Psyllid ID: psy11576
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 108 | ||||||
| 194764555 | 263 | GF23073 [Drosophila ananassae] gi|190614 | 0.370 | 0.152 | 0.875 | 8e-13 | |
| 312385948 | 211 | hypothetical protein AND_00151 [Anophele | 0.370 | 0.189 | 0.85 | 1e-12 | |
| 195036824 | 260 | GH18560 [Drosophila grimshawi] gi|195110 | 0.370 | 0.153 | 0.85 | 2e-12 | |
| 24647891 | 256 | 14-3-3epsilon, isoform C [Drosophila mel | 0.370 | 0.156 | 0.85 | 2e-12 | |
| 24647887 | 261 | 14-3-3epsilon, isoform B [Drosophila mel | 0.370 | 0.153 | 0.85 | 2e-12 | |
| 332374092 | 258 | unknown [Dendroctonus ponderosae] | 0.370 | 0.155 | 0.85 | 2e-12 | |
| 288784881 | 259 | AT09839p [Drosophila melanogaster] | 0.370 | 0.154 | 0.85 | 2e-12 | |
| 195450008 | 260 | GK22388 [Drosophila willistoni] gi|19416 | 0.370 | 0.153 | 0.85 | 2e-12 | |
| 24647889 | 260 | 14-3-3epsilon, isoform D [Drosophila mel | 0.370 | 0.153 | 0.85 | 2e-12 | |
| 359843276 | 256 | 14-3-3 protein epsilon [Schistocerca gre | 0.370 | 0.156 | 0.875 | 2e-12 |
| >gi|194764555|ref|XP_001964394.1| GF23073 [Drosophila ananassae] gi|190614666|gb|EDV30190.1| GF23073 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
Score = 77.8 bits (190), Expect = 8e-13, Method: Compositional matrix adjust.
Identities = 35/40 (87%), Positives = 37/40 (92%)
Query: 63 RERVEKELKDICSDILNVLSKHLIPCALTGESKVFYYKMK 102
R +VEKEL+DICSDILNVL KHLIPCA TGESKVFYYKMK
Sbjct: 86 RGQVEKELRDICSDILNVLEKHLIPCATTGESKVFYYKMK 125
|
Source: Drosophila ananassae Species: Drosophila ananassae Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|312385948|gb|EFR30335.1| hypothetical protein AND_00151 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|195036824|ref|XP_001989868.1| GH18560 [Drosophila grimshawi] gi|195110585|ref|XP_001999860.1| GI24759 [Drosophila mojavensis] gi|195392509|ref|XP_002054900.1| GJ22546 [Drosophila virilis] gi|193894064|gb|EDV92930.1| GH18560 [Drosophila grimshawi] gi|193916454|gb|EDW15321.1| GI24759 [Drosophila mojavensis] gi|194152986|gb|EDW68420.1| GJ22546 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|24647891|ref|NP_732312.1| 14-3-3epsilon, isoform C [Drosophila melanogaster] gi|195497576|ref|XP_002096159.1| GE25525 [Drosophila yakuba] gi|23171618|gb|AAN13766.1| 14-3-3epsilon, isoform C [Drosophila melanogaster] gi|194182260|gb|EDW95871.1| GE25525 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|24647887|ref|NP_732310.1| 14-3-3epsilon, isoform B [Drosophila melanogaster] gi|23171616|gb|AAN13764.1| 14-3-3epsilon, isoform B [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|332374092|gb|AEE62187.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|288784881|gb|ADC53751.1| AT09839p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195450008|ref|XP_002072323.1| GK22388 [Drosophila willistoni] gi|194168408|gb|EDW83309.1| GK22388 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|24647889|ref|NP_732311.1| 14-3-3epsilon, isoform D [Drosophila melanogaster] gi|1814377|gb|AAC47519.1| 14-3-3 epsilon isoform [Drosophila melanogaster] gi|1814382|gb|AAC47520.1| 14-3-3 epsilon isoform [Drosophila melanogaster] gi|23171617|gb|AAN13765.1| 14-3-3epsilon, isoform D [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|359843276|gb|AEV89773.1| 14-3-3 protein epsilon [Schistocerca gregaria] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 108 | ||||||
| FB|FBgn0020238 | 262 | 14-3-3epsilon "14-3-3epsilon" | 0.370 | 0.152 | 0.85 | 6.2e-14 | |
| POMBASE|SPAC17A2.13c | 270 | rad25 "14-3-3 protein Rad25" [ | 0.407 | 0.162 | 0.695 | 5.8e-12 | |
| ZFIN|ZDB-GENE-050306-44 | 255 | ywhae2 "tyrosine 3-monooxygena | 0.370 | 0.156 | 0.775 | 1.2e-11 | |
| ZFIN|ZDB-GENE-030131-779 | 255 | ywhae1 "tyrosine 3-monooxygena | 0.370 | 0.156 | 0.75 | 3.7e-11 | |
| UNIPROTKB|F1P2P9 | 234 | YWHAE "14-3-3 protein epsilon" | 0.370 | 0.170 | 0.775 | 5.8e-11 | |
| UNIPROTKB|I3LLI8 | 232 | I3LLI8 "Uncharacterized protei | 0.370 | 0.172 | 0.775 | 5.8e-11 | |
| UNIPROTKB|F1NGW3 | 255 | YWHAE "14-3-3 protein epsilon" | 0.370 | 0.156 | 0.775 | 8.3e-11 | |
| UNIPROTKB|Q5ZMT0 | 255 | YWHAE "14-3-3 protein epsilon" | 0.370 | 0.156 | 0.775 | 8.3e-11 | |
| UNIPROTKB|P62261 | 255 | YWHAE "14-3-3 protein epsilon" | 0.370 | 0.156 | 0.775 | 8.3e-11 | |
| UNIPROTKB|P62258 | 255 | YWHAE "14-3-3 protein epsilon" | 0.370 | 0.156 | 0.775 | 8.3e-11 |
| FB|FBgn0020238 14-3-3epsilon "14-3-3epsilon" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 180 (68.4 bits), Expect = 6.2e-14, P = 6.2e-14
Identities = 34/40 (85%), Positives = 37/40 (92%)
Query: 63 RERVEKELKDICSDILNVLSKHLIPCALTGESKVFYYKMK 102
R +VEKEL+DICSDILNVL KHLIPCA +GESKVFYYKMK
Sbjct: 86 RGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMK 125
|
|
| POMBASE|SPAC17A2.13c rad25 "14-3-3 protein Rad25" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050306-44 ywhae2 "tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-779 ywhae1 "tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P2P9 YWHAE "14-3-3 protein epsilon" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LLI8 I3LLI8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NGW3 YWHAE "14-3-3 protein epsilon" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZMT0 YWHAE "14-3-3 protein epsilon" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P62261 YWHAE "14-3-3 protein epsilon" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P62258 YWHAE "14-3-3 protein epsilon" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 108 | |||
| cd10020 | 230 | cd10020, 14-3-3_epsilon, 14-3-3 epsilon, an isofor | 3e-18 | |
| pfam00244 | 236 | pfam00244, 14-3-3, 14-3-3 protein | 8e-16 | |
| cd11309 | 231 | cd11309, 14-3-3_fungi, Fungal 14-3-3 protein domai | 1e-15 | |
| COG5040 | 268 | COG5040, BMH1, 14-3-3 family protein [Signal trans | 7e-15 | |
| cd08774 | 225 | cd08774, 14-3-3, 14-3-3 domain | 2e-14 | |
| cd11310 | 230 | cd11310, 14-3-3_1, 14-3-3 protein domain | 6e-13 | |
| smart00101 | 244 | smart00101, 14_3_3, 14-3-3 homologues | 2e-12 | |
| cd10026 | 237 | cd10026, 14-3-3_plant, Plant 14-3-3 protein domain | 5e-12 | |
| cd10022 | 229 | cd10022, 14-3-3_beta_zeta, 14-3-3 beta and zeta is | 7e-12 | |
| cd10023 | 234 | cd10023, 14-3-3_theta, 14-3-3 theta/tau (theta in | 3e-10 | |
| cd10019 | 242 | cd10019, 14-3-3_sigma, 14-3-3 sigma, an isoform of | 6e-08 | |
| cd10024 | 246 | cd10024, 14-3-3_gamma, 14-3-3 gamma, an isoform of | 2e-06 | |
| cd10025 | 239 | cd10025, 14-3-3_eta, 14-3-3 eta, an isoform of 14- | 4e-06 |
| >gnl|CDD|206757 cd10020, 14-3-3_epsilon, 14-3-3 epsilon, an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
Score = 75.9 bits (186), Expect = 3e-18
Identities = 32/40 (80%), Positives = 37/40 (92%)
Query: 63 RERVEKELKDICSDILNVLSKHLIPCALTGESKVFYYKMK 102
R++VEKELKDIC+DIL+VL KHLIP A +GESKVFYYKMK
Sbjct: 83 RQQVEKELKDICNDILDVLDKHLIPAANSGESKVFYYKMK 122
|
14-3-3 protein epsilon isoform (isoform (also known as tyrosine 3-monooxygenase/ tryptophan 5-monooxygenase activation protein, epsilon polypeptide) is encoded by the YWHAE gene in humans and is involved in cancer cell survival and growth. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. Overexpression of 14-3-3 epsilon in primary hepatocellular carcinoma (HCC) tissues predicts a high risk of extrahepatic metastasis and worse survival, and is a potential therapeutic target. It has also been implicated in the pathogenesis of small cell lung cancer. 14-3-3 epsilon overexpression protects colorectal cancer and endothelial cells from oxidative stress-induced apoptosis, while its suppression by non-steroidal anti-inflammatory drugs induces cancer and endothelial cell death. Cellular levels of 14-3-3 epsilon could possibly serve as an important regulator of cell survival in response to oxidative stress and other death signals. 14-3-3 domains are an essential part of 14-3-3 proteins, a ubiquitous class of regulatory, phosphoserine/threonine-binding proteins found in all eukaryotic cells, including yeast, protozoa and mammalian cells. Length = 230 |
| >gnl|CDD|215815 pfam00244, 14-3-3, 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206763 cd11309, 14-3-3_fungi, Fungal 14-3-3 protein domain | Back alignment and domain information |
|---|
| >gnl|CDD|227373 COG5040, BMH1, 14-3-3 family protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|206755 cd08774, 14-3-3, 14-3-3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|206764 cd11310, 14-3-3_1, 14-3-3 protein domain | Back alignment and domain information |
|---|
| >gnl|CDD|128412 smart00101, 14_3_3, 14-3-3 homologues | Back alignment and domain information |
|---|
| >gnl|CDD|206762 cd10026, 14-3-3_plant, Plant 14-3-3 protein domain | Back alignment and domain information |
|---|
| >gnl|CDD|206758 cd10022, 14-3-3_beta_zeta, 14-3-3 beta and zeta isoforms of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206759 cd10023, 14-3-3_theta, 14-3-3 theta/tau (theta in mice, tau in human), an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206756 cd10019, 14-3-3_sigma, 14-3-3 sigma, an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206760 cd10024, 14-3-3_gamma, 14-3-3 gamma, an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206761 cd10025, 14-3-3_eta, 14-3-3 eta, an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 108 | |||
| COG5040 | 268 | BMH1 14-3-3 family protein [Signal transduction me | 99.86 | |
| smart00101 | 244 | 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat | 99.81 | |
| PF00244 | 236 | 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 | 99.74 | |
| COG5040 | 268 | BMH1 14-3-3 family protein [Signal transduction me | 99.72 | |
| KOG0841|consensus | 247 | 99.68 | ||
| smart00101 | 244 | 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat | 99.68 | |
| PF00244 | 236 | 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 | 99.57 | |
| KOG0841|consensus | 247 | 99.42 |
| >COG5040 BMH1 14-3-3 family protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=99.86 E-value=3.4e-22 Score=150.71 Aligned_cols=88 Identities=33% Similarity=0.514 Sum_probs=77.2
Q ss_pred CC-chhhHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHhcccccc---------hhhhHHHHHHH-----HHHHHHHHHHH
Q psy11576 13 TG-NHMVTLLHYYEENIMLQVEKELKDICSDILNVLSKHLIPCA---------LTGALLKRERV-----EKELKDICSDI 77 (108)
Q Consensus 13 ~~-~~~~~~~~~y~~~~~~kie~EL~~~C~~vL~lid~~Lip~~---------~Km~~dY~rki-----e~El~~ic~e~ 77 (108)
+| ..++.+|++||+ +||.||..||+|||++++++|+|.+ .||+|||+|.. +++..+.++.+
T Consensus 74 k~~~~qv~lI~eyrk----kiE~EL~~icddiL~vl~~hlipaa~~~EskvFyyKMKGDYyRYlAEf~~G~~~~e~a~~s 149 (268)
T COG5040 74 KGNTHQVELIKEYRK----KIETELTKICDDILSVLEKHLIPAATTGESKVFYYKMKGDYYRYLAEFSVGEAREEAADSS 149 (268)
T ss_pred CCChhHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHhcccccccccceEEEEeecchHHHHHHHhccchHhHHHHHhH
Confidence 44 468899999999 9999999999999999999999986 89999999943 56666666554
Q ss_pred H------------HhhhhCcCCCCCccchhhhHhhhccc
Q psy11576 78 L------------NVLSKHLIPCALTGESKVFYYKMKDG 104 (108)
Q Consensus 78 l------------~Lid~~lI~~~~~ln~sVFYykmkgD 104 (108)
+ +|+++|||++|+++|+|||||+|.+|
T Consensus 150 lE~YK~AseiA~teLpPT~PirLGLALNfSVFyYEIlns 188 (268)
T COG5040 150 LEAYKAASEIATTELPPTHPIRLGLALNFSVFYYEILNS 188 (268)
T ss_pred HHHHHHHHHHhhccCCCCCchhhhheecceeeeeecccC
Confidence 4 49999999999999999999999886
|
|
| >smart00101 14_3_3 14-3-3 homologues | Back alignment and domain information |
|---|
| >PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] | Back alignment and domain information |
|---|
| >COG5040 BMH1 14-3-3 family protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0841|consensus | Back alignment and domain information |
|---|
| >smart00101 14_3_3 14-3-3 homologues | Back alignment and domain information |
|---|
| >PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] | Back alignment and domain information |
|---|
| >KOG0841|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 108 | ||||
| 3ubw_A | 261 | Complex Of 14-3-3 Isoform Epsilon, A Mlf1 Phosphope | 1e-11 | ||
| 2br9_A | 234 | 14-3-3 Protein Epsilon (Human) Complexed To Peptide | 3e-11 | ||
| 3ual_A | 232 | Crystal Structure Of 14-3-3 Epsilon With Mlf1 Pepti | 3e-11 | ||
| 2npm_A | 260 | Crystal Structure Of Cryptosporidium Parvum 14-3-3 | 5e-10 | ||
| 2bq0_A | 245 | 14-3-3 Protein Beta (Human) Length = 245 | 3e-09 | ||
| 2c1j_A | 258 | Molecular Basis For The Recognition Of Phosphorylat | 3e-09 | ||
| 4fj3_A | 235 | 14-3-3 Isoform Zeta In Complex With A Diphoyphoryla | 3e-09 | ||
| 2o02_A | 230 | Phosphorylation Independent Interactions Between 14 | 3e-09 | ||
| 2v7d_A | 247 | 14-3-3 Protein Zeta In Complex With Thr758 Phosphor | 3e-09 | ||
| 1a38_A | 245 | 14-3-3 Protein Zeta Bound To R18 Peptide Length = 2 | 3e-09 | ||
| 3rdh_A | 248 | X-Ray Induced Covalent Inhibition Of 14-3-3 Length | 3e-09 | ||
| 4dnk_A | 247 | Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYP | 2e-08 | ||
| 4dx0_A | 243 | Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY A | 3e-08 | ||
| 4gnt_A | 245 | Complex Of Chrebp And 14-3-3beta Length = 245 | 4e-08 | ||
| 2btp_A | 256 | 14-3-3 Protein Theta (Human) Complexed To Peptide L | 6e-07 | ||
| 1o9c_A | 260 | Structural View Of A Fungal Toxin Acting On A 14-3- | 1e-06 | ||
| 2o98_A | 242 | Structure Of The 14-3-3 H+-Atpase Plant Complex Len | 1e-06 | ||
| 3m50_A | 240 | Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY E | 1e-06 | ||
| 3axy_C | 240 | Structure Of Florigen Activation Complex Consisting | 2e-06 | ||
| 3lw1_A | 253 | Binary Complex Of 14-3-3 Sigma And P53 Pt387-Peptid | 9e-06 | ||
| 3p1p_A | 236 | Crystal Structure Of Human 14-3-3 Sigma C38nN166H I | 9e-06 | ||
| 3iqj_A | 236 | Crystal Structure Of Human 14-3-3 Sigma In Complex | 9e-06 | ||
| 3p1r_A | 236 | Crystal Structure Of Human 14-3-3 Sigma C38vN166H I | 9e-06 | ||
| 3o8i_A | 239 | Structure Of 14-3-3 Isoform Sigma In Complex With A | 9e-06 | ||
| 3smo_A | 235 | Crystal Structure Of Human 14-3-3 Sigma C38vN166H I | 9e-06 | ||
| 3p1n_A | 235 | Crystal Structure Of Human 14-3-3 Sigma In Complex | 9e-06 | ||
| 4hqw_A | 236 | Molecular Tweezers Modulate 14-3-3 Protein-protein | 1e-05 | ||
| 4dat_A | 234 | Structure Of 14-3-3 Sigma In Complex With Padi6 14- | 1e-05 | ||
| 3t0l_A | 235 | Small-Molecule Inhibitors Of 14-3-3 Protein-Protein | 1e-05 | ||
| 1ywt_A | 248 | Crystal Structure Of The Human Sigma Isoform Of 14- | 1e-05 | ||
| 2b05_A | 246 | Crystal Structure Of 14-3-3 Gamma In Complex With A | 2e-05 | ||
| 3uzd_A | 248 | Crystal Structure Of 14-3-3 Gamma Length = 248 | 2e-05 | ||
| 3u9x_A | 235 | Covalent Attachment Of Pyridoxal-Phosphate Derivati | 4e-05 | ||
| 2c63_A | 247 | 14-3-3 Protein Eta (Human) Complexed To Peptide Len | 5e-05 | ||
| 4e2e_A | 248 | Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYP | 1e-04 |
| >pdb|3UBW|A Chain A, Complex Of 14-3-3 Isoform Epsilon, A Mlf1 Phosphopeptide And A Small Fragment Hit From A Fbdd Screen Length = 261 | Back alignment and structure |
|
| >pdb|2BR9|A Chain A, 14-3-3 Protein Epsilon (Human) Complexed To Peptide Length = 234 | Back alignment and structure |
| >pdb|3UAL|A Chain A, Crystal Structure Of 14-3-3 Epsilon With Mlf1 Peptide Length = 232 | Back alignment and structure |
| >pdb|2NPM|A Chain A, Crystal Structure Of Cryptosporidium Parvum 14-3-3 Protein In Complex With Peptide Length = 260 | Back alignment and structure |
| >pdb|2BQ0|A Chain A, 14-3-3 Protein Beta (Human) Length = 245 | Back alignment and structure |
| >pdb|2C1J|A Chain A, Molecular Basis For The Recognition Of Phosphorylated And Phosphoacetylated Histone H3 By 14-3-3 Length = 258 | Back alignment and structure |
| >pdb|4FJ3|A Chain A, 14-3-3 Isoform Zeta In Complex With A Diphoyphorylated C-Raf Peptide Length = 235 | Back alignment and structure |
| >pdb|2O02|A Chain A, Phosphorylation Independent Interactions Between 14-3-3 And Exoenzyme S: From Structure To Pathogenesis Length = 230 | Back alignment and structure |
| >pdb|2V7D|A Chain A, 14-3-3 Protein Zeta In Complex With Thr758 Phosphorylated Integrin Beta2 Peptide Length = 247 | Back alignment and structure |
| >pdb|1A38|A Chain A, 14-3-3 Protein Zeta Bound To R18 Peptide Length = 245 | Back alignment and structure |
| >pdb|3RDH|A Chain A, X-Ray Induced Covalent Inhibition Of 14-3-3 Length = 248 | Back alignment and structure |
| >pdb|4DNK|A Chain A, Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYPTOPHAN 5- Monooxygenase Activation Protein, Beta Polypeptide (Ywhab) From Homo Sapiens At 2.20 A Resolution. Length = 247 | Back alignment and structure |
| >pdb|4DX0|A Chain A, Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY A PYRAZOLE Derivative Length = 243 | Back alignment and structure |
| >pdb|4GNT|A Chain A, Complex Of Chrebp And 14-3-3beta Length = 245 | Back alignment and structure |
| >pdb|2BTP|A Chain A, 14-3-3 Protein Theta (Human) Complexed To Peptide Length = 256 | Back alignment and structure |
| >pdb|1O9C|A Chain A, Structural View Of A Fungal Toxin Acting On A 14-3-3 Regulatory Complex Length = 260 | Back alignment and structure |
| >pdb|2O98|A Chain A, Structure Of The 14-3-3 H+-Atpase Plant Complex Length = 242 | Back alignment and structure |
| >pdb|3M50|A Chain A, Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY EPIBESTAT Length = 240 | Back alignment and structure |
| >pdb|3AXY|C Chain C, Structure Of Florigen Activation Complex Consisting Of Rice Florigen Hd3a, 14-3-3 Protein Gf14 And Rice Fd Homolog Osfd1 Length = 240 | Back alignment and structure |
| >pdb|3LW1|A Chain A, Binary Complex Of 14-3-3 Sigma And P53 Pt387-Peptide Length = 253 | Back alignment and structure |
| >pdb|3P1P|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38nN166H IN COMPLEX WITH Task-3 Peptide Length = 236 | Back alignment and structure |
| >pdb|3IQJ|A Chain A, Crystal Structure Of Human 14-3-3 Sigma In Complex With Raf1 Peptide (10mer) Length = 236 | Back alignment and structure |
| >pdb|3P1R|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38vN166H IN COMPLEX WITH Task-3 Peptide Length = 236 | Back alignment and structure |
| >pdb|3O8I|A Chain A, Structure Of 14-3-3 Isoform Sigma In Complex With A C-Raf1 Peptide And A Stabilizing Small Molecule Fragment Length = 239 | Back alignment and structure |
| >pdb|3SMO|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38vN166H IN COMPLEX WITH Task-3 Peptide And Stabilizer Fusicoccin J Aglycone Length = 235 | Back alignment and structure |
| >pdb|3P1N|A Chain A, Crystal Structure Of Human 14-3-3 Sigma In Complex With Task-3 Peptide Length = 235 | Back alignment and structure |
| >pdb|4HQW|A Chain A, Molecular Tweezers Modulate 14-3-3 Protein-protein Interactions Length = 236 | Back alignment and structure |
| >pdb|4DAT|A Chain A, Structure Of 14-3-3 Sigma In Complex With Padi6 14-3-3 Binding Motif Ii Length = 234 | Back alignment and structure |
| >pdb|3T0L|A Chain A, Small-Molecule Inhibitors Of 14-3-3 Protein-Protein Interactions From Virtual Screening Length = 235 | Back alignment and structure |
| >pdb|1YWT|A Chain A, Crystal Structure Of The Human Sigma Isoform Of 14-3-3 In Complex With A Mode-1 Phosphopeptide Length = 248 | Back alignment and structure |
| >pdb|2B05|A Chain A, Crystal Structure Of 14-3-3 Gamma In Complex With A Phosphoserine Peptide Length = 246 | Back alignment and structure |
| >pdb|3UZD|A Chain A, Crystal Structure Of 14-3-3 Gamma Length = 248 | Back alignment and structure |
| >pdb|3U9X|A Chain A, Covalent Attachment Of Pyridoxal-Phosphate Derivatives To 14-3-3 Proteins Length = 235 | Back alignment and structure |
| >pdb|2C63|A Chain A, 14-3-3 Protein Eta (Human) Complexed To Peptide Length = 247 | Back alignment and structure |
| >pdb|4E2E|A Chain A, Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYPTOPHAN 5- Monooxygenase Activation Protein, Gamma Polypeptide (Ywhag) From Homo Sapiens At 2.25 A Resolution Length = 248 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 108 | |||
| 2o8p_A | 227 | 14-3-3 domain containing protein; signaling protei | 2e-11 | |
| 2npm_A | 260 | 14-3-3 domain containing protein; cell regulator p | 6e-09 | |
| 3iqu_A | 236 | 14-3-3 protein sigma; signal transuction, nucleus, | 1e-08 | |
| 2br9_A | 234 | 14-3-3E, 14-3-3 protein epsilon; cell regulator pr | 4e-08 | |
| 3ubw_A | 261 | 14-3-3E, 14-3-3 protein epsilon; adapter protein, | 5e-08 | |
| 1o9d_A | 260 | 14-3-3-like protein C; protein-binding, fusicoccin | 9e-08 | |
| 3uzd_A | 248 | 14-3-3 protein gamma; structural genomics, SGC, st | 4e-07 | |
| 3efz_A | 268 | 14-3-3 protein; 14-3-3, cell regulation, structura | 5e-07 |
| >2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Length = 227 | Back alignment and structure |
|---|
Score = 57.3 bits (138), Expect = 2e-11
Identities = 7/40 (17%), Positives = 16/40 (40%), Gaps = 3/40 (7%)
Query: 63 RERVEKELKDICSDILNVLSKHLIPCALTGESKVFYYKMK 102
+ K++K + + + + + SK F K+K
Sbjct: 90 VFSLRKDIKAFLQSFEDCVDRLVEK---SFFSKFFKLKVK 126
|
| >2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} Length = 260 | Back alignment and structure |
|---|
| >3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3p1s_A* 3p1r_A* 3p1q_A* 3p1p_A* 1ywt_A* 1yz5_A 2v7d_A* 2o02_A 1qja_A* 1a37_A 1a38_A 1a4o_A* 1ib1_A* ... Length = 236 | Back alignment and structure |
|---|
| >2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Length = 234 | Back alignment and structure |
|---|
| >3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Length = 261 | Back alignment and structure |
|---|
| >1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Length = 260 | Back alignment and structure |
|---|
| >3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Length = 248 | Back alignment and structure |
|---|
| >3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* Length = 268 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 108 | |||
| 3iqu_A | 236 | 14-3-3 protein sigma; signal transuction, nucleus, | 99.84 | |
| 3ubw_A | 261 | 14-3-3E, 14-3-3 protein epsilon; adapter protein, | 99.84 | |
| 3uzd_A | 248 | 14-3-3 protein gamma; structural genomics, SGC, st | 99.84 | |
| 3efz_A | 268 | 14-3-3 protein; 14-3-3, cell regulation, structura | 99.83 | |
| 2br9_A | 234 | 14-3-3E, 14-3-3 protein epsilon; cell regulator pr | 99.83 | |
| 1o9d_A | 260 | 14-3-3-like protein C; protein-binding, fusicoccin | 99.83 | |
| 2npm_A | 260 | 14-3-3 domain containing protein; cell regulator p | 99.82 | |
| 2o8p_A | 227 | 14-3-3 domain containing protein; signaling protei | 99.81 | |
| 3iqu_A | 236 | 14-3-3 protein sigma; signal transuction, nucleus, | 99.73 | |
| 3uzd_A | 248 | 14-3-3 protein gamma; structural genomics, SGC, st | 99.72 | |
| 3ubw_A | 261 | 14-3-3E, 14-3-3 protein epsilon; adapter protein, | 99.71 | |
| 2o8p_A | 227 | 14-3-3 domain containing protein; signaling protei | 99.7 | |
| 2br9_A | 234 | 14-3-3E, 14-3-3 protein epsilon; cell regulator pr | 99.69 | |
| 1o9d_A | 260 | 14-3-3-like protein C; protein-binding, fusicoccin | 99.69 | |
| 2npm_A | 260 | 14-3-3 domain containing protein; cell regulator p | 99.69 | |
| 3efz_A | 268 | 14-3-3 protein; 14-3-3, cell regulation, structura | 99.68 |
| >3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} SCOP: a.118.7.1 PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3t0l_A* 3t0m_A* 3u9x_A* 3ux0_A* 4dat_A* 4dau_A* 3p1s_A* 3p1r_A* 3smk_A* 3spr_A* 3p1q_A* 3p1p_A* 3sml_A* ... | Back alignment and structure |
|---|
Probab=99.84 E-value=4.7e-22 Score=151.15 Aligned_cols=86 Identities=24% Similarity=0.309 Sum_probs=74.3
Q ss_pred chhhHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHhcccccc---------hhhhHHHHHHH-----HHHHHHHHHHHH--
Q psy11576 15 NHMVTLLHYYEENIMLQVEKELKDICSDILNVLSKHLIPCA---------LTGALLKRERV-----EKELKDICSDIL-- 78 (108)
Q Consensus 15 ~~~~~~~~~y~~~~~~kie~EL~~~C~~vL~lid~~Lip~~---------~Km~~dY~rki-----e~El~~ic~e~l-- 78 (108)
+.+++++++||+ |||+||.++|++||++||++|+|+. .||+|||+|.+ +++..++++.+.
T Consensus 80 ~~~~~~i~~yr~----kie~EL~~iC~dil~lld~~Lip~a~~~eskVFY~KmKGDyyRYlAE~~~g~~r~~~~e~a~~a 155 (236)
T 3iqu_A 80 EEKGPEVREYRE----KVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSA 155 (236)
T ss_dssp CCCCSHHHHHHH----HHHHHHHHHHHHHHHHHHTTHHHHCCSHHHHHHHHHHHHHHHHHHHHHCCSTTHHHHHHHHHHH
T ss_pred HHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHhcCccCCchHHHHHHHHhhhhHHHHHHHhcCchHHHHHHHHHHHH
Confidence 467899999999 9999999999999999999999975 89999999955 344444444332
Q ss_pred ----------HhhhhCcCCCCCccchhhhHhhhccc
Q psy11576 79 ----------NVLSKHLIPCALTGESKVFYYKMKDG 104 (108)
Q Consensus 79 ----------~Lid~~lI~~~~~ln~sVFYykmkgD 104 (108)
+|.++|||++|+++|+|||||++.|+
T Consensus 156 Y~~A~~iA~~~L~pthPirLGLaLNfSVFyyEiln~ 191 (236)
T 3iqu_A 156 YQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANS 191 (236)
T ss_dssp HHHHHHHHHHHSCTTCHHHHHHHHHHHHHHHHTSSC
T ss_pred HHHHHHHHHhhCCCCCcHHHHHHHHHHHHHHHHcCC
Confidence 58899999999999999999999987
|
| >3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* | Back alignment and structure |
|---|
| >3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* | Back alignment and structure |
|---|
| >2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* | Back alignment and structure |
|---|
| >1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* | Back alignment and structure |
|---|
| >2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 | Back alignment and structure |
|---|
| >3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} SCOP: a.118.7.1 PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3t0l_A* 3t0m_A* 3u9x_A* 3ux0_A* 4dat_A* 4dau_A* 3p1s_A* 3p1r_A* 3smk_A* 3spr_A* 3p1q_A* 3p1p_A* 3sml_A* ... | Back alignment and structure |
|---|
| >3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* | Back alignment and structure |
|---|
| >3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 | Back alignment and structure |
|---|
| >2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* | Back alignment and structure |
|---|
| >1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* | Back alignment and structure |
|---|
| >2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 108 | ||||
| d3efza1 | 223 | a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cry | 1e-09 | |
| d3efza1 | 223 | a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cry | 5e-05 | |
| d1o9da_ | 236 | a.118.7.1 (A:) 14-3-3-like protein C {Common tobac | 1e-09 | |
| d1o9da_ | 236 | a.118.7.1 (A:) 14-3-3-like protein C {Common tobac | 0.002 | |
| d2o02a1 | 230 | a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) | 4e-09 | |
| d2o8pa1 | 220 | a.118.7.1 (A:8-227) 14-3-3 domain containing prote | 6e-08 |
| >d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} Length = 223 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: 14-3-3 protein family: 14-3-3 protein domain: 14-3-3 protein cgd1 2980 species: Cryptosporidium parvum [TaxId: 5807]
Score = 51.0 bits (122), Expect = 1e-09
Identities = 6/40 (15%), Positives = 19/40 (47%), Gaps = 1/40 (2%)
Query: 63 RERVEKELKDICSDILNVLSKHLIPCALTGESKVFYYKMK 102
+ E+ + D++ ++ +L+ + ++ F K+K
Sbjct: 65 KRDFEESILLESEDVIRIIDDNLLMYS-EEGARAFCIKLK 103
|
| >d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} Length = 223 | Back information, alignment and structure |
|---|
| >d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 236 | Back information, alignment and structure |
|---|
| >d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 236 | Back information, alignment and structure |
|---|
| >d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Length = 230 | Back information, alignment and structure |
|---|
| >d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Length = 220 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 108 | |||
| d3efza1 | 223 | 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [ | 99.8 | |
| d1o9da_ | 236 | 14-3-3-like protein C {Common tobacco (Nicotiana t | 99.79 | |
| d2o02a1 | 230 | zeta isoform {Cow (Bos taurus) [TaxId: 9913]} | 99.79 | |
| d2o8pa1 | 220 | 14-3-3 domain containing protein cgd7_2470 {Crypto | 99.71 | |
| d1o9da_ | 236 | 14-3-3-like protein C {Common tobacco (Nicotiana t | 99.63 | |
| d2o02a1 | 230 | zeta isoform {Cow (Bos taurus) [TaxId: 9913]} | 99.61 | |
| d3efza1 | 223 | 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [ | 99.61 | |
| d2o8pa1 | 220 | 14-3-3 domain containing protein cgd7_2470 {Crypto | 99.49 |
| >d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: 14-3-3 protein family: 14-3-3 protein domain: 14-3-3 protein cgd1 2980 species: Cryptosporidium parvum [TaxId: 5807]
Probab=99.80 E-value=1.8e-20 Score=139.64 Aligned_cols=87 Identities=8% Similarity=0.117 Sum_probs=74.1
Q ss_pred CchhhHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHhcccccc--------hhhhHHHHHHH-----HHHHHHHHHHHH--
Q psy11576 14 GNHMVTLLHYYEENIMLQVEKELKDICSDILNVLSKHLIPCA--------LTGALLKRERV-----EKELKDICSDIL-- 78 (108)
Q Consensus 14 ~~~~~~~~~~y~~~~~~kie~EL~~~C~~vL~lid~~Lip~~--------~Km~~dY~rki-----e~El~~ic~e~l-- 78 (108)
++..++.+++||+ +||+||..+|++|+++||++|+|.. .||+|||+|.+ ++|..++.+.+.
T Consensus 54 ~~~~~~~i~~yr~----kie~EL~~~C~dii~lid~~Lip~~~~eskvFY~KmKgDYyRYlaE~~~~~e~~~~~~~a~~a 129 (223)
T d3efza1 54 NNEFIQVIEDIKR----DFEESILLESEDVIRIIDDNLLMYSEEGARAFCIKLKGDLMRYKAEILKDEEKNQCIKQAVEF 129 (223)
T ss_dssp CHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHTGGGCCHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHH
T ss_pred cHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHhccCCCChHHHHHHHHHhchHHHHHHHHcCcHHHHHHHHHHHHH
Confidence 4468899999999 9999999999999999999999965 89999999955 455555543322
Q ss_pred ------------HhhhhCcCCCCCccchhhhHhhhccc
Q psy11576 79 ------------NVLSKHLIPCALTGESKVFYYKMKDG 104 (108)
Q Consensus 79 ------------~Lid~~lI~~~~~ln~sVFYykmkgD 104 (108)
++.++|||++|+++|++||||+++||
T Consensus 130 Y~~A~~~a~~~l~l~pt~PirLGLaLN~SVF~YEi~~~ 167 (223)
T d3efza1 130 YEDALQRERSFLEKYPSDPLYLATILNYTILKYDLLGN 167 (223)
T ss_dssp HHHHHHHHHHHCTTGGGCHHHHHHHHHHHHHHHTTTCC
T ss_pred HHHHHHHHHhhhccCccCHHHHHHHHHHHHHHHHHcCC
Confidence 35689999999999999999999987
|
| >d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|