Psyllid ID: psy11525


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240----
MVQSICWNTDVNILAAMQDSALCVWFFPAVVFADQGLLRKTVLLKDIGEFGKSPSIVSFVKNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNDDILWACLAGMATYSRDLATSEEAYAAIEQVDKVMYINHIKGIPVKAAQQAEMYLLGGNISEAESILLQHGLIFRAIQVSILTHNWDRALELALRHKTHIDTVLYQRKKYLDNLEKIETNEKFLRLQSEVIMSGLRTPM
cccEEEEcccccEEEEEEccEEEEEEcccccccccccccEEEEEccccccccccEEEEEEccEEEEEEccccEEEcccccHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHccccccccccccc
cccEEEEcccccEEEEEEcccEEEEEccccEEccccccccEEEEEEccccccccEEEEEcccEEEEEEccccEEEEcccHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccc
mvqsicwnTDVNILAAMQDSALCVWFFPAvvfadqgllRKTVLLKDigefgkspsiVSFVKNHltirrydgtvinypisPYISVLHSYAASHSWPQALSLCRTLNDDILWACLAGMATYSRDLATSEEAYAAIEQVDKVMYINHIKGIPVKAAQQAEMYLLGGNISEAESILLQHGLIFRAIQVSILTHNWDRALELALRHKTHIDTVLYQRKKYLDNLEKIETNEKFLRLQSEVIMSGLRTPM
MVQSICWNTDVNILAAMQDSALCVWFFPAVVFADQGLLRKTVLLKDigefgkspsivsfVKNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNDDILWACLAGMATYSRDLATSEEAYAAIEQVDKVMYINHIKGIPVKAAQQAEMYLLGGNISEAESILLQHGLIFRAIQVSILTHNWDRALELALRHKTHIDTVLYQRKKYLDNLEKIEtnekflrlqsevimsglrtpm
MVQSICWNTDVNILAAMQDSALCVWFFPAVVFADQGLLRKTVLLKDIGEFGKSPSIVSFVKNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNDDILWACLAGMATYSRDLATSEEAYAAIEQVDKVMYINHIKGIPVKAAQQAEMYLLGGNISEAESILLQHGLIFRAIQVSILTHNWDRALELALRHKTHIDTVLYQRKKYLDNLEKIETNEKFLRLQSEVIMSGLRTPM
***SICWNTDVNILAAMQDSALCVWFFPAVVFADQGLLRKTVLLKDIGEFGKSPSIVSFVKNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNDDILWACLAGMATYSRDLATSEEAYAAIEQVDKVMYINHIKGIPVKAAQQAEMYLLGGNISEAESILLQHGLIFRAIQVSILTHNWDRALELALRHKTHIDTVLYQRKKYLDNLEKIETNEKFLRLQSEV*********
MVQSICWNTDVNILAAMQDSALCVWFFPAVVFADQGLLRKTVLLK****FGKSPSIVSFVKNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNDDILWACLAGMATYSRDLATSEEAYAAIEQVDKVMYINHIKGIPVKAAQQAEMYLLGGNISEAESILLQHGLIFRAIQVSILTHNWDRALELALRHKTHIDTVLYQRKKYLDNLEKIETNEKFLRLQSEVIMSGLRTPM
MVQSICWNTDVNILAAMQDSALCVWFFPAVVFADQGLLRKTVLLKDIGEFGKSPSIVSFVKNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNDDILWACLAGMATYSRDLATSEEAYAAIEQVDKVMYINHIKGIPVKAAQQAEMYLLGGNISEAESILLQHGLIFRAIQVSILTHNWDRALELALRHKTHIDTVLYQRKKYLDNLEKIETNEKFLRLQSEVIMSGLRTPM
*VQSICWNTDVNILAAMQDSALCVWFFPAVVFADQGLLRKTVLLKDIGEFGKSPSIVSFVKNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNDDILWACLAGMATYSRDLATSEEAYAAIEQVDKVMYINHIKGIPVKAAQQAEMYLLGGNISEAESILLQHGLIFRAIQVSILTHNWDRALELALRHKTHIDTVLYQRKKYLDNLEKIETNEKFLRLQSEVIMSGLR***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVQSICWNTDVNILAAMQDSALCVWFFPAVVFADQGLLRKTVLLKDIGEFGKSPSIVSFVKNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNDDILWACLAGMATYSRDLATSEEAYAAIEQVDKVMYINHIKGIPVKAAQQAEMYLLGGNISEAESILLQHGLIFRAIQVSILTHNWDRALELALRHKTHIDTVLYQRKKYLDNLEKIETNEKFLRLQSEVIMSGLRTPM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query244 2.2.26 [Sep-21-2011]
Q9P2H3777 Intraflagellar transport yes N/A 0.938 0.294 0.489 5e-66
Q8K057777 Intraflagellar transport yes N/A 0.942 0.296 0.469 8e-65
Q66HB3777 Intraflagellar transport yes N/A 0.942 0.296 0.469 3e-64
>sp|Q9P2H3|IFT80_HUMAN Intraflagellar transport protein 80 homolog OS=Homo sapiens GN=IFT80 PE=1 SV=3 Back     alignment and function desciption
 Score =  250 bits (639), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 112/229 (48%), Positives = 164/229 (71%)

Query: 1   MVQSICWNTDVNILAAMQDSALCVWFFPAVVFADQGLLRKTVLLKDIGEFGKSPSIVSFV 60
           MV ++ WN   NIL  +QD+   VW++P  V+ D+ +L KT+  +D  EF K+P IVSFV
Sbjct: 508 MVHTLAWNDTCNILCGLQDTRFIVWYYPNTVYVDRDILPKTLYERDASEFSKNPHIVSFV 567

Query: 61  KNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNDDILWACLAGMATYS 120
            N +TIRR DG++++  I+PY ++LH Y +S  W  A+ LCR + +  +WACLA MA  +
Sbjct: 568 GNQVTIRRADGSLVHISITPYPAILHEYVSSSKWEDAVRLCRFVKEQTMWACLAAMAVAN 627

Query: 121 RDLATSEEAYAAIEQVDKVMYINHIKGIPVKAAQQAEMYLLGGNISEAESILLQHGLIFR 180
           RD+ T+E AYAAI ++DKV YIN IK +P K ++ A + L  GNI EAE +LLQ GL+++
Sbjct: 628 RDMTTAEIAYAAIGEIDKVQYINSIKNLPSKESKMAHILLFSGNIQEAEIVLLQAGLVYQ 687

Query: 181 AIQVSILTHNWDRALELALRHKTHIDTVLYQRKKYLDNLEKIETNEKFL 229
           AIQ++I  +NW+RALELA+++KTH+DTVL  R+K+L+   K ETN+++L
Sbjct: 688 AIQININLYNWERALELAVKYKTHVDTVLAYRQKFLETFGKQETNKRYL 736




Component of the intraflagellar transport (IFT) complex B, which is essential for the development and maintenance of motile and sensory cilia.
Homo sapiens (taxid: 9606)
>sp|Q8K057|IFT80_MOUSE Intraflagellar transport protein 80 homolog OS=Mus musculus GN=Ift80 PE=2 SV=1 Back     alignment and function description
>sp|Q66HB3|IFT80_RAT Intraflagellar transport protein 80 homolog OS=Rattus norvegicus GN=Ift80 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query244
291237999344 PREDICTED: abnormal CHEmotaxis family me 0.942 0.668 0.539 5e-70
156382726 771 predicted protein [Nematostella vectensi 0.963 0.304 0.523 1e-68
449277291 939 Intraflagellar transport protein 80 like 0.942 0.244 0.526 1e-67
405971480 735 Intraflagellar transport protein 80-like 0.942 0.312 0.504 1e-67
326926211 887 PREDICTED: intraflagellar transport prot 0.942 0.259 0.517 2e-67
327266928 778 PREDICTED: intraflagellar transport prot 0.942 0.295 0.521 6e-67
363737280 778 PREDICTED: intraflagellar transport prot 0.942 0.295 0.513 1e-66
195995615 773 hypothetical protein TRIADDRAFT_49567 [T 0.971 0.306 0.502 2e-65
426342703 433 PREDICTED: intraflagellar transport prot 0.938 0.528 0.493 5e-65
10998235267 hypothetical protein [Macaca fasciculari 0.938 0.857 0.493 7e-65
>gi|291237999|ref|XP_002738919.1| PREDICTED: abnormal CHEmotaxis family member (che-2)-like, partial [Saccoglossus kowalevskii] Back     alignment and taxonomy information
 Score =  270 bits (689), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 124/230 (53%), Positives = 169/230 (73%)

Query: 1   MVQSICWNTDVNILAAMQDSALCVWFFPAVVFADQGLLRKTVLLKDIGEFGKSPSIVSFV 60
           M+ S+ WN   NIL+A+QD  L VW++P  V+ D+ LL KT+L KD  EFGK+P++VSF+
Sbjct: 83  MISSLSWNDTTNILSALQDGKLSVWYYPNAVYVDKELLSKTILEKDTSEFGKNPNLVSFL 142

Query: 61  KNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNDDILWACLAGMATYS 120
            NHLTIRR DG++++  I PY ++LH     + W  A+ LCR + D  +W CLA MA Y+
Sbjct: 143 GNHLTIRRADGSLVSTGIIPYPAMLHELVYGNRWEDAVRLCRFVKDPAMWGCLAAMAAYA 202

Query: 121 RDLATSEEAYAAIEQVDKVMYINHIKGIPVKAAQQAEMYLLGGNISEAESILLQHGLIFR 180
           ++L T+E AYAAI++ DKV +I HIK IP K A+ AEM L  GN  +AE ILLQ GLIFR
Sbjct: 203 KELNTAEIAYAAIDEADKVEFIIHIKEIPSKEARSAEMALFCGNSQDAEGILLQGGLIFR 262

Query: 181 AIQVSILTHNWDRALELALRHKTHIDTVLYQRKKYLDNLEKIETNEKFLR 230
           AI ++I  +NWDRALELA++HKTH+DTVL  R+K+LD+ +K ETN++FL+
Sbjct: 263 AIMMNIELYNWDRALELAVKHKTHVDTVLAYRQKFLDDFDKKETNKRFLQ 312




Source: Saccoglossus kowalevskii

Species: Saccoglossus kowalevskii

Genus: Saccoglossus

Family: Harrimaniidae

Order:

Class: Enteropneusta

Phylum: Hemichordata

Superkingdom: Eukaryota

>gi|156382726|ref|XP_001632703.1| predicted protein [Nematostella vectensis] gi|156219763|gb|EDO40640.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|449277291|gb|EMC85526.1| Intraflagellar transport protein 80 like protein, partial [Columba livia] Back     alignment and taxonomy information
>gi|405971480|gb|EKC36315.1| Intraflagellar transport protein 80-like protein [Crassostrea gigas] Back     alignment and taxonomy information
>gi|326926211|ref|XP_003209297.1| PREDICTED: intraflagellar transport protein 80 homolog [Meleagris gallopavo] Back     alignment and taxonomy information
>gi|327266928|ref|XP_003218255.1| PREDICTED: intraflagellar transport protein 80 homolog [Anolis carolinensis] Back     alignment and taxonomy information
>gi|363737280|ref|XP_422817.3| PREDICTED: intraflagellar transport protein 80 homolog [Gallus gallus] Back     alignment and taxonomy information
>gi|195995615|ref|XP_002107676.1| hypothetical protein TRIADDRAFT_49567 [Trichoplax adhaerens] gi|190588452|gb|EDV28474.1| hypothetical protein TRIADDRAFT_49567 [Trichoplax adhaerens] Back     alignment and taxonomy information
>gi|426342703|ref|XP_004037974.1| PREDICTED: intraflagellar transport protein 80 homolog, partial [Gorilla gorilla gorilla] Back     alignment and taxonomy information
>gi|10998235|dbj|BAB17009.1| hypothetical protein [Macaca fascicularis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query244
UNIPROTKB|E1BT30780 IFT80 "Uncharacterized protein 0.942 0.294 0.513 5.4e-63
UNIPROTKB|Q9P2H3777 IFT80 "Intraflagellar transpor 0.938 0.294 0.489 2.1e-61
UNIPROTKB|H3BRJ5948 H3BRJ5 "Uncharacterized protei 0.938 0.241 0.489 6e-61
UNIPROTKB|F1N0G0764 F1N0G0 "Uncharacterized protei 0.942 0.301 0.478 1.2e-60
UNIPROTKB|F1PNI0784 IFT80 "Uncharacterized protein 0.942 0.293 0.478 1.2e-60
MGI|MGI:1915509777 Ift80 "intraflagellar transpor 0.942 0.296 0.469 3.1e-60
RGD|1312006777 Ift80 "intraflagellar transpor 0.942 0.296 0.469 1e-59
ZFIN|ZDB-GENE-041212-50777 ift80 "intraflagellar transpor 0.963 0.302 0.476 2.2e-59
WB|WBGene00000484760 che-2 [Caenorhabditis elegans 0.963 0.309 0.365 1.8e-41
FB|FBgn0032891775 Oseg5 "Oseg5" [Drosophila mela 0.930 0.292 0.373 3.5e-37
UNIPROTKB|E1BT30 IFT80 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 643 (231.4 bits), Expect = 5.4e-63, P = 5.4e-63
 Identities = 118/230 (51%), Positives = 166/230 (72%)

Query:     1 MVQSICWNTDVNILAAMQDSALCVWFFPAVVFADQGLLRKTVLLKDIGEFGKSPSIVSFV 60
             MVQ++ WN   N+L  +QD+   VW++P  V+ D+ LL KT+  KD  +F K+P IV FV
Sbjct:   509 MVQTLAWNDTSNLLCGIQDTHFTVWYYPNTVYVDKDLLTKTLYEKDASDFSKNPQIVHFV 568

Query:    61 KNHLTIRRYDGTVINYPISPYISVLHSYAASHSWPQALSLCRTLNDDILWACLAGMATYS 120
              N +TIRR DG++I+  ISPY  +LH Y +S  W  A+ LCR + D  +WACLA MA  +
Sbjct:   569 GNQITIRRADGSLIHINISPYPVILHEYVSSSKWEDAVRLCRFVKDQTMWACLAAMAVAN 628

Query:   121 RDLATSEEAYAAIEQVDKVMYINHIKGIPVKAAQQAEMYLLGGNISEAESILLQHGLIFR 180
             +D+AT+E AYA+I ++DKV YIN IK +P K ++ A + L  GN  EAE++LLQ GLI++
Sbjct:   629 KDMATAEIAYASIGEIDKVQYINFIKDLPSKESRMAHILLFSGNTQEAETLLLQTGLIYQ 688

Query:   181 AIQVSILTHNWDRALELALRHKTHIDTVLYQRKKYLDNLEKIETNEKFLR 230
             AIQV+I  +NWDRALELA++HKTH+DTVL  R+K+L++  K ETN++FL+
Sbjct:   689 AIQVNINLYNWDRALELAVKHKTHVDTVLAYRQKFLEDFGKKETNKRFLQ 738




GO:0001649 "osteoblast differentiation" evidence=IEA
GO:0005813 "centrosome" evidence=IEA
GO:0005929 "cilium" evidence=IEA
GO:0007224 "smoothened signaling pathway" evidence=IEA
GO:0060271 "cilium morphogenesis" evidence=IEA
GO:0060349 "bone morphogenesis" evidence=IEA
UNIPROTKB|Q9P2H3 IFT80 "Intraflagellar transport protein 80 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H3BRJ5 H3BRJ5 "Uncharacterized protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N0G0 F1N0G0 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PNI0 IFT80 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1915509 Ift80 "intraflagellar transport 80" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1312006 Ift80 "intraflagellar transport 80 homolog (Chlamydomonas)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041212-50 ift80 "intraflagellar transport 80 homolog (Chlamydomonas)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00000484 che-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0032891 Oseg5 "Oseg5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 244
KOG1524|consensus737 100.0
KOG3616|consensus 1636 99.97
KOG1538|consensus 1081 99.95
KOG3617|consensus 1416 99.78
KOG2041|consensus 1189 99.7
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 99.65
KOG0292|consensus 1202 99.34
KOG2041|consensus 1189 99.18
KOG3616|consensus 1636 98.94
KOG0276|consensus794 98.9
KOG2247|consensus 615 98.61
KOG1538|consensus 1081 98.09
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.45
KOG1920|consensus 1265 97.4
KOG3617|consensus 1416 97.04
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.04
PRK11788389 tetratricopeptide repeat protein; Provisional 97.03
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 96.96
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 96.83
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 96.75
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 96.73
KOG1920|consensus 1265 96.72
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 96.71
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 96.6
PLN03077 857 Protein ECB2; Provisional 96.45
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 96.17
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 96.16
PLN03218 1060 maturation of RBCL 1; Provisional 96.15
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 96.15
PRK11788 389 tetratricopeptide repeat protein; Provisional 96.12
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 96.1
PRK12370553 invasion protein regulator; Provisional 96.05
PRK15359144 type III secretion system chaperone protein SscB; 95.95
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 95.94
KOG2114|consensus 933 95.94
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 95.68
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 95.66
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 95.62
PRK11189296 lipoprotein NlpI; Provisional 95.6
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 95.58
TIGR02552135 LcrH_SycD type III secretion low calcium response 95.44
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 95.33
PLN03218 1060 maturation of RBCL 1; Provisional 95.28
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 94.98
cd00189100 TPR Tetratricopeptide repeat domain; typically con 94.97
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 94.92
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 94.84
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 94.73
PLN03077 857 Protein ECB2; Provisional 94.56
PRK12370553 invasion protein regulator; Provisional 94.52
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 94.52
KOG0985|consensus 1666 94.36
smart00299140 CLH Clathrin heavy chain repeat homology. 93.77
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 93.76
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 93.65
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 93.4
KOG1840|consensus508 93.32
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 93.31
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 93.2
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 93.09
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 92.97
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 92.96
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 92.72
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 92.71
CHL00033168 ycf3 photosystem I assembly protein Ycf3 92.63
PRK15359144 type III secretion system chaperone protein SscB; 92.23
KOG1125|consensus579 92.04
KOG3785|consensus 557 91.67
KOG0276|consensus794 91.64
KOG2034|consensus 911 91.49
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 91.48
cd00189100 TPR Tetratricopeptide repeat domain; typically con 91.18
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 91.02
PRK15331165 chaperone protein SicA; Provisional 90.95
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 90.93
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 90.83
KOG1840|consensus508 90.78
PRK10370198 formate-dependent nitrite reductase complex subuni 90.67
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 90.65
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 90.41
PF1337173 TPR_9: Tetratricopeptide repeat 90.35
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 90.35
PRK10747398 putative protoheme IX biogenesis protein; Provisio 90.33
PRK02603172 photosystem I assembly protein Ycf3; Provisional 90.32
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 89.36
KOG0292|consensus 1202 89.3
KOG2114|consensus 933 88.78
KOG0550|consensus486 88.25
smart00299140 CLH Clathrin heavy chain repeat homology. 88.22
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 88.1
KOG1155|consensus559 87.82
KOG2063|consensus 877 87.73
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 87.68
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 87.55
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 86.93
PRK11189296 lipoprotein NlpI; Provisional 86.91
KOG2280|consensus829 86.85
KOG2076|consensus 895 86.43
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 86.08
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 86.07
PF12931 284 Sec16_C: Sec23-binding domain of Sec16; PDB: 3MZK_ 85.03
cd05804355 StaR_like StaR_like; a well-conserved protein foun 84.9
PRK14574 822 hmsH outer membrane protein; Provisional 84.45
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 84.2
PF0398370 SHD1: SLA1 homology domain 1, SHD1 ; InterPro: IPR 83.72
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 83.35
COG3071 400 HemY Uncharacterized enzyme of heme biosynthesis [ 82.99
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 82.74
PRK14574 822 hmsH outer membrane protein; Provisional 82.63
PRK10803263 tol-pal system protein YbgF; Provisional 82.55
TIGR02552135 LcrH_SycD type III secretion low calcium response 82.36
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 82.26
KOG1129|consensus478 81.64
KOG0985|consensus 1666 81.31
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 81.23
KOG2076|consensus 895 81.13
cd05804355 StaR_like StaR_like; a well-conserved protein foun 80.76
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 80.61
CHL00033168 ycf3 photosystem I assembly protein Ycf3 80.13
KOG3081|consensus299 80.03
>KOG1524|consensus Back     alignment and domain information
Probab=100.00  E-value=3e-55  Score=404.16  Aligned_cols=241  Identities=44%  Similarity=0.762  Sum_probs=237.8

Q ss_pred             CcceeeecCCCceEEEEeCCeEEEEEcCCccccCcccceeeeEeeccCCCCCCCeEEeEeCCEEEEEecCCcEEEeecCc
Q psy11525          1 MVQSICWNTDVNILAAMQDSALCVWFFPAVVFADQGLLRKTVLLKDIGEFGKSPSIVSFVKNHLTIRRYDGTVINYPISP   80 (244)
Q Consensus         1 ~v~~v~W~~~~~vlv~~~~~~l~vw~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~v~f~g~~v~~~~~~G~~~~~~~~p   80 (244)
                      ||..++||+.+||||+.+|+.+.|||||+..|+|+++|++|.+++++++||++|++++|.|++|+++|+||.+++++++|
T Consensus       496 mVhtLawndttNiLcglqDt~fsVWy~pn~vyvDrdiLpkTlierdt~efgKnpqIvsFvgNqvtirrsdG~LlpisV~p  575 (737)
T KOG1524|consen  496 MVHTLAWNDTTNILCGLQDTCFSVWYYPNEVYVDRDILPKTLIERDTTEFGKNPQIVSFVGNQVTIRRSDGALLPISVNP  575 (737)
T ss_pred             hhhhhhhccccceeeeeccceEEEEEcCCcceecccccchhheecchhhccCCcceeeeeccEEEEEeccCceEeeeccc
Confidence            78899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cHHHHHHHHHcCCHHHHHHHHhccCCHHHHHHHHHHHHHcCCHHHHHHHHHHhCChhHHHHHHHhhCCCcHHHHHHHHHH
Q psy11525         81 YISVLHSYAASHSWPQALSLCRTLNDDILWACLAGMATYSRDLATSEEAYAAIEQVDKVMYINHIKGIPVKAAQQAEMYL  160 (244)
Q Consensus        81 ~~~~l~~~l~~~~~~~A~~~~~~~~~~~lW~~LA~~Al~~~~l~~A~~~y~~l~d~~~v~~l~~i~~~~~~~~~~A~ia~  160 (244)
                      |++.|++|+..++|++|+++||++++.+||++||.+|+.+.++.++|.+|+++++.++|++|++|+.+.+++.++|+..+
T Consensus       576 y~~iL~e~~sssKWeqavRLCrfv~eqTMWAtlAa~Av~~~~m~~~EiAYaA~~~idKVsyin~iK~ltske~~mA~~~l  655 (737)
T KOG1524|consen  576 YPEILHEYLSSSKWEQAVRLCRFVQEQTMWATLAAVAVRKHQMQISEIAYAAALQIDKVSYINHIKALTSKEEQMAENSL  655 (737)
T ss_pred             cHHHHHHHhccchHHHHHHHHHhccchHHHHHHHHHHHhhccccHHHHHHHHhhchhhHHHHHHHhccCcHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HcCCHHHHHHHHHHCCCHHHHHHHHHHhcCHHHHHHHHHhcCCchhHHHHHHHHHHHHcCCcccHHHHHhcccccccCcc
Q psy11525        161 LGGNISEAESILLQHGLIFRAIQVSILTHNWDRALELALRHKTHIDTVLYQRKKYLDNLEKIETNEKFLRLQSEVIMSGL  240 (244)
Q Consensus       161 ~~G~~~eAe~~~l~~g~~~~Ai~m~~~l~~W~~Al~LA~~~~~~~~~vl~~r~~yl~~~~~~e~~~~f~~~~~~~~~~~~  240 (244)
                      +.|+..|||.+++++|.+++|+.+...+++|+|||+|+.+|+.+++.||.+|++||+..|++||+++|+++..++|||..
T Consensus       656 ~~G~~~eAe~iLl~~gl~~qav~lni~m~nW~RALEl~~K~K~~v~~Vl~yR~KyLk~~g~~EtdplyL~~~~~~eiD~i  735 (737)
T KOG1524|consen  656 MLGRMLEAETILLHGGLIEQAVGLNIRMHNWRRALELSQKHKELVPRVLQYRRKYLKALGREETDPLYLPLVAKEEIDNI  735 (737)
T ss_pred             HhccchhhhHHHHhcchHHHhhhhhhhhhhHHHHHHHHHhHHHHHHHHHHHHHHHHHHhcccccCchhhhhhhhcccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999954


Q ss_pred             c
Q psy11525        241 R  241 (244)
Q Consensus       241 ~  241 (244)
                      +
T Consensus       736 ~  736 (737)
T KOG1524|consen  736 S  736 (737)
T ss_pred             c
Confidence            3



>KOG3616|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG2034|consensus Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>KOG2063|consensus Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF12931 Sec16_C: Sec23-binding domain of Sec16; PDB: 3MZK_C Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF03983 SHD1: SLA1 homology domain 1, SHD1 ; InterPro: IPR007131 The SLA1 homology domain is found in the cytoskeleton assembly control protein SLA1, which is responsible for the correct formation of the actin cytoskeleton Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query244
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.9
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 99.86
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 98.44
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.41
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.15
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.92
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 97.68
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 97.63
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 97.52
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 97.5
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 97.49
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 97.43
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 97.39
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 97.39
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 97.36
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 97.36
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 97.35
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 97.32
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.3
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 97.28
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 97.27
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 97.25
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 97.23
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 97.22
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 97.19
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 97.18
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 97.18
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 97.13
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 97.12
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 97.03
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.03
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 97.02
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.01
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 96.97
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 96.97
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 96.96
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 96.96
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 96.94
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 96.92
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 96.89
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.86
4eqf_A365 PEX5-related protein; accessory protein, tetratric 96.86
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 96.86
3u4t_A272 TPR repeat-containing protein; structural genomics 96.86
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.81
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 96.79
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 96.79
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 96.76
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 96.75
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 96.68
2gw1_A 514 Mitochondrial precursor proteins import receptor; 96.65
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 96.64
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.56
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 96.55
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 96.53
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.53
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 96.49
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 96.39
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 96.35
3u4t_A272 TPR repeat-containing protein; structural genomics 96.35
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 96.31
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 96.28
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 96.28
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 96.25
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.22
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 96.21
3u3w_A293 Transcriptional activator PLCR protein; ternary co 96.18
2gw1_A514 Mitochondrial precursor proteins import receptor; 96.16
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 96.16
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 96.15
3q49_B137 STIP1 homology and U box-containing protein 1; E3 96.14
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 96.14
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 96.13
4i17_A228 Hypothetical protein; TPR repeats protein, structu 96.09
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 96.07
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 96.04
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 96.02
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 95.98
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 95.93
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 95.92
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 95.89
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 95.83
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 95.83
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 95.82
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 95.77
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 95.75
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 95.7
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 95.66
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 95.64
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 95.63
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 95.58
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 95.56
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 95.53
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 95.51
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 95.51
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 95.47
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 95.39
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 95.22
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 95.18
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 95.12
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 95.1
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 95.08
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 95.08
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 95.06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 95.03
3q15_A378 PSP28, response regulator aspartate phosphatase H; 94.97
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 94.95
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 94.84
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 94.81
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 94.81
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 94.77
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 94.76
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 94.7
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 94.67
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 94.63
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 94.58
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 94.52
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 94.51
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 94.51
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 94.5
3q15_A378 PSP28, response regulator aspartate phosphatase H; 94.47
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 94.41
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 94.41
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 94.4
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 94.32
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 94.27
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 94.27
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 94.26
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 94.25
3q49_B137 STIP1 homology and U box-containing protein 1; E3 94.24
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 94.23
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 94.23
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 94.19
4i17_A228 Hypothetical protein; TPR repeats protein, structu 94.07
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 94.01
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 93.96
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 93.92
3k9i_A117 BH0479 protein; putative protein binding protein, 93.82
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 93.6
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 93.55
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 93.52
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 93.27
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 93.21
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 93.15
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 93.07
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 93.02
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 92.9
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 92.86
2kat_A115 Uncharacterized protein; NESG, structure, structur 92.85
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 92.83
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 92.5
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 92.32
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 92.28
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 92.25
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 92.23
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 92.05
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 92.03
3qww_A433 SET and MYND domain-containing protein 2; methyltr 92.02
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 92.0
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 91.97
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 91.89
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 91.75
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 91.37
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 91.34
2l6j_A111 TPR repeat-containing protein associated with HSP; 91.31
4g1t_A472 Interferon-induced protein with tetratricopeptide 90.82
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 90.7
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 90.6
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 90.3
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 90.14
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 90.13
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 89.55
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 89.51
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 89.2
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 89.2
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 88.82
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 88.68
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 87.95
2l6j_A111 TPR repeat-containing protein associated with HSP; 87.91
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 87.77
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 87.37
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 87.34
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 86.88
2kat_A115 Uncharacterized protein; NESG, structure, structur 86.77
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 85.85
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 84.79
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 84.67
3u3w_A293 Transcriptional activator PLCR protein; ternary co 84.2
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 83.97
3k9i_A117 BH0479 protein; putative protein binding protein, 83.46
3qww_A433 SET and MYND domain-containing protein 2; methyltr 83.15
4g1t_A 472 Interferon-induced protein with tetratricopeptide 83.13
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 83.11
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 82.05
2hbp_A68 Cytoskeleton assembly control protein SLA1; SHD1, 81.73
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 80.39
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
Probab=99.90  E-value=9e-22  Score=191.02  Aligned_cols=134  Identities=13%  Similarity=0.077  Sum_probs=127.8

Q ss_pred             HHcCCHHHHHHHHhccCCHHHHHHHHHHHHHcCCHHHHHHHHHHhCChhHHHHHHHhhCCCcHHHHHHHHHHHcCCHHHH
Q psy11525         89 AASHSWPQALSLCRTLNDDILWACLAGMATYSRDLATSEEAYAAIEQVDKVMYINHIKGIPVKAAQQAEMYLLGGNISEA  168 (244)
Q Consensus        89 l~~~~~~~A~~~~~~~~~~~lW~~LA~~Al~~~~l~~A~~~y~~l~d~~~v~~l~~i~~~~~~~~~~A~ia~~~G~~~eA  168 (244)
                      ++.|+|++|+++|+.++++.+|+.||++|++.+++++|++||.+++|++++.+|..+....++..++|+++...|+++.|
T Consensus       663 l~~~~~~~A~~~~~~~~~~~~W~~la~~al~~~~~~~A~~~y~~~~d~~~l~~l~~~~~~~~~~~~~~~~a~~~~~~~~A  742 (814)
T 3mkq_A          663 LKVGQLTLARDLLTDESAEMKWRALGDASLQRFNFKLAIEAFTNAHDLESLFLLHSSFNNKEGLVTLAKDAETTGKFNLA  742 (814)
T ss_dssp             HHHTCHHHHHHHHTTCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHTCHHHHHHHHHHTTCHHHHHHHHHHHHHTTCHHHH
T ss_pred             hhcCCHHHHHHHHHhhCcHhHHHHHHHHHHHcCCHHHHHHHHHHccChhhhHHHHHHcCCHHHHHHHHHHHHHcCchHHH
Confidence            78899999999999999999999999999999999999999999999999999999988777788999999999999999


Q ss_pred             HHHHHHCCCHHHHHHHHHHhcCHHHHHHHHHhcC-Cc--hhHHHHHHHHHHHHcCCc
Q psy11525        169 ESILLQHGLIFRAIQVSILTHNWDRALELALRHK-TH--IDTVLYQRKKYLDNLEKI  222 (244)
Q Consensus       169 e~~~l~~g~~~~Ai~m~~~l~~W~~Al~LA~~~~-~~--~~~vl~~r~~yl~~~~~~  222 (244)
                      +.+|+++|++++|++||+++++|++|+.||++|+ .+  ++.++..++.+|+..|+.
T Consensus       743 ~~~~~~~g~~~~a~~~~~~~~~~~~A~~lA~~~~~~~~~i~~~~~~~~~~L~~~~~~  799 (814)
T 3mkq_A          743 FNAYWIAGDIQGAKDLLIKSQRFSEAAFLGSTYGLGDNEVNDIVTKWKENLILNGKN  799 (814)
T ss_dssp             HHHHHHHTCHHHHHHHHHHTTCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHTTTCH
T ss_pred             HHHHHHcCCHHHHHHHHHHcCChHHHHHHHHHhCCChHHHHHHHHHHHHHHHhccch
Confidence            9999999999999999999999999999999999 45  779999999999999874



>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2hbp_A Cytoskeleton assembly control protein SLA1; SHD1, NPFX(1,2)D, endocytosis, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query244
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.17
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 97.13
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.99
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 96.87
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.8
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.71
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.69
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.56
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.21
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 95.65
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.04
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 94.5
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 93.97
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 93.94
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 93.89
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 93.87
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 93.65
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 93.44
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 93.23
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 92.59
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 92.58
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 91.77
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 90.01
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 89.86
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 89.58
d1hz4a_366 Transcription factor MalT domain III {Escherichia 88.86
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 88.63
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 88.63
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 88.13
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 87.15
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 85.6
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 85.55
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 83.19
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 82.43
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 82.42
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 82.31
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 81.54
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 81.27
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Neutrophil cytosolic factor 2 (NCF-2, p67-phox)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.17  E-value=0.0044  Score=48.30  Aligned_cols=102  Identities=20%  Similarity=0.200  Sum_probs=77.4

Q ss_pred             HHHHcCCHHHHHHHHhcc--CCHHHHHHHHHHHHHcCCHHHHHHHHHHhCChhHHHHHHHhhCCCcHHHHHHHHHHHcCC
Q psy11525         87 SYAASHSWPQALSLCRTL--NDDILWACLAGMATYSRDLATSEEAYAAIEQVDKVMYINHIKGIPVKAAQQAEMYLLGGN  164 (244)
Q Consensus        87 ~~l~~~~~~~A~~~~~~~--~~~~lW~~LA~~Al~~~~l~~A~~~y~~l~d~~~v~~l~~i~~~~~~~~~~A~ia~~~G~  164 (244)
                      .+.+.|+|+.|.+.-..+  .+...|-.+|..-...++++.|+.+|.+.        |+.=.+.......+|.++..+|+
T Consensus        14 ~~~~~~d~~~Al~~~~~i~~~~~~~~~nlG~~~~~~g~~~~A~~~~~kA--------l~ldp~~~~a~~~~g~~~~~~g~   85 (192)
T d1hh8a_          14 LAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRS--------INRDKHLAVAYFQRGMLYYQTEK   85 (192)
T ss_dssp             HHHHTTCHHHHHHHHHTSSSCCHHHHHHHHHHHHHTTCHHHHHHHHHHH--------HHHCTTCHHHHHHHHHHHHHTTC
T ss_pred             HHHHCCCHHHHHHHHHhcCCCCHHHHHHHHHHHHHcCCchhHHHHHHHH--------HHHhhhhhhhHHHHHHHHHhhcc
Confidence            358999999999988876  45788999999999999999999999874        11111222234568999999999


Q ss_pred             HHHHHHHHHHCCC-------------------------HHHHHHHHHHhcCHHHHHHH
Q psy11525        165 ISEAESILLQHGL-------------------------IFRAIQVSILTHNWDRALEL  197 (244)
Q Consensus       165 ~~eAe~~~l~~g~-------------------------~~~Ai~m~~~l~~W~~Al~L  197 (244)
                      +++|.+.|.++=.                         ...| .++..+++|++|++.
T Consensus        86 ~~~A~~~~~kAl~~~~~n~~~~~~~~~~~~~~~~~e~~~n~a-~~~~~~~~~~~A~~~  142 (192)
T d1hh8a_          86 YDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIA-FMYAKKEEWKKAEEQ  142 (192)
T ss_dssp             HHHHHHHHHHHHHTTTTCSEEECGGGTBCCEEEHHHHHHHHH-HHHHHTTCHHHHHHH
T ss_pred             HHHHHHHHHHHHHhCccCchHHHHHhhhhcccchHHHHHHHH-HHHHHCCCHHHHHHH
Confidence            9999998877510                         1223 357889999998764



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure