Psyllid ID: psy11470

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MSIEVFEIRANTWTEIGHLRNRRLQFGAEVLNGKIHVVGGRDGLKTVNTFEYLNTHSDMKDRIEVTWTSLPSMLTHRHGLGKASLHIYIQNVPEGLVYHKAMSSRKWRIVQVKG
ccEEEEEcccccEEEEccccccccccEEEEEccEEEEEccccccccccEEEEEEccccccccccccEEEccccccccccEEEEEEcEEEEEEccccEEEccEEEccEEEEEEcc
ccEEEEccccccEEEEcccccccccEEEEEEccEEEEEEcccccccccEEEEEccccccccccccccEEccccccccccEEEEEEEEEEEEccccccccccEEccccEEEEccc
MSIEVFEIRANTWTEIGHLRNRRLQFGAEVlngkihvvggrdglktvntfeylnthsdmkdRIEVTWtslpsmlthrhglgkaSLHIYIQNVPEGLVYHKAMSSRKWRIVQVKG
msievfeirantwteighlrNRRLQFGAEVLNGKihvvggrdglktVNTFEYlnthsdmkdrIEVTWTSLPSMLTHRHGLGKASLHIYIQNVPEGLVYHKamssrkwrivqvkg
MSIEVFEIRANTWTEIGHLRNRRLQFGAEVLNGKIHVVGGRDGLKTVNTFEYLNTHSDMKDRIEVTWTSLPSMLTHRHGLGKASLHIYIQNVPEGLVYHKAMSSRKWRIVQVKG
***EVFEIRANTWTEIGHLRNRRLQFGAEVLNGKIHVVGGRDGLKTVNTFEYLNTHSDMKDRIEVTWTSLPSMLTHRHGLGKASLHIYIQNVPEGLVYHKAMSSRKWRIV****
MSIEVFEIRANTWTEIGHLRNRRLQFGAEVLNGKIHVVGGRDGLKTVNTFEYLNTHSDMKDRIEVTWTSLPSMLTHRHGLGKASLHIYIQNVPEGLVYHKAMSSRKWRIVQVKG
MSIEVFEIRANTWTEIGHLRNRRLQFGAEVLNGKIHVVGGRDGLKTVNTFEYLNTHSDMKDRIEVTWTSLPSMLTHRHGLGKASLHIYIQNVPEGLVYHKAMSSRKWRIVQVKG
MSIEVFEIRANTWTEIGHLRNRRLQFGAEVLNGKIHVVGGRDGLKTVNTFEYLNTHSDMKDRIEVTWTSLPSMLTHRHGLGKASLHIYIQNVPEGLVYHKAMSSRKWRIVQV**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIEVFEIRANTWTEIGHLRNRRLQFGAEVLNGKIHVVGGRDGLKTVNTFEYLNTHSDMKDRIEVTWTSLPSMLTHRHGLGKASLHIYIQNVPEGLVYHKAMSSRKWRIVQVKG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query114 2.2.26 [Sep-21-2011]
Q96PQ7 755 Kelch-like protein 5 OS=H no N/A 0.894 0.135 0.422 6e-19
Q9C0H6 718 Kelch-like protein 4 OS=H no N/A 0.675 0.107 0.5 7e-18
Q9NR64 748 Kelch-like protein 1 OS=H no N/A 0.894 0.136 0.413 2e-17
Q9JI74 751 Kelch-like protein 1 OS=M no N/A 0.894 0.135 0.413 2e-17
B0WWP2582 Kelch-like protein diablo N/A N/A 0.885 0.173 0.260 3e-07
Q7QGL0582 Kelch-like protein diablo no N/A 0.885 0.173 0.260 3e-07
Q16RL8589 Kelch-like protein diablo N/A N/A 0.885 0.171 0.260 3e-07
O94889 574 Kelch-like protein 18 OS= no N/A 0.771 0.153 0.309 4e-07
Q9Z2X8624 Kelch-like ECH-associated no N/A 0.657 0.120 0.329 4e-07
Q5R774624 Kelch-like ECH-associated no N/A 0.657 0.120 0.304 9e-07
>sp|Q96PQ7|KLHL5_HUMAN Kelch-like protein 5 OS=Homo sapiens GN=KLHL5 PE=2 SV=3 Back     alignment and function desciption
 Score = 92.8 bits (229), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 49/116 (42%), Positives = 67/116 (57%), Gaps = 14/116 (12%)

Query: 2   SIEVFEIRANTWTEIGHLRNRRLQFGAEVLNGKIHVVGGRDGLKTVNTFEYLNTHSDMKD 61
           SIE +++R N WT + ++  RRLQFG  VL+ K++VVGGRDGLKT+NT E  N  +    
Sbjct: 483 SIEKYDLRTNMWTPVANMNGRRLQFGVAVLDDKLYVVGGRDGLKTLNTVECYNPKTK--- 539

Query: 62  RIEVTWTSLPSMLTHRHGLGKASLH--IYIQNVPEGLVYHKAM-----SSRKWRIV 110
               TW+ +P M THRHGLG A L   +Y     +G  Y   +      +R+W  V
Sbjct: 540 ----TWSVMPPMSTHRHGLGVAVLEGPMYAVGGHDGWSYLNTVERWDPQARQWNFV 591

Homo sapiens (taxid: 9606)
>sp|Q9C0H6|KLHL4_HUMAN Kelch-like protein 4 OS=Homo sapiens GN=KLHL4 PE=1 SV=2 Back     alignment and function description
>sp|Q9NR64|KLHL1_HUMAN Kelch-like protein 1 OS=Homo sapiens GN=KLHL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9JI74|KLHL1_MOUSE Kelch-like protein 1 OS=Mus musculus GN=Klhl1 PE=1 SV=2 Back     alignment and function description
>sp|B0WWP2|KLHDB_CULQU Kelch-like protein diablo OS=Culex quinquefasciatus GN=dbo PE=3 SV=2 Back     alignment and function description
>sp|Q7QGL0|KLHDB_ANOGA Kelch-like protein diablo OS=Anopheles gambiae GN=dbo PE=3 SV=4 Back     alignment and function description
>sp|Q16RL8|KLHDB_AEDAE Kelch-like protein diablo OS=Aedes aegypti GN=dbo PE=3 SV=1 Back     alignment and function description
>sp|O94889|KLH18_HUMAN Kelch-like protein 18 OS=Homo sapiens GN=KLHL18 PE=2 SV=3 Back     alignment and function description
>sp|Q9Z2X8|KEAP1_MOUSE Kelch-like ECH-associated protein 1 OS=Mus musculus GN=Keap1 PE=1 SV=1 Back     alignment and function description
>sp|Q5R774|KEAP1_PONAB Kelch-like ECH-associated protein 1 OS=Pongo abelii GN=KEAP1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
449500933 707 PREDICTED: kelch-like 5 [Taeniopygia gut 0.894 0.144 0.448 3e-18
410917478 924 PREDICTED: kelch-like protein 5-like [Ta 0.894 0.110 0.439 5e-18
449273471 581 Kelch-like protein 5, partial [Columba l 0.894 0.175 0.431 7e-18
355698674 490 kelch-like 5 [Mustela putorius furo] 0.745 0.173 0.484 9e-18
7023120 508 unnamed protein product [Homo sapiens] 0.921 0.206 0.420 1e-17
118090606 708 PREDICTED: kelch-like protein 5 [Gallus 0.894 0.144 0.431 1e-17
390336346 579 PREDICTED: LOW QUALITY PROTEIN: kelch-li 0.640 0.126 0.55 1e-17
348529440 790 PREDICTED: kelch-like protein 5-like [Or 0.675 0.097 0.511 2e-17
410957804 902 PREDICTED: LOW QUALITY PROTEIN: kelch-li 0.894 0.113 0.422 2e-17
327273247 741 PREDICTED: kelch-like protein 5-like, pa 0.894 0.137 0.422 2e-17
>gi|449500933|ref|XP_002189617.2| PREDICTED: kelch-like 5 [Taeniopygia guttata] Back     alignment and taxonomy information
 Score = 95.9 bits (237), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 52/116 (44%), Positives = 67/116 (57%), Gaps = 14/116 (12%)

Query: 2   SIEVFEIRANTWTEIGHLRNRRLQFGAEVLNGKIHVVGGRDGLKTVNTFEYLNTHSDMKD 61
           SIE +E+R NTWT + ++  RRLQFG  VL+ K+ VVGGRDGLKT+NT E  N  S    
Sbjct: 435 SIEKYELRTNTWTPVANMNGRRLQFGVAVLDDKLFVVGGRDGLKTLNTVECYNPRSK--- 491

Query: 62  RIEVTWTSLPSMLTHRHGLGKASLH--IYIQNVPEGLVYHKAM-----SSRKWRIV 110
               TW+ +P M THRHGLG A L   +Y     +G  Y   +      +R+W  V
Sbjct: 492 ----TWSVMPPMSTHRHGLGVAVLEGPMYAVGGHDGWSYLNTVERWDPQARQWNFV 543

Source: Taeniopygia guttata

Species: Taeniopygia guttata

Genus: Taeniopygia

Family: Estrildidae

Order: Passeriformes

Class: Aves

Phylum: Chordata

Superkingdom: Eukaryota
>gi|410917478|ref|XP_003972213.1| PREDICTED: kelch-like protein 5-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|449273471|gb|EMC82965.1| Kelch-like protein 5, partial [Columba livia] Back     alignment and taxonomy information
>gi|355698674|gb|AES00876.1| kelch-like 5 [Mustela putorius furo] Back     alignment and taxonomy information
>gi|7023120|dbj|BAA91845.1| unnamed protein product [Homo sapiens] Back     alignment and taxonomy information
>gi|118090606|ref|XP_422912.2| PREDICTED: kelch-like protein 5 [Gallus gallus] Back     alignment and taxonomy information
>gi|390336346|ref|XP_003724329.1| PREDICTED: LOW QUALITY PROTEIN: kelch-like protein 5-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|348529440|ref|XP_003452221.1| PREDICTED: kelch-like protein 5-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|410957804|ref|XP_003985514.1| PREDICTED: LOW QUALITY PROTEIN: kelch-like protein 5 [Felis catus] Back     alignment and taxonomy information
>gi|327273247|ref|XP_003221392.1| PREDICTED: kelch-like protein 5-like, partial [Anolis carolinensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
UNIPROTKB|Q1EG90 708 Klhl5 "Myocardial ischemic pre 0.894 0.144 0.422 7.2e-17
UNIPROTKB|Q96PQ7 755 KLHL5 "Kelch-like protein 5" [ 0.894 0.135 0.422 8e-17
RGD|1565441 717 Klhl4 "kelch-like family membe 0.894 0.142 0.413 1.5e-16
UNIPROTKB|Q9C0H6 718 KLHL4 "Kelch-like protein 4" [ 0.894 0.142 0.413 1.6e-16
UNIPROTKB|F1PQW2 574 KLHL4 "Uncharacterized protein 0.675 0.134 0.5 1.7e-16
UNIPROTKB|D2HZX0 699 KLHL4 "Uncharacterized protein 0.894 0.145 0.413 1.9e-16
UNIPROTKB|F1S1P2 718 KLHL4 "Uncharacterized protein 0.894 0.142 0.413 2e-16
UNIPROTKB|G3X6H8641 KLHL4 "Uncharacterized protein 0.894 0.159 0.413 2.1e-16
UNIPROTKB|F1NIN1 587 KLHL4 "Uncharacterized protein 0.894 0.173 0.405 4.8e-16
UNIPROTKB|F1RJ37 583 KLHL1 "Uncharacterized protein 0.894 0.174 0.413 6.1e-16
UNIPROTKB|Q1EG90 Klhl5 "Myocardial ischemic preconditioning associated protein 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 218 (81.8 bits), Expect = 7.2e-17, P = 7.2e-17
 Identities = 49/116 (42%), Positives = 67/116 (57%)

Query:     2 SIEVFEIRANTWTEIGHLRNRRLQFGAEVLNGKIHVVGGRDGLKTVNTFEYLNTHSDMKD 61
             SIE +++R N WT + ++  RRLQFG  VL+ K++VVGGRDGLKT+NT E  N  +    
Sbjct:   436 SIEKYDLRTNMWTPVANMNGRRLQFGVAVLDDKLYVVGGRDGLKTLNTVECYNPKTK--- 492

Query:    62 RIEVTWTSLPSMLTHRHGLGKASLH--IYIQNVPEGLVYHKAMS-----SRKWRIV 110
                 TW+ +P M THRHGLG A L   +Y     +G  Y   +      +R+W  V
Sbjct:   493 ----TWSVMPPMSTHRHGLGVAVLEGPMYAVGGHDGWSYLNTVERWDPQARQWNFV 544
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
UNIPROTKB|Q96PQ7 KLHL5 "Kelch-like protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1565441 Klhl4 "kelch-like family member 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9C0H6 KLHL4 "Kelch-like protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PQW2 KLHL4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D2HZX0 KLHL4 "Uncharacterized protein" [Ailuropoda melanoleuca (taxid:9646)] Back     alignment and assigned GO terms
UNIPROTKB|F1S1P2 KLHL4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G3X6H8 KLHL4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NIN1 KLHL4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RJ37 KLHL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
pfam0134446 pfam01344, Kelch_1, Kelch motif 4e-08
smart0061247 smart00612, Kelch, Kelch domain 1e-05
PHA03098 534 PHA03098, PHA03098, kelch-like protein; Provisiona 6e-04
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information 
 Score = 45.7 bits (109), Expect = 4e-08
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 7/52 (13%)

Query: 22 RRLQFGAEVLNGKIHVVGGRDGLKTVNTFEYLNTHSDMKDRIEVTWTSLPSM 73
           R   G  VL GKI+V+GG DG +++++ E  +  ++       TW+ LPSM
Sbjct: 1  PRSGAGVVVLGGKIYVIGGYDGGQSLSSVEVYDPETN-------TWSKLPSM 45

The kelch motif was initially discovered in Kelch. In this protein there are six copies of the motif. It has been shown that the Drosophila ring canal kelch protein is related to Galactose Oxidase, for which a structure has been solved. The kelch motif forms a beta sheet. Several of these sheets associate to form a beta propeller structure as found in pfam00064, pfam00400 and pfam00415. Length = 46
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 114
KOG4441|consensus 571 99.91
KOG4441|consensus571 99.91
PHA02713 557 hypothetical protein; Provisional 99.89
PHA02713 557 hypothetical protein; Provisional 99.87
PHA02790480 Kelch-like protein; Provisional 99.84
PHA02790480 Kelch-like protein; Provisional 99.83
PHA03098 534 kelch-like protein; Provisional 99.82
TIGR03548 323 mutarot_permut cyclically-permuted mutatrotase fam 99.82
PLN02153 341 epithiospecifier protein 99.82
PHA03098534 kelch-like protein; Provisional 99.81
PLN02193 470 nitrile-specifier protein 99.81
PLN02153 341 epithiospecifier protein 99.8
PLN02193 470 nitrile-specifier protein 99.79
TIGR03547 346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.78
TIGR03548 323 mutarot_permut cyclically-permuted mutatrotase fam 99.77
TIGR03547 346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.76
PRK14131 376 N-acetylneuraminic acid mutarotase; Provisional 99.74
KOG0379|consensus 482 99.66
PRK14131 376 N-acetylneuraminic acid mutarotase; Provisional 99.66
PF1396450 Kelch_6: Kelch motif 99.59
KOG4693|consensus 392 99.56
KOG4693|consensus 392 99.49
KOG0379|consensus 482 99.49
KOG1230|consensus 521 99.47
KOG1230|consensus 521 99.45
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.43
PF1341549 Kelch_3: Galactose oxidase, central domain 99.32
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 99.31
smart0061247 Kelch Kelch domain. 99.3
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 99.23
PF1385442 Kelch_5: Kelch motif 98.87
PLN02772 398 guanylate kinase 98.76
COG3055 381 Uncharacterized protein conserved in bacteria [Fun 98.76
KOG4152|consensus 830 98.74
COG3055 381 Uncharacterized protein conserved in bacteria [Fun 98.72
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 98.6
KOG4152|consensus 830 98.57
PF1396450 Kelch_6: Kelch motif 98.49
smart0061247 Kelch Kelch domain. 98.43
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.34
PF1341549 Kelch_3: Galactose oxidase, central domain 98.25
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 97.95
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 97.78
KOG2437|consensus 723 97.54
KOG2437|consensus 723 97.43
PLN02772 398 guanylate kinase 97.35
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 97.35
PF1385442 Kelch_5: Kelch motif 97.27
PF12768 281 Rax2: Cortical protein marker for cell polarity 96.82
PF07893 342 DUF1668: Protein of unknown function (DUF1668); In 96.18
PF03089 337 RAG2: Recombination activating protein 2; InterPro 96.04
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 95.17
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 93.32
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 91.51
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 84.92
PF03089337 RAG2: Recombination activating protein 2; InterPro 84.15
PF12768 281 Rax2: Cortical protein marker for cell polarity 83.01
>KOG4441|consensus Back     alignment and domain information 
Probab=99.91  E-value=2.8e-24  Score=162.12  Aligned_cols=107  Identities=33%  Similarity=0.622  Sum_probs=101.5

Q ss_pred             CeEEEEECCCCcEEEecCCcccccceeEEEECCEEEEEecCCCCCCcCeEEEEeCCCCcCCcccceeEEcCCCCCcccce
Q psy11470          1 MSIEVFEIRANTWTEIGHLRNRRLQFGAEVLNGKIHVVGGRDGLKTVNTFEYLNTHSDMKDRIEVTWTSLPSMLTHRHGL   80 (114)
Q Consensus         1 ~~~~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~d~~t~~~~~~~~~W~~~~~~~~~r~~~   80 (114)
                      +++++|||.+++|..+++|+.+|..++++++++.||++||.++...++++++|||.++       +|..+++|+.+|.++
T Consensus       349 ~~ve~YD~~~~~W~~~a~M~~~R~~~~v~~l~g~iYavGG~dg~~~l~svE~YDp~~~-------~W~~va~m~~~r~~~  421 (571)
T KOG4441|consen  349 SSVERYDPRTNQWTPVAPMNTKRSDFGVAVLDGKLYAVGGFDGEKSLNSVECYDPVTN-------KWTPVAPMLTRRSGH  421 (571)
T ss_pred             ceEEEecCCCCceeccCCccCccccceeEEECCEEEEEeccccccccccEEEecCCCC-------cccccCCCCcceeee
Confidence            4789999999999999999999999999999999999999999899999999999999       999999999999999


Q ss_pred             eeEEECC--eEEeccCCce-eeccee-----cCCeEEeeeCC
Q psy11470         81 GKASLHI--YIQNVPEGLV-YHKAMS-----SRKWRIVQVKG  114 (114)
Q Consensus        81 ~~~~~~~--yv~GG~~~~~-~~~~~~-----~~~W~~~~~~g  114 (114)
                      +++++++  |++||.++.. ++++++     +++|+.+++|.
T Consensus       422 gv~~~~g~iYi~GG~~~~~~~l~sve~YDP~t~~W~~~~~M~  463 (571)
T KOG4441|consen  422 GVAVLGGKLYIIGGGDGSSNCLNSVECYDPETNTWTLIAPMN  463 (571)
T ss_pred             EEEEECCEEEEEcCcCCCccccceEEEEcCCCCceeecCCcc
Confidence            9999999  9999987766 788888     99999999983

>KOG4441|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>KOG4693|consensus Back     alignment and domain information
>KOG4693|consensus Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>KOG1230|consensus Back     alignment and domain information
>KOG1230|consensus Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>KOG2437|consensus Back     alignment and domain information
>KOG2437|consensus Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 1e-07
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 1e-07
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 4e-07
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 4e-07
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 5e-07
2xn4_A 302 Crystal Structure Of The Kelch Domain Of Human Klhl 4e-06
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 6e-06
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure 
Iteration: 1

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 7/82 (8%)
Query: 2   SIEVFEIRANTWTEIGHLRNRRLQFGAEVLNGKIHVVGGRDGLKTVNTFEYLNTHSDMKD 61
           S+E +++   TWT +  +R+ R   G  V  GKI+V+GG DG   +++ E  +  SD   
Sbjct: 226 SVERYDVETETWTFVAPMRHHRSALGITVHQGKIYVLGGYDGHTFLDSVECYDPDSD--- 282
Query: 62  RIEVTWTSLPSMLTHRHGLGKA 83
               TW+ +  M + R G+G A
Sbjct: 283 ----TWSEVTRMTSGRSGVGVA 300
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-20
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-20
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 8e-19
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-17
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 1e-15
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 5e-07
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 5e-20
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-17
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 1e-17
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-17
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 6e-17
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 1e-06
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-19
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-19
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-17
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 3e-17
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 6e-17
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 8e-07
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 4e-18
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-17
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-17
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 4e-17
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 1e-16
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 5e-18
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 8e-17
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 1e-16
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-16
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 2e-12
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-06
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-17
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 4e-17
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 6e-17
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-15
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 2e-11
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 8e-10
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 1e-07
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 3e-07
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-05
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 7e-05
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 1e-07
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 5e-04
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
 Score = 82.7 bits (205), Expect = 1e-20
 Identities = 29/90 (32%), Positives = 47/90 (52%), Gaps = 9/90 (10%)

Query: 2   SIEVFEIRANTWTEIGHLRNRRLQFGAEVLNGKIHVVGGRDGLKTVNTFEYLNTHSDMKD 61
           S+E ++   + W+ +G ++  R   G  V +G I+ +GG DGL  +N+ E  + H+    
Sbjct: 129 SMERYDPNIDQWSMLGDMQTAREGAGLVVASGVIYCLGGYDGLNILNSVEKYDPHTG--- 185

Query: 62  RIEVTWTSLPSMLTHRHGLGKASL--HIYI 89
                WT++  M T R G G A L  HIY+
Sbjct: 186 ----HWTNVTPMATKRSGAGVALLNDHIYV 211
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.89
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 99.88
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.87
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 99.87
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.87
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 99.87
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.87
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.87
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.87
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.87
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 99.87
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 99.85
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 99.81
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.8
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 99.79
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.73
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.66
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.52
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 95.01
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 93.15
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 91.95
3mbr_X 243 Glutamine cyclotransferase; beta-propeller; 1.44A 86.19
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 85.61
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 80.16
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
Probab=99.89  E-value=5.5e-22  Score=138.02  Aligned_cols=106  Identities=16%  Similarity=0.187  Sum_probs=95.3

Q ss_pred             CeEEEEECCCCcEEEecCCcccccceeEEEECCEEEEEecC-CCCCCcCeEEEEeCCCCcCCcccceeEEcCCCCCcccc
Q psy11470          1 MSIEVFEIRANTWTEIGHLRNRRLQFGAEVLNGKIHVVGGR-DGLKTVNTFEYLNTHSDMKDRIEVTWTSLPSMLTHRHG   79 (114)
Q Consensus         1 ~~~~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~iyv~GG~-~~~~~~~~~~~~d~~t~~~~~~~~~W~~~~~~~~~r~~   79 (114)
                      +++++||+.+++|+.++++|.+|..+++++++++|||+||. .....++++++||+.++       +|+.+++||.+|..
T Consensus       117 ~~~~~~d~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~~~-------~W~~~~~~p~~r~~  189 (315)
T 4asc_A          117 DSVMCYDRLSFKWGESDPLPYVVYGHTVLSHMDLVYVIGGKGSDRKCLNKMCVYDPKKF-------EWKELAPMQTARSL  189 (315)
T ss_dssp             CCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCTTSCBCCCEEEEETTTT-------EEEECCCCSSCCBS
T ss_pred             ceEEEECCCCCcEeECCCCCCcccceeEEEECCEEEEEeCCCCCCcccceEEEEeCCCC-------eEEECCCCCCchhc
Confidence            36899999999999999999999999999999999999998 45567899999999999       99999999999999


Q ss_pred             eeeEEECC--eEEeccCCceeeccee-----cCCeEEeeeC
Q psy11470         80 LGKASLHI--YIQNVPEGLVYHKAMS-----SRKWRIVQVK  113 (114)
Q Consensus        80 ~~~~~~~~--yv~GG~~~~~~~~~~~-----~~~W~~~~~~  113 (114)
                      |+++++++  |++||.+....++.++     +++|+.++++
T Consensus       190 ~~~~~~~~~iyv~GG~~~~~~~~~~~~yd~~~~~W~~~~~~  230 (315)
T 4asc_A          190 FGATVHDGRIIVAAGVTDTGLTSSAEVYSITDNKWAPFEAF  230 (315)
T ss_dssp             CEEEEETTEEEEEEEECSSSEEEEEEEEETTTTEEEEECCC
T ss_pred             eEEEEECCEEEEEeccCCCCccceEEEEECCCCeEEECCCC
Confidence            99999999  9999987665555555     8899999865
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 114
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 4e-09
d1zgka1 288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 5e-05
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-04
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 0.001
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 0.002
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 50.3 bits (118), Expect = 4e-09
 Identities = 24/80 (30%), Positives = 44/80 (55%), Gaps = 7/80 (8%)

Query: 2   SIEVFEIRANTWTEIGHLRNRRLQFGAEVLNGKIHVVGGRDGLKTVNTFEYLNTHSDMKD 61
           S+E +++   TWT +  +++RR   G  V  G+I+V+GG DG   +++ E  +  +D   
Sbjct: 212 SVERYDVETETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTD--- 268

Query: 62  RIEVTWTSLPSMLTHRHGLG 81
               TW+ +  M + R G+G
Sbjct: 269 ----TWSEVTRMTSGRSGVG 284
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
d1zgka1 288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.85
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.75
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 99.53
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.48
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 84.26
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.85  E-value=7.3e-21  Score=128.17  Aligned_cols=106  Identities=20%  Similarity=0.433  Sum_probs=91.8

Q ss_pred             CeEEEEECCCCcEEEecCCcccccceeEEEECCEEEEEecCCC----CCCcCeEEEEeCCCCcCCcccceeEEcCCCCCc
Q psy11470          1 MSIEVFEIRANTWTEIGHLRNRRLQFGAEVLNGKIHVVGGRDG----LKTVNTFEYLNTHSDMKDRIEVTWTSLPSMLTH   76 (114)
Q Consensus         1 ~~~~~yd~~~~~W~~~~~~~~~~~~~~~~~~~~~iyv~GG~~~----~~~~~~~~~~d~~t~~~~~~~~~W~~~~~~~~~   76 (114)
                      .++++||+.+++|++++++|.+|.+|++++++++|||+||...    ....+++++||+.++       +|..+++||.+
T Consensus        19 ~~~~~yd~~t~~W~~~~~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~yd~~~~-------~w~~~~~~p~~   91 (288)
T d1zgka1          19 SYLEAYNPSNGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTN-------QWSPCAPMSVP   91 (288)
T ss_dssp             CCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCEEEETTEEEECCCEEEEETTTT-------EEEECCCCSSC
T ss_pred             ceEEEEECCCCeEEECCCCCCccceeEEEEECCEEEEEeCcccCCCCccccchhhhcccccc-------cccccccccce
Confidence            3689999999999999999999999999999999999999742    335789999999999       99999999999


Q ss_pred             ccceeeEEECC--eEEeccCCceeeccee-----cCCeEEeeeC
Q psy11470         77 RHGLGKASLHI--YIQNVPEGLVYHKAMS-----SRKWRIVQVK  113 (114)
Q Consensus        77 r~~~~~~~~~~--yv~GG~~~~~~~~~~~-----~~~W~~~~~~  113 (114)
                      |..|+++++++  |++||..+...++..+     +++|...+.+
T Consensus        92 r~~~~~~~~~~~i~~~gg~~~~~~~~~~~~~~~~~~~~~~~~~~  135 (288)
T d1zgka1          92 RNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPM  135 (288)
T ss_dssp             CBTCEEEEETTEEEEECCEETTEECCCEEEEETTTTEEEECCCC
T ss_pred             ecceeccccceeeEEecceecccccceeeeeccccCcccccccc
Confidence            99999999999  9999987666555554     7778776643
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure