Psyllid ID: psy11532

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260
MENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGSVTIAVSLSKIPTYQRGGTIIPLRERVRRASSLTLQDPVTLIVALNVNGTARGNLYLDDGQSYDYRKGNYVAVQFKYENGVLSSKGHAHIDTRRREPWLYGDATTSLVRDALRARYALLPYWYTLFHTQEISGAPVIRPLWYEFPQDKETFAMENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGSVTIAVSLSKIS
cccEEEEcccEEEccccccccEEEEEEEccccccEEEcccccEEEcccEEEEEEccccccEEEEccEEEEccccccccccccccccEEEEEEEccccEEEEEEEcccccccccccccEEEEEEEEcccccEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEcccEEEccccccccEEEEEEEccccccEEEcccccEEEcccEEEEEccccccc
ccccEEEcccEEEcEEEccccEEEEEEEccccEEEEEEccccEEcccEEEEEEcccccccEEEEccEEEEccccccccccccccccEEEEEEEccccccEEEEEEccccccccccccEEEEEEEEcccccEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEcEEEEEcccccccccccccEEccccEEEcEEEccccEEEEEEEccccEEEEEcccccEEcccEEEEEEccHHccc
menqyligdsilvrpvtdpgatqvsvyfpradevwfdrdtyEAFTQTGSVTIAVSlskiptyqrggtiiplrERVRRassltlqdpVTLIVALNVngtargnlylddgqsydyrkgNYVAVQFKYEngvlsskghahidtrrrepwlygdatTSLVRDALRARYALLPYWYTLFHtqeisgapvirplwyefpqdketFAMENQYLIGdsilvrpvtdpgatqvsvyfpradevwfdrdtyEAFTQTGSVTIAVSLSKIS
menqyligdsilvrpvtdpgATQVSVYFPRADEVWFDRDTYEAFTQtgsvtiavslskiptyqrggtiiplreRVRRAssltlqdpvtLIVALNVNGTARGNLYLDDGQSYDYRKGNYVAVQFKYENgvlsskghahidtrrrepwlygdATTSLVRDALRARYALLPYWYTLFHTQEISGAPVIRPLWYEFPQDKETFAMENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGSVTIAVSLSKIS
MENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGSVTIAVSLSKIPTYQRGGTIIPLRERVRRASSLTLQDPVTLIVALNVNGTARGNLYLDDGQSYDYRKGNYVAVQFKYENGVLSSKGHAHIDTRRREPWLYGDATTSLVRDALRARYALLPYWYTLFHTQEISGAPVIRPLWYEFPQDKETFAMENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGSVTIAVSLSKIS
****YLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGSVTIAVSLSKIPTYQRGGTIIPLRERVRRASSLTLQDPVTLIVALNVNGTARGNLYLDDGQSYDYRKGNYVAVQFKYENGVLSSKGHAHIDTRRREPWLYGDATTSLVRDALRARYALLPYWYTLFHTQEISGAPVIRPLWYEFPQDKETFAMENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGSVTIAV******
MENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGSVTIAVSLSKIPTYQRGGTIIPLRERVRRASSLTLQDPVTLIVALNVNGTARGNLYLDDGQSYDYRKGNYVAVQFKYENGVLSSKGHAHIDTRRREPWLYGDATTSLVRDALRARYALLPYWYTLFHTQEISGAPVIRPLWYEFPQDKETFAMENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGSVTIAVSLSKIS
MENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGSVTIAVSLSKIPTYQRGGTIIPLRERVRRASSLTLQDPVTLIVALNVNGTARGNLYLDDGQSYDYRKGNYVAVQFKYENGVLSSKGHAHIDTRRREPWLYGDATTSLVRDALRARYALLPYWYTLFHTQEISGAPVIRPLWYEFPQDKETFAMENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGSVTIAVSLSKIS
MENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGSVTIAVSLSKIPTYQRGGTIIPLRERVRRASSLTLQDPVTLIVALNVNGTARGNLYLDDGQSYDYRKGNYVAVQFKYENGVLSSKGHAHIDTRRREPWLYGDATTSLVRDALRARYALLPYWYTLFHTQEISGAPVIRPLWYEFPQDKETFAMENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGSVTIAVSLSKIS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGSVTIAVSLSKIPTYQRGGTIIPLRERVRRASSLTLQDPVTLIVALNVNGTARGNLYLDDGQSYDYRKGNYVAVQFKYENGVLSSKGHAHIDTRRREPWLYGDATTSLVRDALRARYALLPYWYTLFHTQEISGAPVIRPLWYEFPQDKETFAMENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGSVTIAVSLSKIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query260 2.2.26 [Sep-21-2011]
Q8TET4 914 Neutral alpha-glucosidase yes N/A 0.484 0.137 0.488 2e-35
Q8BVW0 898 Neutral alpha-glucosidase yes N/A 0.465 0.134 0.496 5e-35
Q9BE70 769 Neutral alpha-glucosidase N/A N/A 0.484 0.163 0.480 1e-34
Q8BHN3 944 Neutral alpha-glucosidase no N/A 0.465 0.128 0.464 3e-32
Q14697 944 Neutral alpha-glucosidase no N/A 0.473 0.130 0.480 8e-32
Q4R4N7 944 Neutral alpha-glucosidase N/A N/A 0.473 0.130 0.472 9e-32
P79403 944 Neutral alpha-glucosidase no N/A 0.465 0.128 0.464 2e-30
Q94502 943 Neutral alpha-glucosidase yes N/A 0.484 0.133 0.441 9e-30
Q9US55 923 Glucosidase 2 subunit alp yes N/A 0.484 0.136 0.437 4e-27
P38138 954 Glucosidase 2 subunit alp yes N/A 0.473 0.128 0.365 1e-21
>sp|Q8TET4|GANC_HUMAN Neutral alpha-glucosidase C OS=Homo sapiens GN=GANC PE=2 SV=3 Back     alignment and function desciption
 Score =  149 bits (376), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 62/127 (48%), Positives = 93/127 (73%)

Query: 133 KGHAHIDTRRREPWLYGDATTSLVRDALRARYALLPYWYTLFHTQEISGAPVIRPLWYEF 192
           +GHA ++T+RREPWL+G+  T L+R+A+R RY LLPYWY+LF+   ++  PV+RPLW EF
Sbjct: 643 RGHATMNTKRREPWLFGEEHTRLIREAIRERYGLLPYWYSLFYHAHVASQPVMRPLWVEF 702

Query: 193 PQDKETFAMENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGSVTI 252
           P + +TF ME++Y++G ++LV PVT+P AT V V+ P ++EVW+D  T+  +    +V I
Sbjct: 703 PDELKTFDMEDEYMLGSALLVHPVTEPKATTVDVFLPGSNEVWYDYKTFAHWEGGCTVKI 762

Query: 253 AVSLSKI 259
            V+L  I
Sbjct: 763 PVALDTI 769
Has alpha-glucosidase activity.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 2EC: 0
>sp|Q8BVW0|GANC_MOUSE Neutral alpha-glucosidase C OS=Mus musculus GN=Ganc PE=2 SV=2 Back     alignment and function description
>sp|Q9BE70|GANC_MACFA Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis GN=GANC PE=2 SV=2 Back     alignment and function description
>sp|Q8BHN3|GANAB_MOUSE Neutral alpha-glucosidase AB OS=Mus musculus GN=Ganab PE=1 SV=1 Back     alignment and function description
>sp|Q14697|GANAB_HUMAN Neutral alpha-glucosidase AB OS=Homo sapiens GN=GANAB PE=1 SV=3 Back     alignment and function description
>sp|Q4R4N7|GANAB_MACFA Neutral alpha-glucosidase AB OS=Macaca fascicularis GN=GANAB PE=2 SV=1 Back     alignment and function description
>sp|P79403|GANAB_PIG Neutral alpha-glucosidase AB OS=Sus scrofa GN=GANAB PE=1 SV=1 Back     alignment and function description
>sp|Q94502|GANAB_DICDI Neutral alpha-glucosidase AB OS=Dictyostelium discoideum GN=modA PE=3 SV=1 Back     alignment and function description
>sp|Q9US55|GLU2A_SCHPO Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gls2 PE=3 SV=1 Back     alignment and function description
>sp|P38138|GLU2A_YEAST Glucosidase 2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROT2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query260
443709570 932 hypothetical protein CAPTEDRAFT_178821 [ 0.461 0.128 0.587 4e-39
242019253 721 Neutral alpha-glucosidase AB precursor, 0.565 0.203 0.510 6e-37
195998333 947 hypothetical protein TRIADDRAFT_37096 [T 0.488 0.134 0.527 2e-36
321473948 928 hypothetical protein DAPPUDRAFT_300811 [ 0.511 0.143 0.556 2e-36
241701391 904 glucosidase II, putative [Ixodes scapula 0.484 0.139 0.535 6e-36
427795091 974 Putative maltase glucoamylase, partial [ 0.484 0.129 0.559 7e-36
260791718 944 hypothetical protein BRAFLDRAFT_115975 [ 0.484 0.133 0.519 3e-35
320162884 922 neutral alpha-glucosidase AB [Capsaspora 0.484 0.136 0.519 4e-35
193638961 907 PREDICTED: neutral alpha-glucosidase AB- 0.488 0.140 0.480 4e-35
348514498 967 PREDICTED: neutral alpha-glucosidase AB- 0.488 0.131 0.519 8e-35
>gi|443709570|gb|ELU04203.1| hypothetical protein CAPTEDRAFT_178821 [Capitella teleta] Back     alignment and taxonomy information
 Score =  167 bits (423), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 74/126 (58%), Positives = 92/126 (73%)

Query: 133 KGHAHIDTRRREPWLYGDATTSLVRDALRARYALLPYWYTLFHTQEISGAPVIRPLWYEF 192
           + HAHI+T+RREPWL  D    ++RD+LRARY LLPYWYTLFH  E  G+P +RPLW EF
Sbjct: 656 RAHAHIETKRREPWLLPDENRDVIRDSLRARYRLLPYWYTLFHAAEAGGSPAMRPLWVEF 715

Query: 193 PQDKETFAMENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGSVTI 252
           P+DK TF  E+QYL+G  +LV PVTD GAT VSVY P  D+VW+D DT + F    +V +
Sbjct: 716 PKDKSTFGTEDQYLVGPGLLVHPVTDAGATGVSVYLPGTDDVWYDMDTSQRFHGAQTVYV 775

Query: 253 AVSLSK 258
           AV L+K
Sbjct: 776 AVKLNK 781

Source: Capitella teleta

Species: Capitella teleta

Genus: Capitella

Family: Capitellidae

Order: Capitellida

Class: Polychaeta

Phylum: Annelida

Superkingdom: Eukaryota
>gi|242019253|ref|XP_002430076.1| Neutral alpha-glucosidase AB precursor, putative [Pediculus humanus corporis] gi|212515157|gb|EEB17338.1| Neutral alpha-glucosidase AB precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|195998333|ref|XP_002109035.1| hypothetical protein TRIADDRAFT_37096 [Trichoplax adhaerens] gi|190589811|gb|EDV29833.1| hypothetical protein TRIADDRAFT_37096 [Trichoplax adhaerens] Back     alignment and taxonomy information
>gi|321473948|gb|EFX84914.1| hypothetical protein DAPPUDRAFT_300811 [Daphnia pulex] Back     alignment and taxonomy information
>gi|241701391|ref|XP_002413171.1| glucosidase II, putative [Ixodes scapularis] gi|215506985|gb|EEC16479.1| glucosidase II, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|427795091|gb|JAA62997.1| Putative maltase glucoamylase, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|260791718|ref|XP_002590875.1| hypothetical protein BRAFLDRAFT_115975 [Branchiostoma floridae] gi|229276073|gb|EEN46886.1| hypothetical protein BRAFLDRAFT_115975 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|320162884|gb|EFW39783.1| neutral alpha-glucosidase AB [Capsaspora owczarzaki ATCC 30864] Back     alignment and taxonomy information
>gi|193638961|ref|XP_001943284.1| PREDICTED: neutral alpha-glucosidase AB-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|348514498|ref|XP_003444777.1| PREDICTED: neutral alpha-glucosidase AB-like [Oreochromis niloticus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query260
ZFIN|ZDB-GENE-070928-36 962 zgc:171967 "zgc:171967" [Danio 0.488 0.132 0.511 1.1e-33
UNIPROTKB|J9NYZ4 738 GANC "Uncharacterized protein" 0.488 0.172 0.488 5.3e-33
UNIPROTKB|E1BKJ4 916 GANC "Uncharacterized protein" 0.488 0.138 0.480 7.3e-33
UNIPROTKB|F1SI19 924 GANC "Uncharacterized protein" 0.676 0.190 0.385 7.4e-33
MGI|MGI:1923301 898 Ganc "glucosidase, alpha; neut 0.484 0.140 0.507 8.9e-33
UNIPROTKB|E2RAA1 914 GANC "Uncharacterized protein" 0.488 0.138 0.488 9.3e-33
UNIPROTKB|E7ER45 2754 MGAM "Maltase" [Homo sapiens ( 0.4 0.037 0.424 1.7e-32
UNIPROTKB|C9JNC2 2259 C9JNC2 "Uncharacterized protei 0.442 0.050 0.401 1.7e-32
UNIPROTKB|E2RT38 1833 MGAM "Uncharacterized protein" 0.4 0.056 0.424 1.7e-32
UNIPROTKB|F1PAQ3 1850 MGAM "Uncharacterized protein" 0.4 0.056 0.424 1.8e-32
ZFIN|ZDB-GENE-070928-36 zgc:171967 "zgc:171967" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 359 (131.4 bits), Expect = 1.1e-33, Sum P(2) = 1.1e-33
 Identities = 65/127 (51%), Positives = 88/127 (69%)

Query:   133 KGHAHIDTRRREPWLYGDATTSLVRDALRARYALLPYWYTLFHTQEISGAPVIRPLWYEF 192
             + HAHIDT RREPWL+G   T+L+R+A+R RYALLP WY LF+    +G PV+RPLW E+
Sbjct:   647 RAHAHIDTPRREPWLFGPENTALIREAVRQRYALLPNWYQLFYNAHNTGQPVMRPLWVEY 706

Query:   193 PQDKETFAMENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGSVTI 252
             P +  TF++E++YLIG  +LV PVTD GAT V+ Y P   EVW+D  + +      S+ I
Sbjct:   707 PAEVTTFSIEDEYLIGKDLLVHPVTDEGATGVTAYLPGKGEVWYDVHSLQKHDGDQSLYI 766

Query:   253 AVSLSKI 259
              V++S I
Sbjct:   767 PVTMSSI 773
GO:0030246 "carbohydrate binding" evidence=IEA
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0004553 "hydrolase activity, hydrolyzing O-glycosyl compounds" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
UNIPROTKB|J9NYZ4 GANC "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BKJ4 GANC "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SI19 GANC "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1923301 Ganc "glucosidase, alpha; neutral C" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RAA1 GANC "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E7ER45 MGAM "Maltase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9JNC2 C9JNC2 "Uncharacterized protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RT38 MGAM "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PAQ3 MGAM "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query260
pfam01055436 pfam01055, Glyco_hydro_31, Glycosyl hydrolases fam 7e-47
COG1501 772 COG1501, COG1501, Alpha-glucosidases, family 31 of 7e-33
cd06602339 cd06602, GH31_MGAM_SI_GAA, This family includes th 3e-22
COG1501772 COG1501, COG1501, Alpha-glucosidases, family 31 of 2e-21
cd06603339 cd06603, GH31_GANC_GANAB_alpha, This family includ 2e-20
pfam01055436 pfam01055, Glyco_hydro_31, Glycosyl hydrolases fam 9e-17
PRK10426635 PRK10426, PRK10426, alpha-glucosidase; Provisional 2e-13
PRK10658665 PRK10658, PRK10658, putative alpha-glucosidase; Pr 3e-13
PLN02763 978 PLN02763, PLN02763, hydrolase, hydrolyzing O-glyco 4e-13
PLN02763 978 PLN02763, PLN02763, hydrolase, hydrolyzing O-glyco 1e-11
cd06604339 cd06604, GH31_glucosidase_II_MalA, Alpha-glucosida 2e-10
cd06600317 cd06600, GH31_MGAM-like, This family includes the 3e-08
PRK10426635 PRK10426, PRK10426, alpha-glucosidase; Provisional 2e-05
>gnl|CDD|216268 pfam01055, Glyco_hydro_31, Glycosyl hydrolases family 31 Back     alignment and domain information 
 Score =  161 bits (409), Expect = 7e-47
 Identities = 59/141 (41%), Positives = 85/141 (60%), Gaps = 8/141 (5%)

Query: 125 YENGVLS--SKGHAHIDTRRREPWLYGDATTSLVRDALRARYALLPYWYTLFHTQEISGA 182
            + G  S   + H+  DT+R+EPWL+G+      R ALR RY LLPY YTLF+    +G 
Sbjct: 288 MQLGAFSPFFRNHSSNDTKRQEPWLFGEEVEEAARKALRLRYRLLPYLYTLFYEAHKTGL 347

Query: 183 PVIRPLWYEFPQDKETFAMENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYE 242
           PV+RPL+ EFP+D+ T+ +++Q+L+GD +LV PV + GAT   VY P  +  W+D  T E
Sbjct: 348 PVMRPLFLEFPEDENTYDIDDQFLLGDDLLVAPVLEEGATSRDVYLP--EGTWYDFWTGE 405

Query: 243 AFTQTGS----VTIAVSLSKI 259
            +   G     VT+   L +I
Sbjct: 406 VYEGGGGGGQTVTVDAPLDRI 426

Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases. Length = 436
>gnl|CDD|224418 COG1501, COG1501, Alpha-glucosidases, family 31 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|133133 cd06602, GH31_MGAM_SI_GAA, This family includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase Back     alignment and domain information
>gnl|CDD|224418 COG1501, COG1501, Alpha-glucosidases, family 31 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|133134 cd06603, GH31_GANC_GANAB_alpha, This family includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB) Back     alignment and domain information
>gnl|CDD|216268 pfam01055, Glyco_hydro_31, Glycosyl hydrolases family 31 Back     alignment and domain information
>gnl|CDD|236691 PRK10426, PRK10426, alpha-glucosidase; Provisional Back     alignment and domain information
>gnl|CDD|236731 PRK10658, PRK10658, putative alpha-glucosidase; Provisional Back     alignment and domain information
>gnl|CDD|215408 PLN02763, PLN02763, hydrolase, hydrolyzing O-glycosyl compounds Back     alignment and domain information
>gnl|CDD|215408 PLN02763, PLN02763, hydrolase, hydrolyzing O-glycosyl compounds Back     alignment and domain information
>gnl|CDD|133135 cd06604, GH31_glucosidase_II_MalA, Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities Back     alignment and domain information
>gnl|CDD|133131 cd06600, GH31_MGAM-like, This family includes the following closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), lysosomal acid alpha-glucosidase (GAA), neutral alpha-glucosidase C (GANC), the alpha subunit of neutral alpha-glucosidase AB (GANAB), and alpha-glucosidase II Back     alignment and domain information
>gnl|CDD|236691 PRK10426, PRK10426, alpha-glucosidase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 260
COG1501 772 Alpha-glucosidases, family 31 of glycosyl hydrolas 100.0
PRK10658665 putative alpha-glucosidase; Provisional 100.0
PF01055441 Glyco_hydro_31: Glycosyl hydrolases family 31 ; In 100.0
KOG1066|consensus 915 100.0
PRK10426635 alpha-glucosidase; Provisional 100.0
PLN02763 978 hydrolase, hydrolyzing O-glycosyl compounds 100.0
KOG1066|consensus915 99.97
KOG1065|consensus 805 99.95
COG1501772 Alpha-glucosidases, family 31 of glycosyl hydrolas 99.94
PLN02763 978 hydrolase, hydrolyzing O-glycosyl compounds 99.92
PF01055441 Glyco_hydro_31: Glycosyl hydrolases family 31 ; In 99.81
PRK10426635 alpha-glucosidase; Provisional 99.8
KOG1065|consensus805 99.79
cd06602339 GH31_MGAM_SI_GAA This family includes the followin 99.77
PRK10658665 putative alpha-glucosidase; Provisional 99.73
cd06600317 GH31_MGAM-like This family includes the following 99.36
cd06603339 GH31_GANC_GANAB_alpha This family includes the clo 99.32
cd06604339 GH31_glucosidase_II_MalA Alpha-glucosidase II (alp 99.29
cd06596261 GH31_CPE1046 CPE1046 is an uncharacterized Clostri 98.95
cd06593308 GH31_xylosidase_YicI YicI alpha-xylosidase is a gl 97.88
cd06598317 GH31_transferase_CtsZ CtsZ (cyclic tetrasaccharide 97.57
cd06601332 GH31_lyase_GLase GLases (alpha-1,4-glucan lyases) 97.07
cd06595292 GH31_xylosidase_XylS-like This family represents a 95.96
cd06591319 GH31_xylosidase_XylS XylS is a glycosyl hydrolase 95.04
cd06589265 GH31 The enzymes of glycosyl hydrolase family 31 ( 95.02
cd06597340 GH31_transferase_CtsY CtsY (cyclic tetrasaccharide 93.59
cd06599317 GH31_glycosidase_Aec37 Glycosyl hydrolase family 3 91.76
cd06594317 GH31_glucosidase_YihQ YihQ is a bacterial alpha-gl 91.34
cd06592303 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharact 89.78
>COG1501 Alpha-glucosidases, family 31 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.9e-41  Score=326.75  Aligned_cols=156  Identities=33%  Similarity=0.614  Sum_probs=144.0

Q ss_pred             EEEeeCCCccc--cccceeeEEEEEeeccccccccccccCCCcCcccccCchhhHHHHHHHHhHHhhHHHHHHHHHHhhc
Q psy11532        102 NLYLDDGQSYD--YRKGNYVAVQFKYENGVLSSKGHAHIDTRRREPWLYGDATTSLVRDALRARYALLPYWYTLFHTQEI  179 (260)
Q Consensus       102 ~ly~DDG~s~~--y~~g~~~~~~f~~~~~~p~~R~H~~~~~~~~~Pw~~~~~~~~~~~~~~~~r~~l~py~y~~~~~~~~  179 (260)
                      -+-.|-|--..  ....|++.||+++..++|+||.|++ +...++||.|++++.+++|+++++||+|+|||||++.+|++
T Consensus       504 ~wg~DiGGF~g~~~~~~EL~~RW~q~g~F~P~~R~H~~-d~~~rePW~~~e~~~~i~r~~~~lR~~LlPYiYt~~~~a~~  582 (772)
T COG1501         504 FWGHDIGGFTGGDDPTAELYIRWYQFGAFSPIFRLHGN-DNIPREPWAFGEETEEIVREYIQLRYRLLPYIYTLAAEASE  582 (772)
T ss_pred             cccccccccCCCCCCCHHHHHHHHHHHhcCchhhhhCC-CCCCCCCccCChhHHHHHHHHHHHHHccchHHHHHHHHHhc
Confidence            33346543322  4566788899999999999999998 77899999999999999999999999999999999999999


Q ss_pred             CCCceecccccccCCChhhhhccCeeeeCCceEEEeecCCCCeEEEEEeCCCCCcEEECCCCcEEeCCeEEEEEcCCCCC
Q psy11532        180 SGAPVIRPLWYEFPQDKETFAMENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGSVTIAVSLSKI  259 (260)
Q Consensus       180 ~G~pi~rpl~~~~p~d~~~~~~~~q~~~G~~lLvaPv~~~~~~~~~vylP~~~~~W~~~~~~~~~~g~~~~~~~~~l~~i  259 (260)
                      +|.|+|||||++||+|+.++++++|||||++||||||+++++++|+||||+|  .|||+|||+.+.||+++++++|+++|
T Consensus       583 tG~P~mRplf~~fp~D~~~~~iddqym~G~~lLVAPV~~eg~~~r~vyLP~g--~W~d~~tg~~~~Gg~~i~~~apl~~i  660 (772)
T COG1501         583 TGLPMMRPLFLEFPEDETTYNLDDQYMFGDDLLVAPVVEEGQTSREVYLPEG--TWYDFWTGEEYEGGQTITVEAPLETI  660 (772)
T ss_pred             cCCcceehhheeCCCChhhhhcccceecccceEEeeccccCcceEEEECCCc--eEEEccCCCEEeCCeeEEEecCccCC
Confidence            9999999999999999999999999999999999999999999999999976  59999999999999999999999999


Q ss_pred             C
Q psy11532        260 S  260 (260)
Q Consensus       260 p  260 (260)
                      |
T Consensus       661 P  661 (772)
T COG1501         661 P  661 (772)
T ss_pred             c
Confidence            8

>PRK10658 putative alpha-glucosidase; Provisional Back     alignment and domain information
>PF01055 Glyco_hydro_31: Glycosyl hydrolases family 31 ; InterPro: IPR000322 O-Glycosyl hydrolases 3 Back     alignment and domain information
>KOG1066|consensus Back     alignment and domain information
>PRK10426 alpha-glucosidase; Provisional Back     alignment and domain information
>PLN02763 hydrolase, hydrolyzing O-glycosyl compounds Back     alignment and domain information
>KOG1066|consensus Back     alignment and domain information
>KOG1065|consensus Back     alignment and domain information
>COG1501 Alpha-glucosidases, family 31 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02763 hydrolase, hydrolyzing O-glycosyl compounds Back     alignment and domain information
>PF01055 Glyco_hydro_31: Glycosyl hydrolases family 31 ; InterPro: IPR000322 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK10426 alpha-glucosidase; Provisional Back     alignment and domain information
>KOG1065|consensus Back     alignment and domain information
>cd06602 GH31_MGAM_SI_GAA This family includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase Back     alignment and domain information
>PRK10658 putative alpha-glucosidase; Provisional Back     alignment and domain information
>cd06600 GH31_MGAM-like This family includes the following closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), lysosomal acid alpha-glucosidase (GAA), neutral alpha-glucosidase C (GANC), the alpha subunit of neutral alpha-glucosidase AB (GANAB), and alpha-glucosidase II Back     alignment and domain information
>cd06603 GH31_GANC_GANAB_alpha This family includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB) Back     alignment and domain information
>cd06604 GH31_glucosidase_II_MalA Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities Back     alignment and domain information
>cd06596 GH31_CPE1046 CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain Back     alignment and domain information
>cd06593 GH31_xylosidase_YicI YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose Back     alignment and domain information
>cd06598 GH31_transferase_CtsZ CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z) is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY Back     alignment and domain information
>cd06601 GH31_lyase_GLase GLases (alpha-1,4-glucan lyases) are glycosyl hydrolase family 31 (GH31) enzymes that degrade alpha-1,4-glucans and maltooligosaccharides via a nonhydrolytic pathway to yield 1,5-D-anhydrofructose from the nonreducing end Back     alignment and domain information
>cd06595 GH31_xylosidase_XylS-like This family represents an uncharacterized glycosyl hydrolase family 31 (GH31) enzyme found in bacteria and eukaryotes that is related to the XylS xylosidase of Sulfolobus solfataricus Back     alignment and domain information
>cd06591 GH31_xylosidase_XylS XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate Back     alignment and domain information
>cd06589 GH31 The enzymes of glycosyl hydrolase family 31 (GH31) occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase Back     alignment and domain information
>cd06597 GH31_transferase_CtsY CtsY (cyclic tetrasaccharide-synthesizing enzyme Y) is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ Back     alignment and domain information
>cd06599 GH31_glycosidase_Aec37 Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37 Back     alignment and domain information
>cd06594 GH31_glucosidase_YihQ YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride Back     alignment and domain information
>cd06592 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharacterized Homo sapiens protein with a glycosyl hydrolase family 31 (GH31) domain that is homologous to the Escherichia coli YihQ glucosidase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query260
3ton_A 908 Crystral Structure Of The C-Terminal Subunit Of Hum 3e-18
3l4t_A 875 Crystal Complex Of N-Terminal Human Maltase-Glucoam 1e-13
2qly_A 870 Crystral Structure Of The N-Terminal Subunit Of Hum 1e-13
3lpo_A898 Crystal Structure Of The N-Terminal Domain Of Sucra 2e-13
3lpo_A 898 Crystal Structure Of The N-Terminal Domain Of Sucra 4e-12
4b9y_A 817 Crystal Structure Of Apo Agd31b, Alpha-transglucosy 4e-12
1xsi_A 778 Structure Of A Family 31 Alpha Glycosidase Length = 1e-10
2f2h_A 773 Structure Of The Yici Thiosugar Michaelis Complex L 1e-10
2g3m_A693 Crystal Structure Of The Sulfolobus Solfataricus Al 2e-10
2xvg_A1020 Crystal Structure Of Alpha-Xylosidase (Gh31) From C 6e-09
2xvg_A 1020 Crystal Structure Of Alpha-Xylosidase (Gh31) From C 3e-07
3pha_A667 The Crystal Structure Of The W169y Mutant Of Alpha- 3e-08
3nuk_A666 The Crystal Structure Of The W169y Mutant Of Alpha- 3e-08
3nsx_A666 The Crystal Structure Of The The Crystal Structure 4e-08
3m6d_A666 The Crystal Structure Of The D307a Mutant Of Glycos 4e-08
3m46_A666 The Crystal Structure Of The D73a Mutant Of Glycosi 4e-08
1we5_A 772 Crystal Structure Of Alpha-Xylosidase From Escheric 8e-08
3n04_A666 The Crystal Structure Of The Alpha-Glucosidase (Fam 2e-07
>pdb|3TON|A Chain A, Crystral Structure Of The C-Terminal Subunit Of Human Maltase- Glucoamylase Length = 908 Back     alignment and structure 
Iteration: 1

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 65/106 (61%), Gaps = 2/106 (1%)
Query: 132 SKGHAHIDTRRREPWLYGDATTSLVRDALRARYALLPYWYTLFHTQEISGAPVIRPLWYE 191
           S+ H  I TRR++P  +  A  ++ R  L+ RY LLPY YTL H     G  V+RPL +E
Sbjct: 630 SRNHNTIGTRRQDPVSWDVAFVNISRTVLQTRYTLLPYLYTLMHKAHTEGVTVVRPLLHE 689
Query: 192 FPQDKETFAMENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFD 237
           F  D+ T+ +++Q+L+G + LV PV +  A  V+ YFPRA   W+D
Sbjct: 690 FVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRAR--WYD 733
>pdb|3L4T|A Chain A, Crystal Complex Of N-Terminal Human Maltase-Glucoamylase With Bj2661 Length = 875 Back     alignment and structure
>pdb|2QLY|A Chain A, Crystral Structure Of The N-Terminal Subunit Of Human Maltase- Glucoamylase Length = 870 Back     alignment and structure
>pdb|3LPO|A Chain A, Crystal Structure Of The N-Terminal Domain Of Sucrase-Isomal Length = 898 Back     alignment and structure
>pdb|3LPO|A Chain A, Crystal Structure Of The N-Terminal Domain Of Sucrase-Isomal Length = 898 Back     alignment and structure
>pdb|4B9Y|A Chain A, Crystal Structure Of Apo Agd31b, Alpha-transglucosylase In Glycoside Hydrolase Family 31 Length = 817 Back     alignment and structure
>pdb|1XSI|A Chain A, Structure Of A Family 31 Alpha Glycosidase Length = 778 Back     alignment and structure
>pdb|2F2H|A Chain A, Structure Of The Yici Thiosugar Michaelis Complex Length = 773 Back     alignment and structure
>pdb|2G3M|A Chain A, Crystal Structure Of The Sulfolobus Solfataricus Alpha- Glucosidase Mala Length = 693 Back     alignment and structure
>pdb|2XVG|A Chain A, Crystal Structure Of Alpha-Xylosidase (Gh31) From Cellvibrio Japonicus Length = 1020 Back     alignment and structure
>pdb|2XVG|A Chain A, Crystal Structure Of Alpha-Xylosidase (Gh31) From Cellvibrio Japonicus Length = 1020 Back     alignment and structure
>pdb|3PHA|A Chain A, The Crystal Structure Of The W169y Mutant Of Alpha-Glucosidase (Gh31 Family) From Ruminococcus Obeum Atcc 29174 In Complex With Acarbose Length = 667 Back     alignment and structure
>pdb|3NUK|A Chain A, The Crystal Structure Of The W169y Mutant Of Alpha-Glucosidase (Family 31) From Ruminococcus Obeum Atcc 29174 Length = 666 Back     alignment and structure
>pdb|3NSX|A Chain A, The Crystal Structure Of The The Crystal Structure Of The D420a Mutant Of The Alpha-Glucosidase (Family 31) From Ruminococcus Obeum Atcc 29174 Length = 666 Back     alignment and structure
>pdb|3M6D|A Chain A, The Crystal Structure Of The D307a Mutant Of Glycoside Hydrolase (Family 31) From Ruminococcus Obeum Atcc 29174 Length = 666 Back     alignment and structure
>pdb|3M46|A Chain A, The Crystal Structure Of The D73a Mutant Of Glycoside Hydrolase (Family 31) From Ruminococcus Obeum Atcc 29174 Length = 666 Back     alignment and structure
>pdb|1WE5|A Chain A, Crystal Structure Of Alpha-Xylosidase From Escherichia Coli Length = 772 Back     alignment and structure
>pdb|3N04|A Chain A, The Crystal Structure Of The Alpha-Glucosidase (Family 31) From Ruminococcus Obeum Atcc 29174 Length = 666 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query260
3top_A 908 Maltase-glucoamylase, intestinal; membrane, hydrol 2e-49
3top_A908 Maltase-glucoamylase, intestinal; membrane, hydrol 1e-40
2g3m_A693 Maltase, alpha-glucosidase; hydrolase, glycoside h 4e-47
2g3m_A693 Maltase, alpha-glucosidase; hydrolase, glycoside h 4e-28
3lpp_A 898 Sucrase-isomaltase; glycoside hydrolase family 31, 5e-47
3lpp_A898 Sucrase-isomaltase; glycoside hydrolase family 31, 5e-43
3l4y_A 875 Maltase-glucoamylase, intestinal; glycoside hydrol 5e-47
3l4y_A875 Maltase-glucoamylase, intestinal; glycoside hydrol 4e-39
3nsx_A666 Alpha-glucosidase; structural genomics, PSI-2, pro 7e-46
3nsx_A666 Alpha-glucosidase; structural genomics, PSI-2, pro 4e-34
2xvl_A 1020 Alpha-xylosidase, putative, XYL31A; hydrolase, gly 1e-43
2xvl_A1020 Alpha-xylosidase, putative, XYL31A; hydrolase, gly 9e-40
2f2h_A 773 Putative family 31 glucosidase YICI; BETA8alpha8 b 5e-43
2f2h_A773 Putative family 31 glucosidase YICI; BETA8alpha8 b 6e-31
2x2h_A 1027 Alpha-1,4-glucan lyase isozyme 1; anhydrofructose 1e-37
2x2h_A1027 Alpha-1,4-glucan lyase isozyme 1; anhydrofructose 3e-35
>3top_A Maltase-glucoamylase, intestinal; membrane, hydrolase-hydrolase inhibitor complex; HET: ACR; 2.88A {Homo sapiens} PDB: 3ton_A* Length = 908 Back     alignment and structure
 Score =  173 bits (439), Expect = 2e-49
 Identities = 47/127 (37%), Positives = 67/127 (52%), Gaps = 3/127 (2%)

Query: 134 GHAHIDTRRREPWLYGDATTSLVRDALRARYALLPYWYTLFHTQEISGAPVIRPLWYEFP 193
            H  I TRR++P  +  A  ++ R  L+ RY LLPY YTL H     G  V+RPL +EF 
Sbjct: 632 NHNTIGTRRQDPVSWDVAFVNISRTVLQTRYTLLPYLYTLMHKAHTEGVTVVRPLLHEFV 691

Query: 194 QDKETFAMENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGS-VTI 252
            D+ T+ +++Q+L+G + LV PV +  A  V+ YFP     W+D  T       G   T+
Sbjct: 692 SDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFP--RARWYDYYTGVDINARGEWKTL 749

Query: 253 AVSLSKI 259
              L  I
Sbjct: 750 PAPLDHI 756
>3top_A Maltase-glucoamylase, intestinal; membrane, hydrolase-hydrolase inhibitor complex; HET: ACR; 2.88A {Homo sapiens} PDB: 3ton_A* Length = 908 Back     alignment and structure
>2g3m_A Maltase, alpha-glucosidase; hydrolase, glycoside hydrolase family 31, multidomain protein, (beta/alpha)8 barrel, retaining mechanism; 2.55A {Sulfolobus solfataricus} PDB: 2g3n_A* Length = 693 Back     alignment and structure
>2g3m_A Maltase, alpha-glucosidase; hydrolase, glycoside hydrolase family 31, multidomain protein, (beta/alpha)8 barrel, retaining mechanism; 2.55A {Sulfolobus solfataricus} PDB: 2g3n_A* Length = 693 Back     alignment and structure
>3lpp_A Sucrase-isomaltase; glycoside hydrolase family 31, alpha-glucosidase membrane, disease mutation, disulfide bond, glycoprotein, glycosidase; HET: NAG BMA MAN KTL; 2.15A {Homo sapiens} PDB: 3lpo_A* Length = 898 Back     alignment and structure
>3lpp_A Sucrase-isomaltase; glycoside hydrolase family 31, alpha-glucosidase membrane, disease mutation, disulfide bond, glycoprotein, glycosidase; HET: NAG BMA MAN KTL; 2.15A {Homo sapiens} PDB: 3lpo_A* Length = 898 Back     alignment and structure
>3l4y_A Maltase-glucoamylase, intestinal; glycoside hydrolase family 31, cell membrane, disulfide bond, glycoprotein, glycosidase, hydrolase, membrane; HET: NR4 NAG; 1.80A {Homo sapiens} PDB: 3l4u_A* 3l4v_A* 3l4w_A* 3l4x_A* 3l4t_A* 3l4z_A* 2qmj_A* 2qly_A* 3ctt_A* Length = 875 Back     alignment and structure
>3l4y_A Maltase-glucoamylase, intestinal; glycoside hydrolase family 31, cell membrane, disulfide bond, glycoprotein, glycosidase, hydrolase, membrane; HET: NR4 NAG; 1.80A {Homo sapiens} PDB: 3l4u_A* 3l4v_A* 3l4w_A* 3l4x_A* 3l4t_A* 3l4z_A* 2qmj_A* 2qly_A* 3ctt_A* Length = 875 Back     alignment and structure
>3nsx_A Alpha-glucosidase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, acarbose; 1.57A {Ruminococcus obeum} PDB: 3ffj_A 3n04_A 3pha_A* 3nuk_A 3nxm_A* 3m46_A 3mkk_A* 3m6d_A* 3nqq_A* 3poc_A* Length = 666 Back     alignment and structure
>3nsx_A Alpha-glucosidase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, acarbose; 1.57A {Ruminococcus obeum} PDB: 3ffj_A 3n04_A 3pha_A* 3nuk_A 3nxm_A* 3m46_A 3mkk_A* 3m6d_A* 3nqq_A* 3poc_A* Length = 666 Back     alignment and structure
>2xvl_A Alpha-xylosidase, putative, XYL31A; hydrolase, glycosyl hydrolase family 31, (beta/alpha)8 barre; HET: PXN; 2.30A {Cellvibrio japonicus} PDB: 2xvg_A* 2xvk_A* Length = 1020 Back     alignment and structure
>2xvl_A Alpha-xylosidase, putative, XYL31A; hydrolase, glycosyl hydrolase family 31, (beta/alpha)8 barre; HET: PXN; 2.30A {Cellvibrio japonicus} PDB: 2xvg_A* 2xvk_A* Length = 1020 Back     alignment and structure
>2f2h_A Putative family 31 glucosidase YICI; BETA8alpha8 barrel, hydrolase; HET: MPO XTG; 1.95A {Escherichia coli} SCOP: b.150.1.1 b.30.5.11 b.71.1.4 c.1.8.13 PDB: 1xsj_A 1xsi_A 1xsk_A* 1we5_A* Length = 773 Back     alignment and structure
>2f2h_A Putative family 31 glucosidase YICI; BETA8alpha8 barrel, hydrolase; HET: MPO XTG; 1.95A {Escherichia coli} SCOP: b.150.1.1 b.30.5.11 b.71.1.4 c.1.8.13 PDB: 1xsj_A 1xsi_A 1xsk_A* 1we5_A* Length = 773 Back     alignment and structure
>2x2h_A Alpha-1,4-glucan lyase isozyme 1; anhydrofructose pathway, glycoside hydrolase family 3 starch binding domain; 2.06A {Gracilariopsis lemaneiformis} PDB: 2x2i_A* 2x2j_A* Length = 1027 Back     alignment and structure
>2x2h_A Alpha-1,4-glucan lyase isozyme 1; anhydrofructose pathway, glycoside hydrolase family 3 starch binding domain; 2.06A {Gracilariopsis lemaneiformis} PDB: 2x2i_A* 2x2j_A* Length = 1027 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query260
3lpp_A 898 Sucrase-isomaltase; glycoside hydrolase family 31, 100.0
3l4y_A 875 Maltase-glucoamylase, intestinal; glycoside hydrol 100.0
4ba0_A 817 Alpha-glucosidase, putative, ADG31B; hydrolase; HE 100.0
2xvl_A 1020 Alpha-xylosidase, putative, XYL31A; hydrolase, gly 100.0
3top_A 908 Maltase-glucoamylase, intestinal; membrane, hydrol 100.0
2f2h_A 773 Putative family 31 glucosidase YICI; BETA8alpha8 b 100.0
3nsx_A666 Alpha-glucosidase; structural genomics, PSI-2, pro 100.0
2g3m_A693 Maltase, alpha-glucosidase; hydrolase, glycoside h 100.0
2x2h_A 1027 Alpha-1,4-glucan lyase isozyme 1; anhydrofructose 100.0
3l4y_A875 Maltase-glucoamylase, intestinal; glycoside hydrol 99.97
3lpp_A898 Sucrase-isomaltase; glycoside hydrolase family 31, 99.97
3top_A908 Maltase-glucoamylase, intestinal; membrane, hydrol 99.96
4ba0_A817 Alpha-glucosidase, putative, ADG31B; hydrolase; HE 99.96
2xvl_A1020 Alpha-xylosidase, putative, XYL31A; hydrolase, gly 99.96
3nsx_A666 Alpha-glucosidase; structural genomics, PSI-2, pro 99.95
2f2h_A773 Putative family 31 glucosidase YICI; BETA8alpha8 b 99.92
2x2h_A1027 Alpha-1,4-glucan lyase isozyme 1; anhydrofructose 99.91
2g3m_A693 Maltase, alpha-glucosidase; hydrolase, glycoside h 99.86
>3lpp_A Sucrase-isomaltase; glycoside hydrolase family 31, alpha-glucosidase membrane, disease mutation, disulfide bond, glycoprotein, glycosidase; HET: NAG BMA MAN KTL; 2.15A {Homo sapiens} PDB: 3lpo_A* Back     alignment and structure
Probab=100.00  E-value=3.4e-40  Score=324.33  Aligned_cols=153  Identities=26%  Similarity=0.447  Sum_probs=141.7

Q ss_pred             eCCCccccccceeeEEEEEeeccccccccccccCCCcCcccccCch--hhHHHHHHHHhHHhhHHHHHHHHHHhhcCCCc
Q psy11532        106 DDGQSYDYRKGNYVAVQFKYENGVLSSKGHAHIDTRRREPWLYGDA--TTSLVRDALRARYALLPYWYTLFHTQEISGAP  183 (260)
Q Consensus       106 DDG~s~~y~~g~~~~~~f~~~~~~p~~R~H~~~~~~~~~Pw~~~~~--~~~~~~~~~~~r~~l~py~y~~~~~~~~~G~p  183 (260)
                      |-|.-..-...|++.||+++..+.|+||+|++.+...++||.|+++  +.+++|+++++||+|+|||||++++|+++|.|
T Consensus       600 DIGGF~g~~~~EL~~RW~Q~GaF~P~~R~H~~~~~~~~EPw~f~~~~~~~~~~r~~i~lRY~LlPYlYtl~~~a~~~G~P  679 (898)
T 3lpp_A          600 DICGFVAETTEELCRRWMQLGAFYPFSRNHNSDGYEHQDPAFFGQNSLLVKSSRQYLTIRYTLLPFLYTLFYKAHVFGET  679 (898)
T ss_dssp             EETCSBSCCCHHHHHHHHHHHTTSSSCEECCCTTSCCCSGGGGCTTCHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHCCC
T ss_pred             CCcCCCCCCCHHHHHHHHHHhcCCccchhccCCCCCCCCCeecCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCc
Confidence            4443333345678889999999999999999988889999999998  99999999999999999999999999999999


Q ss_pred             eecccccccCCChhhhhccCeeeeCCceEEEeecCCCCeEEEEEeCCCCCcEEECCCCcEEe-CCeEEEEEcCCCCCC
Q psy11532        184 VIRPLWYEFPQDKETFAMENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFT-QTGSVTIAVSLSKIS  260 (260)
Q Consensus       184 i~rpl~~~~p~d~~~~~~~~q~~~G~~lLvaPv~~~~~~~~~vylP~~~~~W~~~~~~~~~~-g~~~~~~~~~l~~ip  260 (260)
                      ||||||++||+|+.++.+++|||+|++||||||+++++++|+||||+|  .|||++||+.+. ||+++++++||++||
T Consensus       680 v~RPL~~efP~D~~~~~i~dQfm~G~~LLVAPV~~~g~~~~~VYLP~g--~Wyd~~tg~~~~~gg~~i~~~apld~iP  755 (898)
T 3lpp_A          680 VARPVLHEFYEDTNSWIEDTEFLWGPALLITPVLKQGADTVSAYIPDA--IWYDYESGAKRPWRKQRVDMYLPADKIG  755 (898)
T ss_dssp             SEECTHHHHTTSGGGGGCCSSEEETTTEEEECCCSTTCSEEEEEECSS--CEEETTTCCBCSCCSEEEEEECCTTCCE
T ss_pred             eecccccCCCCChHHhcCCCeEEecCCcEEeeeccCCCcEEEEECCCC--eEEECCCCcEEeeCCEEEEEECCcccce
Confidence            999999999999999999999999999999999999999999999988  599999999985 889999999999998
>3l4y_A Maltase-glucoamylase, intestinal; glycoside hydrolase family 31, cell membrane, disulfide bond, glycoprotein, glycosidase, hydrolase, membrane; HET: NR4 NAG; 1.80A {Homo sapiens} PDB: 3l4u_A* 3l4v_A* 3l4w_A* 3l4x_A* 3l4t_A* 3l4z_A* 2qmj_A* 2qly_A* 3ctt_A* Back     alignment and structure
>4ba0_A Alpha-glucosidase, putative, ADG31B; hydrolase; HET: 5GF PGE ARG; 1.85A {Cellvibrio japonicus} PDB: 4b9z_A* 4b9y_A* Back     alignment and structure
>2xvl_A Alpha-xylosidase, putative, XYL31A; hydrolase, glycosyl hydrolase family 31, (beta/alpha)8 barre; HET: PXN; 2.30A {Cellvibrio japonicus} PDB: 2xvg_A* 2xvk_A* Back     alignment and structure
>3top_A Maltase-glucoamylase, intestinal; membrane, hydrolase-hydrolase inhibitor complex; HET: ACR; 2.88A {Homo sapiens} PDB: 3ton_A* Back     alignment and structure
>2f2h_A Putative family 31 glucosidase YICI; BETA8alpha8 barrel, hydrolase; HET: MPO XTG; 1.95A {Escherichia coli} SCOP: b.150.1.1 b.30.5.11 b.71.1.4 c.1.8.13 PDB: 1xsj_A 1xsi_A 1xsk_A* 1we5_A* Back     alignment and structure
>3nsx_A Alpha-glucosidase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, acarbose; 1.57A {Ruminococcus obeum} PDB: 3ffj_A 3n04_A 3pha_A* 3nuk_A 3nxm_A* 3m46_A 3mkk_A* 3m6d_A* 3nqq_A* 3poc_A* Back     alignment and structure
>2g3m_A Maltase, alpha-glucosidase; hydrolase, glycoside hydrolase family 31, multidomain protein, (beta/alpha)8 barrel, retaining mechanism; 2.55A {Sulfolobus solfataricus} PDB: 2g3n_A* Back     alignment and structure
>2x2h_A Alpha-1,4-glucan lyase isozyme 1; anhydrofructose pathway, glycoside hydrolase family 3 starch binding domain; 2.06A {Gracilariopsis lemaneiformis} PDB: 2x2i_A* 2x2j_A* Back     alignment and structure
>3l4y_A Maltase-glucoamylase, intestinal; glycoside hydrolase family 31, cell membrane, disulfide bond, glycoprotein, glycosidase, hydrolase, membrane; HET: NR4 NAG; 1.80A {Homo sapiens} PDB: 3l4u_A* 3l4v_A* 3l4w_A* 3l4x_A* 3l4t_A* 3l4z_A* 2qmj_A* 2qly_A* 3ctt_A* Back     alignment and structure
>3lpp_A Sucrase-isomaltase; glycoside hydrolase family 31, alpha-glucosidase membrane, disease mutation, disulfide bond, glycoprotein, glycosidase; HET: NAG BMA MAN KTL; 2.15A {Homo sapiens} PDB: 3lpo_A* Back     alignment and structure
>3top_A Maltase-glucoamylase, intestinal; membrane, hydrolase-hydrolase inhibitor complex; HET: ACR; 2.88A {Homo sapiens} PDB: 3ton_A* Back     alignment and structure
>4ba0_A Alpha-glucosidase, putative, ADG31B; hydrolase; HET: 5GF PGE ARG; 1.85A {Cellvibrio japonicus} PDB: 4b9z_A* 4b9y_A* Back     alignment and structure
>2xvl_A Alpha-xylosidase, putative, XYL31A; hydrolase, glycosyl hydrolase family 31, (beta/alpha)8 barre; HET: PXN; 2.30A {Cellvibrio japonicus} PDB: 2xvg_A* 2xvk_A* Back     alignment and structure
>3nsx_A Alpha-glucosidase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, acarbose; 1.57A {Ruminococcus obeum} PDB: 3ffj_A 3n04_A 3pha_A* 3nuk_A 3nxm_A* 3m46_A 3mkk_A* 3m6d_A* 3nqq_A* 3poc_A* Back     alignment and structure
>2f2h_A Putative family 31 glucosidase YICI; BETA8alpha8 barrel, hydrolase; HET: MPO XTG; 1.95A {Escherichia coli} SCOP: b.150.1.1 b.30.5.11 b.71.1.4 c.1.8.13 PDB: 1xsj_A 1xsi_A 1xsk_A* 1we5_A* Back     alignment and structure
>2x2h_A Alpha-1,4-glucan lyase isozyme 1; anhydrofructose pathway, glycoside hydrolase family 3 starch binding domain; 2.06A {Gracilariopsis lemaneiformis} PDB: 2x2i_A* 2x2j_A* Back     alignment and structure
>2g3m_A Maltase, alpha-glucosidase; hydrolase, glycoside hydrolase family 31, multidomain protein, (beta/alpha)8 barrel, retaining mechanism; 2.55A {Sulfolobus solfataricus} PDB: 2g3n_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 260
d2f2ha380 b.71.1.4 (A:586-665) Putative glucosidase YicI, do 3e-20
d2f2ha380 b.71.1.4 (A:586-665) Putative glucosidase YicI, do 4e-11
d2f2ha4338 c.1.8.13 (A:248-585) Putative glucosidase YicI, do 3e-12
>d2f2ha3 b.71.1.4 (A:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure

class: All beta proteins
fold: Glycosyl hydrolase domain
superfamily: Glycosyl hydrolase domain
family: Putative glucosidase YicI, domain 3
domain: Putative glucosidase YicI, domain 3
species: Escherichia coli [TaxId: 562]

 Score = 80.2 bits (198), Expect = 3e-20
 Identities = 17/77 (22%), Positives = 30/77 (38%), Gaps = 3/77 (3%)

Query: 183 PVIRPLWYEFPQDKETFAMENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYE 242
           P++R +  EFP D     ++ QY++GD+++V PV       V  Y P     W      +
Sbjct: 1   PMMRAMMMEFPDDPACDYLDRQYMLGDNVMVAPVFTEAGD-VQFYLPEGR--WTHLWHND 57

Query: 243 AFTQTGSVTIAVSLSKI 259
               +           +
Sbjct: 58  ELDGSRWHKQQHGFLSL 74
>d2f2ha3 b.71.1.4 (A:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d2f2ha4 c.1.8.13 (A:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]} Length = 338 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query260
d2f2ha380 Putative glucosidase YicI, domain 3 {Escherichia c 99.95
d2f2ha380 Putative glucosidase YicI, domain 3 {Escherichia c 99.88
d2f2ha4338 Putative glucosidase YicI, domain 2 {Escherichia c 99.22
>d2f2ha3 b.71.1.4 (A:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Glycosyl hydrolase domain
superfamily: Glycosyl hydrolase domain
family: Putative glucosidase YicI, domain 3
domain: Putative glucosidase YicI, domain 3
species: Escherichia coli [TaxId: 562]

Probab=99.95  E-value=4.1e-29  Score=175.20  Aligned_cols=75  Identities=23%  Similarity=0.486  Sum_probs=72.4

Q ss_pred             ceecccccccCCChhhhhccCeeeeCCceEEEeecCCCCeEEEEEeCCCCCcEEECCCCcEEeCCeEEEEEcCCCCCC
Q psy11532        183 PVIRPLWYEFPQDKETFAMENQYLIGDSILVRPVTDPGATQVSVYFPRADEVWFDRDTYEAFTQTGSVTIAVSLSKIS  260 (260)
Q Consensus       183 pi~rpl~~~~p~d~~~~~~~~q~~~G~~lLvaPv~~~~~~~~~vylP~~~~~W~~~~~~~~~~g~~~~~~~~~l~~ip  260 (260)
                      ||+||||++||+|+.++++++|||+|++||||||+++++ +++||||+|  +|||++||+.++||+++++.+||++||
T Consensus         1 Pi~RPl~~~~p~d~~~~~~~~Qfm~G~~lLVaPV~~~~~-~~~vylP~G--~W~d~~t~~~~~g~~~~~~~~~l~~iP   75 (80)
T d2f2ha3           1 PMMRAMMMEFPDDPACDYLDRQYMLGDNVMVAPVFTEAG-DVQFYLPEG--RWTHLWHNDELDGSRWHKQQHGFLSLP   75 (80)
T ss_dssp             CSEECHHHHSTTCGGGTTCCSCEEETTTEEECCCCSSSC-EEEEEECSS--EEEETTTCCEEECSEEEEEECCTTCCC
T ss_pred             CcccCccccCCCChhHhCCCcEEEEcCeEEEEEeeeCCc-EEEEEcCCc--eEEECCCCCEEECCEEEEEeCCCcccC
Confidence            899999999999999999999999999999999999987 599999998  599999999999999999999999998
>d2f2ha3 b.71.1.4 (A:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f2ha4 c.1.8.13 (A:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure