Psyllid ID: psy1145

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MATNFELLTIGEFPGLSYRNCALSQLWQFESIITGSFRYGDKTEGRSVFVQEYFRPDESHLGARRGAVGMRRIKKTSENKGLVGSQFRIILNHQKQFTGIFGQVIYGLEYIDAISTYSNAQGQPTERFYISNCGKWEG
ccccccHHHcccccccccccccccEEEcccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccEEcEEEEEcHHHHHHHHHcccccccccccEEEEccccccc
cHHHHHHHHccccccccccccEEEEEccccEEEccccEcccccccccccccccccccccccccccccccHHccccccccccccccEEEEEEcccccccccEEEEEcHHHHHHHHHHccccccccccEEEEEccccccc
MATNFELltigefpglsyrncalSQLWQFESiitgsfrygdktegrsvfvqeyfrpdeshlgarrGAVGMRRIkktsenkglvgsQFRIILNHQKQFTGIFGQVIYGLEYIDAIstysnaqgqpterfyisncgkweg
MATNFELLTIGEFPGLSYRNCALSQLWQFESIITGSFRYGDKTEGRSVFVQeyfrpdeshlgarrgavgmrrikktsenkglvgsqFRIILNHQKQFTGIFGQVIYGLEYIDAISTysnaqgqpterfyisncgkweg
MATNFELLTIGEFPGLSYRNCALSQLWQFESIITGSFRYGDKTEGRSVFVQEYFRPDESHLGARRGAVGMRRIKKTSENKGLVGSQFRIILNHQKQFTGIFGQVIYGLEYIDAISTYSNAQGQPTERFYISNCGKWEG
****FELLTIGEFPGLSYRNCALSQLWQFESIITGSFRYGDKTEGRSVFVQEYFRPD**********V***********KGLVGSQFRIILNHQKQFTGIFGQVIYGLEYIDAISTYSNAQGQPTERFYISNCG****
MATNFELLTIGEFPGLSYRNCALSQLWQFESIITGSFRYGDKTEGRSVFVQEYFRPDESHLGARRGAVGMRRIKKTSENKGLVGSQFRIILNHQKQFTGIFGQVIYGLEYID***T***********FYISNCGKWEG
MATNFELLTIGEFPGLSYRNCALSQLWQFESIITGSFRYGDKTEGRSVFVQEYFRPDESHLGARRGAVGMRRIKKTSENKGLVGSQFRIILNHQKQFTGIFGQVIYGLEYIDAISTYSNAQGQPTERFYISNCGKWEG
*ATNFELLTIGEFPGLSYRNCALSQLWQFESIITGSFRYGDKTEGRSVFVQEYFRPDESHLGARRGAVGMRRIKKTSENKGLVGSQFRIILNHQKQFTGIFGQVIYGLEYIDAISTYSNAQGQPTERFYISNCGKW**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATNFELLTIGEFPGLSYRNCALSQLWQFESIITGSFRYGDKTEGRSVFVQEYFRPDESHLGARRGAVGMRRIKKTSENKGLVGSQFRIILNHQKQFTGIFGQVIYGLEYIDAISTYSNAQGQPTERFYISNCGKWEG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query138 2.2.26 [Sep-21-2011]
P23284216 Peptidyl-prolyl cis-trans yes N/A 0.898 0.574 0.309 8e-07
P24368216 Peptidyl-prolyl cis-trans yes N/A 0.898 0.574 0.295 8e-06
P80311216 Peptidyl-prolyl cis-trans yes N/A 0.898 0.574 0.295 8e-06
Q26548273 Peptidyl-prolyl cis-trans N/A N/A 0.927 0.468 0.270 5e-05
P24369216 Peptidyl-prolyl cis-trans yes N/A 0.898 0.574 0.295 6e-05
Q26516179 Peptidyl-prolyl cis-trans N/A N/A 0.927 0.715 0.262 8e-05
O93826226 Peptidyl-prolyl cis-trans N/A N/A 0.942 0.575 0.264 0.0002
Q01490203 Peptidyl-prolyl cis-trans N/A N/A 0.913 0.620 0.272 0.0002
Q38867176 Peptidyl-prolyl cis-trans yes N/A 0.949 0.744 0.241 0.0002
Q9SKQ0174 Peptidyl-prolyl cis-trans no N/A 0.898 0.712 0.256 0.0003
>sp|P23284|PPIB_HUMAN Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens GN=PPIB PE=1 SV=2 Back     alignment and function desciption
 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 69/142 (48%), Gaps = 18/142 (12%)

Query: 4   NFELLTIGEFPGLSYRNCALSQLWQFESIITGSFRYGDKTEGRSVFVQEYFRPDES---- 59
           NF  L  GE  G  Y+N    ++ +   I  G F  GD T G+S++ + +  PDE+    
Sbjct: 75  NFVALATGE-KGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERF--PDENFKLK 131

Query: 60  HLGARRGAVGMRRIKKTSENKGLVGSQFRIILNHQKQFTG---IFGQVIYGLEYIDAI-S 115
           H G   G V M    K +      GSQF I         G   +FG+V+ G+E +  + S
Sbjct: 132 HYGP--GWVSMANAGKDTN-----GSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVES 184

Query: 116 TYSNAQGQPTERFYISNCGKWE 137
           T ++++ +P +   I++CGK E
Sbjct: 185 TKTDSRDKPLKDVIIADCGKIE 206
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Homo sapiens (taxid: 9606)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|P24368|PPIB_RAT Peptidyl-prolyl cis-trans isomerase B OS=Rattus norvegicus GN=Ppib PE=2 SV=3 Back     alignment and function description
>sp|P80311|PPIB_BOVIN Peptidyl-prolyl cis-trans isomerase B OS=Bos taurus GN=PPIB PE=1 SV=4 Back     alignment and function description
>sp|Q26548|PPIE_SCHMA Peptidyl-prolyl cis-trans isomerase E OS=Schistosoma mansoni PE=1 SV=2 Back     alignment and function description
>sp|P24369|PPIB_MOUSE Peptidyl-prolyl cis-trans isomerase B OS=Mus musculus GN=Ppib PE=2 SV=2 Back     alignment and function description
>sp|Q26516|PPIE_SCHJA Peptidyl-prolyl cis-trans isomerase E (Fragment) OS=Schistosoma japonicum PE=2 SV=1 Back     alignment and function description
>sp|O93826|PPIB_ARTBE Peptidyl-prolyl cis-trans isomerase B OS=Arthroderma benhamiae GN=CPR2 PE=2 SV=1 Back     alignment and function description
>sp|Q01490|PPIB_ORPSP Peptidyl-prolyl cis-trans isomerase B OS=Orpinomyces sp. (strain PC-2) GN=CYPB PE=1 SV=1 Back     alignment and function description
>sp|Q38867|CP19C_ARATH Peptidyl-prolyl cis-trans isomerase CYP19-3 OS=Arabidopsis thaliana GN=CYP19-3 PE=2 SV=2 Back     alignment and function description
>sp|Q9SKQ0|CP19B_ARATH Peptidyl-prolyl cis-trans isomerase CYP19-2 OS=Arabidopsis thaliana GN=CYP19-2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
189239910 537 PREDICTED: similar to peptidyl-prolyl ci 0.971 0.249 0.525 1e-34
332020703 608 Peptidyl-prolyl cis-trans isomerase, mit 0.971 0.220 0.503 1e-33
345485484 635 PREDICTED: hypothetical protein LOC10011 0.971 0.211 0.503 3e-33
350406728 599 PREDICTED: hypothetical protein LOC10074 0.971 0.223 0.496 4e-33
340721570 573 PREDICTED: hypothetical protein LOC10064 0.971 0.233 0.496 4e-33
328793001 599 PREDICTED: hypothetical protein LOC10057 0.971 0.223 0.496 4e-33
383861573 599 PREDICTED: uncharacterized protein LOC10 0.971 0.223 0.496 5e-33
380028901 599 PREDICTED: uncharacterized protein LOC10 0.971 0.223 0.496 6e-33
328793003 485 PREDICTED: hypothetical protein LOC10057 0.971 0.276 0.496 1e-32
307175903 611 Peptidyl-prolyl cis-trans isomerase, mit 0.971 0.219 0.488 1e-32
>gi|189239910|ref|XP_001811161.1| PREDICTED: similar to peptidyl-prolyl cis-trans isomerase (cyclophilin) [Tribolium castaneum] gi|270012115|gb|EFA08563.1| hypothetical protein TcasGA2_TC006218 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  150 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 71/135 (52%), Positives = 90/135 (66%), Gaps = 1/135 (0%)

Query: 1   MATNFELLTIGEFPGLSYRNCALSQLWQFESIITGSFRYGDKTEGRSVFVQEYFRPDESH 60
           MA NF LLT GE  G+ Y+ C + Q W+ ES+ITG F   +   GRS+F   YF PD++ 
Sbjct: 403 MAKNFGLLTTGE-AGMGYKGCQIFQCWEGESVITGDFELNNGRGGRSIFEDSYFLPDDTK 461

Query: 61  LGARRGAVGMRRIKKTSENKGLVGSQFRIILNHQKQFTGIFGQVIYGLEYIDAISTYSNA 120
           L A RG VGMRR +K  +N G+VGSQFRIIL   + FTGIFG VI GLE ++ ISTY + 
Sbjct: 462 LMAVRGTVGMRRTQKRHDNLGMVGSQFRIILQEMRGFTGIFGHVIEGLELVEKISTYGDT 521

Query: 121 QGQPTERFYISNCGK 135
            G+PT+   I+ CGK
Sbjct: 522 AGKPTKNILIAKCGK 536

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332020703|gb|EGI61108.1| Peptidyl-prolyl cis-trans isomerase, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345485484|ref|XP_001606888.2| PREDICTED: hypothetical protein LOC100119773 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350406728|ref|XP_003487863.1| PREDICTED: hypothetical protein LOC100745937 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340721570|ref|XP_003399191.1| PREDICTED: hypothetical protein LOC100649267 [Bombus terrestris] Back     alignment and taxonomy information
>gi|328793001|ref|XP_003251809.1| PREDICTED: hypothetical protein LOC100577578 isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|383861573|ref|XP_003706260.1| PREDICTED: uncharacterized protein LOC100875281 [Megachile rotundata] Back     alignment and taxonomy information
>gi|380028901|ref|XP_003698122.1| PREDICTED: uncharacterized protein LOC100869801 [Apis florea] Back     alignment and taxonomy information
>gi|328793003|ref|XP_003251810.1| PREDICTED: hypothetical protein LOC100577578 isoform 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|307175903|gb|EFN65716.1| Peptidyl-prolyl cis-trans isomerase, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
FB|FBgn0039347680 CG5071 [Drosophila melanogaste 0.978 0.198 0.463 1.3e-26
UNIPROTKB|P23284216 PPIB "Peptidyl-prolyl cis-tran 0.927 0.592 0.297 3.3e-08
TIGR_CMR|NSE_0851219 NSE_0851 "peptidyl-prolyl cis- 0.934 0.589 0.280 1.4e-07
UNIPROTKB|F1PLV2216 PPIB "Peptidyl-prolyl cis-tran 0.927 0.592 0.289 1.7e-07
RGD|620312216 Ppib "peptidylprolyl isomerase 0.927 0.592 0.282 2.9e-07
ZFIN|ZDB-GENE-030131-7459164 ppiab "peptidylprolyl isomeras 0.927 0.780 0.255 4.8e-07
UNIPROTKB|P80311216 PPIB "Peptidyl-prolyl cis-tran 0.927 0.592 0.282 5e-07
UNIPROTKB|P14851164 PPIA "Peptidyl-prolyl cis-tran 0.927 0.780 0.255 6.1e-07
UNIPROTKB|Q9TTC6164 PPIA "Peptidyl-prolyl cis-tran 0.927 0.780 0.255 7.8e-07
FB|FBgn0036415164 CG7768 [Drosophila melanogaste 0.920 0.774 0.257 1e-06
FB|FBgn0039347 CG5071 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 308 (113.5 bits), Expect = 1.3e-26, P = 1.3e-26
 Identities = 63/136 (46%), Positives = 80/136 (58%)

Query:     1 MATNFELLTIGEFPGLSYRNCALSQLWQFESIITGSFRYGDKTEGRSVFVQEYFRPDESH 60
             MA NF  L   E  G  YR C + Q W  ESIITG F   +   G S F   YF PDE+ 
Sbjct:   542 MADNFGALVRHE-RGYGYRGCTVFQAWGGESIITGDFESQNGRGGHSAFESRYFLPDETG 600

Query:    61 LGARRGAVGMRRIKKTSENKGLVGSQFRIILNHQKQFTGIFGQVIYGLEYIDAISTYSNA 120
             L A RG VGMRR ++  +  G VGSQFR++LN  + FT IFG ++ G+E +D I+   NA
Sbjct:   601 LPAHRGTVGMRRGQRRQDRSGFVGSQFRLVLNEMRSFTAIFGFIVQGIELVDRIAASGNA 660

Query:   121 QGQPTERFYISNCGKW 136
              G+P  R  I NCG++
Sbjct:   661 LGRPALRSIIRNCGEY 676
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0006457 "protein folding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
UNIPROTKB|P23284 PPIB "Peptidyl-prolyl cis-trans isomerase B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TIGR_CMR|NSE_0851 NSE_0851 "peptidyl-prolyl cis-trans isomerase, cyclophilin-type" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] Back     alignment and assigned GO terms
UNIPROTKB|F1PLV2 PPIB "Peptidyl-prolyl cis-trans isomerase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|620312 Ppib "peptidylprolyl isomerase B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7459 ppiab "peptidylprolyl isomerase Ab (cyclophilin A)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P80311 PPIB "Peptidyl-prolyl cis-trans isomerase B" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P14851 PPIA "Peptidyl-prolyl cis-trans isomerase A" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
UNIPROTKB|Q9TTC6 PPIA "Peptidyl-prolyl cis-trans isomerase A" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
FB|FBgn0036415 CG7768 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.1LOW CONFIDENCE prediction!
4th Layer5.2.1.8LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 1e-10
cd00317146 cd00317, cyclophilin, cyclophilin: cyclophilin-typ 4e-07
COG0652158 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase 1e-04
cd01926164 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik 3e-04
PTZ00060183 PTZ00060, PTZ00060, cyclophilin; Provisional 9e-04
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information 
 Score = 55.0 bits (133), Expect = 1e-10
 Identities = 29/121 (23%), Positives = 46/121 (38%), Gaps = 17/121 (14%)

Query: 18  YRNCALSQLWQFESIITGSFRYGDKTEGRSVFVQEYFRPDESH--LGARRGAVGMRRIKK 75
           Y      ++     I  G          RS+       PDE    L  +RG + M R   
Sbjct: 36  YDGTIFHRVIPGFMIQGGDPTGPGTGGKRSI-------PDEFVSKLKHKRGTLSMAR--- 85

Query: 76  TSENKGLVGSQFRIILNHQKQFTG---IFGQVIYGLEYIDAISTYSNAQGQPTERFYISN 132
           +  N    GSQF I L       G   +FG+V+ G++ ++ I        +P +   I++
Sbjct: 86  SGPNSA--GSQFFITLGDAPHLDGGYTVFGRVVEGMDVVEKIEKVETDGDRPLKDVKITS 143

Query: 133 C 133
           C
Sbjct: 144 C 144

The peptidyl-prolyl cis-trans isomerases, also known as cyclophilins, share this domain of about 109 amino acids. Cyclophilins have been found in all organisms studied so far and catalyze peptidyl-prolyl isomerisation during which the peptide bond preceding proline (the peptidyl-prolyl bond) is stabilised in the cis conformation. Mammalian cyclophilin A (CypA) is a major cellular target for the immunosuppressive drug cyclosporin A (CsA). Other roles for cyclophilins may include chaperone and cell signalling function. Length = 144
>gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 138
KOG0546|consensus 372 100.0
KOG0880|consensus217 100.0
KOG0111|consensus298 100.0
KOG0879|consensus177 100.0
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 100.0
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 100.0
PTZ00060183 cyclophilin; Provisional 100.0
KOG0881|consensus164 100.0
PTZ00221249 cyclophilin; Provisional 100.0
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 100.0
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 100.0
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 100.0
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 100.0
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 100.0
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 100.0
KOG0865|consensus167 100.0
KOG0883|consensus518 100.0
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 100.0
cd01925171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 100.0
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 100.0
KOG0882|consensus558 100.0
cd01920155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 100.0
KOG0884|consensus161 100.0
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 100.0
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 99.98
cd01924176 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc 99.97
KOG0415|consensus 479 99.97
KOG0885|consensus 439 99.95
KOG0882|consensus 558 96.69
PRK00969 508 hypothetical protein; Provisional 93.99
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 93.77
COG4070 512 Predicted peptidyl-prolyl cis-trans isomerase (rot 90.95
>KOG0546|consensus Back     alignment and domain information 
Probab=100.00  E-value=7.3e-50  Score=314.15  Aligned_cols=129  Identities=29%  Similarity=0.407  Sum_probs=121.8

Q ss_pred             ChhhhHHHhcCCCCC--------eeecCCEEEEEeCCcEEEeCCCCCCCCCCccccccccccCCCCCCCCCC--cceeee
Q psy1145           1 MATNFELLTIGEFPG--------LSYRNCALSQLWQFESIITGSFRYGDKTEGRSVFVQEYFRPDESHLGAR--RGAVGM   70 (138)
Q Consensus         1 ~~~NF~~L~~g~~~g--------~~Y~gt~f~ri~~~~~iq~Gd~~~~~~~g~~si~g~~~~~~~e~~~~~h--~G~lsm   70 (138)
                      +||||++||+|+ +|        ++|+|+.||||+++|||||||++.++|+||.||||+.|  +||+|.++|  +++|||
T Consensus        37 TaENFraLCtGE-~G~~~~~gk~L~YKG~~FHRViK~FMiQgGDfs~gnGtGGeSIYG~~F--dDEnF~lKHdrpflLSM  113 (372)
T KOG0546|consen   37 TAENFRALCTGE-KGGGLTTGKPLHYKGSRFHRVIKNFMIQGGDFSEGNGTGGESIYGEKF--DDENFELKHDRPFLLSM  113 (372)
T ss_pred             hHHHHHHHhccc-cCCCCCCCCeeeecCchhheeeecceeeccccccCCCCCccccccccc--ccccceeccCcchhhhh
Confidence            489999999999 65        58999999999999999999999999999999999988  999999998  799999


Q ss_pred             eccccCCCCCCcceeeEEEEecC---CCCCCeEEEEEEcCHHHHHHHhcCCC-CCCCcccceEEeeeeEec
Q psy1145          71 RRIKKTSENKGLVGSQFRIILNH---QKQFTGIFGQVIYGLEYIDAISTYSN-AQGQPTERFYISNCGKWE  137 (138)
Q Consensus        71 ~~~~~~~~~~~~~~SqF~Itl~~---ld~~~~vfG~Vv~G~~vl~~i~~~~~-~~~~P~~~v~I~~cg~l~  137 (138)
                      ||.||     |+||||||||+.+   |||+|||||+||+|++||+.|+.+.+ .+.+|+.+|+|.+||+|.
T Consensus       114 AN~Gp-----NTNgSQFFITT~p~PHLdGkHVVFGqVI~G~~VVr~IEn~~~d~~skP~~dV~I~dCGel~  179 (372)
T KOG0546|consen  114 ANRGP-----NTNGSQFFITTVPTPHLDGKHVVFGQVIKGKEVVREIENLETDEESKPLADVVISDCGELV  179 (372)
T ss_pred             hcCCC-----CCCCcceEEeCCCCCCcCCceeEEeeEeechhHHHHHhccccccCCCCccceEeccccccc
Confidence            99997     8999999999985   99999999999999999999999997 445899999999999985

>KOG0880|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0879|consensus Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>KOG0881|consensus Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>KOG0865|consensus Back     alignment and domain information
>KOG0883|consensus Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>KOG0884|consensus Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0885|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
1cyn_A178 Cyclophilin B Complexed With [d-(Cholinylester)ser8 8e-08
3ich_A188 Crystal Structure Of Cyclophilin B At 1.2 A Resolut 8e-08
4fru_A185 Crystal Structure Of Horse Wild-Type Cyclophilin B 6e-07
4frv_A185 Crystal Structure Of Mutated Cyclophilin B That Cau 7e-07
2ck1_A172 The Structure Of Oxidised Cyclophilin A From S. Man 3e-06
4dgd_A165 Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 4e-05
3qyu_A164 Crystal Structure Of Human Cyclophilin D At 1.54 A 4e-05
2z6w_A165 Crystal Structure Of Human Cyclophilin D In Complex 4e-05
2wlw_A165 Structure Of The N-Terminal Capsid Domain Of Hiv-2 4e-05
2bit_X165 Crystal Structure Of Human Cyclophilin D At 1.7 A R 4e-05
3r49_A166 Human Cyclophilin D Complexed With Quinolin-8-Amine 5e-05
2x2a_A165 Free Acetyl-Cypa Trigonal Form Length = 165 5e-05
2cfe_A162 The 1.5 A Crystal Structure Of The Malassezia Sympo 5e-05
2x25_B169 Free Acetyl-Cypa Orthorhombic Form Length = 169 6e-05
1dyw_A173 Biochemical And Structural Characterization Of A Di 6e-05
2hqj_A183 Cyclophilin From Leishmania Major Length = 183 8e-05
2alf_A164 Crystal Structure Of Human Cypa Mutant K131a Length 8e-05
3k0r_A165 Cryogenic Structure Of Cypa Mutant Arg55lys Length 1e-04
3k0o_A165 Room Temperature Structure Of Cypa Mutant Ser99thr 1e-04
2rma_A165 Crystal Structures Of Cyclophilin A Complexed With 1e-04
2x2c_K165 Acetyl-Cypa:cyclosporine Complex Length = 165 1e-04
2x83_B163 Evolutionary Basis Of Hiv Restriction By The Antire 1e-04
1bck_A165 Human Cyclophilin A Complexed With 2-Thr Cyclospori 2e-04
5cyh_A164 Cyclophilin A Complexed With Dipeptide Gly-Pro Leng 2e-04
3rdd_A184 Human Cyclophilin A Complexed With An Inhibitor Len 2e-04
2xgy_B173 Complex Of Rabbit Endogenous Lentivirus (Relik)caps 2e-04
1zmf_A165 C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 2e-04
2r99_A173 Crystal Structure Of Cyclophilin Abh-Like Domain Of 3e-04
3uch_A174 Crystal Structure Of A Hypotherical Peptidyl-Prolyl 5e-04
1m9e_A164 X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- 5e-04
>pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 Back     alignment and structure 
Iteration: 1

 Score = 52.4 bits (124), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 69/142 (48%), Gaps = 18/142 (12%)
Query: 4   NFELLTIGEFPGLSYRNCALSQLWQFESIITGSFRYGDKTEGRSVFVQEYFRPDES---- 59
           NF  L  GE  G  Y+N    ++ +   I  G F  GD T G+S++ + +  PDE+    
Sbjct: 37  NFVALATGE-KGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERF--PDENFKLK 93
Query: 60  HLGARRGAVGMRRIKKTSENKGLVGSQFRIILNHQKQFTG---IFGQVIYGLEYIDAI-S 115
           H G   G V M    K +      GSQF I         G   +FG+V+ G+E +  + S
Sbjct: 94  HYGP--GWVSMANAGKDTN-----GSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVES 146
Query: 116 TYSNAQGQPTERFYISNCGKWE 137
           T ++++ +P +   I++CGK E
Sbjct: 147 TKTDSRDKPLKDVIIADCGKIE 168
>pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 Back     alignment and structure
>pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 Back     alignment and structure
>pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 Back     alignment and structure
>pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 Back     alignment and structure
>pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 Back     alignment and structure
>pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 Back     alignment and structure
>pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 Back     alignment and structure
>pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 Back     alignment and structure
>pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 Back     alignment and structure
>pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 Back     alignment and structure
>pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 Back     alignment and structure
>pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 Back     alignment and structure
>pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 Back     alignment and structure
>pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 Back     alignment and structure
>pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 Back     alignment and structure
>pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 Back     alignment and structure
>pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 Back     alignment and structure
>pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 Back     alignment and structure
>pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 Back     alignment and structure
>pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 Back     alignment and structure
>pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 Back     alignment and structure
>pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 Back     alignment and structure
>pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 Back     alignment and structure
>pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 Back     alignment and structure
>pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 Back     alignment and structure
>pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 Back     alignment and structure
>pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 Back     alignment and structure
>pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 Back     alignment and structure
>pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 7e-09
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 1e-05
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 4e-05
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 4e-05
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 5e-05
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 6e-05
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 7e-05
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 8e-05
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 1e-04
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 4e-04
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 6e-04
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 7e-04
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 9e-04
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
 Score = 51.6 bits (124), Expect = 7e-09
 Identities = 41/158 (25%), Positives = 55/158 (34%), Gaps = 39/158 (24%)

Query: 2   ATNFELLTIGEF-------PGLSYRNCALSQLWQFESIIT------GSFRYGDKTEGRSV 48
           A NF  L  GE          L ++ C       F  II       G F   + T G S+
Sbjct: 45  AENFRALCTGEKGIGPTTGKPLHFKGC------PFHRIIKKFMIQGGDFSNQNGTGGESI 98

Query: 49  FVQEYFRPDE----SHLGARRGAVGMRRIKKTSENKG--LVGSQFRIILNHQKQFTG--- 99
           +  E F  DE     H     G + M        N G    GSQF I         G   
Sbjct: 99  Y-GEKF-EDENFHYKHDKE--GLLSM-------ANAGSNTNGSQFFITTVPTPHLDGKHV 147

Query: 100 IFGQVIYGLEYIDAISTYSNAQGQPTERFYISNCGKWE 137
           +FGQVI G+     +        +P +   I+ CG+ +
Sbjct: 148 VFGQVIKGMGVAKILENVEVKGEKPAKLCVIAECGELK 185
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 100.0
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 100.0
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 100.0
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 100.0
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 100.0
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 100.0
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 100.0
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 100.0
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 100.0
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 100.0
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 100.0
4fru_A185 Cyclophilin B, peptidyl-prolyl CIS-trans isomerase 100.0
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 100.0
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 100.0
1z81_A229 Cyclophilin; structural genomics, structural genom 100.0
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 100.0
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 100.0
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 100.0
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 100.0
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 100.0
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 100.0
2b71_A196 Cyclophilin-like protein; structural genomics, str 100.0
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 100.0
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 100.0
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 100.0
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 100.0
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 100.0
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 100.0
2hq6_A185 Serologically defined colon cancer antigen 10; pro 100.0
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 100.0
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 100.0
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 100.0
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 99.97
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Back     alignment and structure
Probab=100.00  E-value=5.1e-46  Score=271.25  Aligned_cols=128  Identities=23%  Similarity=0.450  Sum_probs=120.1

Q ss_pred             hhhhHHHhcCCCCCeeecCCEEEEEeCCcEEEeCCCCCCCCCCccccccccccCCCCCCCCCC--cceeeeeccccCCCC
Q psy1145           2 ATNFELLTIGEFPGLSYRNCALSQLWQFESIITGSFRYGDKTEGRSVFVQEYFRPDESHLGAR--RGAVGMRRIKKTSEN   79 (138)
Q Consensus         2 ~~NF~~L~~g~~~g~~Y~gt~f~ri~~~~~iq~Gd~~~~~~~g~~si~g~~~~~~~e~~~~~h--~G~lsm~~~~~~~~~   79 (138)
                      |+||++||+|+ ++++|+++.||||+|+|+||+||++.+++.++.++|+.+|  ++|++.++|  +|+||||+.++    
T Consensus        41 ~~NF~~L~~g~-~g~~Y~g~~FhRvi~~f~iQgGd~~~~~g~gg~si~g~~f--~dE~~~l~h~~~G~lsmA~~gp----  113 (173)
T 2r99_A           41 AENFRCLCTHE-KGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKF--DDENFILKHTGPGLLSMANSGP----  113 (173)
T ss_dssp             HHHHHHHHHTT-TSCCSTTCBEEEEETTTEEEECCTTTSSSSCCCBTTBSCB--CCCCCCSCCCSSSEEEECCSST----
T ss_pred             HHHHHHHhccc-CCceecCCEEEEeeCCCEEEeCCcCCCCCCCCCccCCCcc--cCcccCcccCCCcEEEEccCCC----
Confidence            79999999988 8888999999999999999999998889999999999887  899887777  79999999876    


Q ss_pred             CCcceeeEEEEecC---CCCCCeEEEEEEcCHHHHHHHhcCCCCCCCcccceEEeeeeEec
Q psy1145          80 KGLVGSQFRIILNH---QKQFTGIFGQVIYGLEYIDAISTYSNAQGQPTERFYISNCGKWE  137 (138)
Q Consensus        80 ~~~~~SqF~Itl~~---ld~~~~vfG~Vv~G~~vl~~i~~~~~~~~~P~~~v~I~~cg~l~  137 (138)
                       ++++|||||++.+   ||++|+|||||++|||||++|+++++.+++|.++|+|.+||+|.
T Consensus       114 -~t~gSQFfIt~~~~~~LDg~~tVFG~Vv~G~dvv~~I~~~~~~~~~P~~~v~I~~cG~l~  173 (173)
T 2r99_A          114 -NTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV  173 (173)
T ss_dssp             -TCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTTCCTTCCCSSCEEEEEEEECC
T ss_pred             -CCcccEEEEECCCCCccCCCeeEEEEEEcCHHHHHHHHhCCCCCCCCCCCeEEEEeeeEC
Confidence             8999999999985   99999999999999999999999999889999999999999984
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Back     alignment and structure
>4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 138
d2igva1172 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno 1e-12
d2cfea1162 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 3e-12
d1a33a_174 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( 6e-11
d1qnga_170 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium 1e-10
d1ihga2195 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain 2e-10
d2z6wa1164 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c 2e-10
d1h0pa_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd 6e-10
d2rmca_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus 1e-09
d1qoia_173 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom 1e-08
d1xo7a_166 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom 4e-08
d2c3ba1171 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper 5e-08
d2r99a1161 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl 5e-07
d1z81a1186 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas 2e-06
d2fu0a1155 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { 8e-05
d2b71a1169 b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 1e-04
d1xwna1166 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome 5e-04
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 Back     information, alignment and structure

class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Cyclophilin (eukaryotic)
species: Caenorhabditis elegans, isoform 3 [TaxId: 6239]

 Score = 59.4 bits (143), Expect = 1e-12
 Identities = 22/122 (18%), Positives = 50/122 (40%), Gaps = 2/122 (1%)

Query: 16  LSYRNCALSQLWQFESIITGSFRYGDKTEGRSVFVQEYFRPDESHLGARRGAVGMRRIKK 75
           L ++     ++     I  G F  G+ T G S++ +++   +        G + M     
Sbjct: 53  LHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGP 112

Query: 76  TSENKGLVGSQFRIILNHQKQFTGIFGQVIYGLEYIDAISTYSNAQGQPTERFYISNCGK 135
            +   G       +          +FG+V+ GL+ + A+ +  +  G+P +   I++CG+
Sbjct: 113 NT--NGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQSGKPVKDCMIADCGQ 170

Query: 136 WE 137
            +
Sbjct: 171 LK 172
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 100.0
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 100.0
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 100.0
d2rmca_182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 100.0
d1h0pa_182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d1ihga2195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 100.0
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 100.0
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 100.0
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 100.0
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 100.0
d2ok3a1159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 100.0
d1zkca1178 Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop 100.0
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 100.0
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 100.0
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 100.0
d1v9ta_166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 99.98
d1lopa_164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 99.97
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 99.97
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Cyclophilin (eukaryotic)
species: Caenorhabditis elegans, isoform 3 [TaxId: 6239]

Probab=100.00  E-value=1.6e-39  Score=234.62  Aligned_cols=129  Identities=26%  Similarity=0.475  Sum_probs=115.4

Q ss_pred             ChhhhHHHhcCCC-------CCeeecCCEEEEEeCCcEEEeCCCCCCCCCCccccccccccCCCCCCCCCC--cceeeee
Q psy1145           1 MATNFELLTIGEF-------PGLSYRNCALSQLWQFESIITGSFRYGDKTEGRSVFVQEYFRPDESHLGAR--RGAVGMR   71 (138)
Q Consensus         1 ~~~NF~~L~~g~~-------~g~~Y~gt~f~ri~~~~~iq~Gd~~~~~~~g~~si~g~~~~~~~e~~~~~h--~G~lsm~   71 (138)
                      .|+||++||+++.       .++ |+++.||||+|++++|+||....++.++..++++++  ++|.....|  +|+||||
T Consensus        32 tv~nF~~L~~~~~~~~~~~k~~~-y~~~~f~rv~~~~~i~~G~~~~~~~~~~~~~~~~~~--~~e~~~~~~~~~G~lsma  108 (172)
T d2igva1          32 TAGNFRALCTGENGIGKSGKPLH-FKGSKFHRIIPNFMIQGGDFTRGNGTGGESIYGEKF--PDENFKEKHTGPGVLSMA  108 (172)
T ss_dssp             HHHHHHHHHHTTTCBCTTSSBSC-CTTCBCCEEETTTEEEECCTTTSSSSCCCBTTBSCB--CCCCCCSCCCSTTEEEEC
T ss_pred             HHHHHHHHHhccccccccCcccc-cCCcceeEEEecceEEcCCccCCCCCCCcccCCCcc--CccccccccCCCcEEEEe
Confidence            3799999998751       234 999999999999999999998888899999998877  777665443  7999999


Q ss_pred             ccccCCCCCCcceeeEEEEecC---CCCCCeEEEEEEcCHHHHHHHhcCCCCCCCcccceEEeeeeEec
Q psy1145          72 RIKKTSENKGLVGSQFRIILNH---QKQFTGIFGQVIYGLEYIDAISTYSNAQGQPTERFYISNCGKWE  137 (138)
Q Consensus        72 ~~~~~~~~~~~~~SqF~Itl~~---ld~~~~vfG~Vv~G~~vl~~i~~~~~~~~~P~~~v~I~~cg~l~  137 (138)
                      +.++     ++++|||||++.+   ||++|+|||||++|||||++|+.+++.+++|.++|+|++||+|+
T Consensus       109 ~~~~-----~~~~sqFfIt~~~~~~ld~~~~vFG~Vv~Gmdvl~~I~~~~~~~g~P~~~i~I~~cG~l~  172 (172)
T d2igva1         109 NAGP-----NTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQSGKPVKDCMIADCGQLK  172 (172)
T ss_dssp             CSST-----TCBSSCEEEESSCCGGGTTTSCEEEEEEECHHHHHHHHTTCCTTSCCSSCEEEEEEEEEC
T ss_pred             ecCC-----CCcCceeEeeecCCcccCCceeEEEEEeccHHHHHHHHcCCCCCCCCCCCeEEEeccccC
Confidence            8765     7999999999985   89999999999999999999999999999999999999999996
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure