Psyllid ID: psy11576


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MLHLVNVGIGDNTGNHMVTLLHYYEENIMLQVEKELKDICSDILNVLSKHLIPCALTGALLKRERVEKELKDICSDILNVLSKHLIPCALTGESKVFYYKMKDGLKKV
cccEEEcccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHcccccccc
ccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccHHHHHHHHHHHcccccc
MLHLVNvgigdntgNHMVTLLHYYEENIMLQVEKELKDICSDILNVLSKHLIPCALTGALLKRERVEKELKDICSDILNVLSKHlipcaltgeSKVFYYKMKDGLKKV
MLHLVNVgigdntgnHMVTLLHYYEENIMLQVEKELKDICSDILNVLSKHLIPCALTGALLKRERVEKELKDICSDILNVLSKHLipcaltgeskvfYYKMKDGLKKV
MLHLVNVGIGDNTGNHMVTLLHYYEENIMLQVEKELKDICSDILNVLSKHLIPCALTGALLKRERVEKELKDICSDILNVLSKHLIPCALTGESKVFYYKMKDGLKKV
**HLVNVGIGDNTGNHMVTLLHYYEENIMLQVEKELKDICSDILNVLSKHLIPCALTGALLKRERVEKELKDICSDILNVLSKHLIPCALTGESKVFYYKM*******
**HLVNVGIGDNTGNHMVTLLHYYEENIMLQVEKELKDICSDILNVLSKHLIPCALTGALLKRERVEKELKDICSDILNVLSKHLIPCALTGESKVFYYKMKDGLKKV
MLHLVNVGIGDNTGNHMVTLLHYYEENIMLQVEKELKDICSDILNVLSKHLIPCALTGALLKRERVEKELKDICSDILNVLSKHLIPCALTGESKVFYYKMKDGLKKV
MLHLVNVGIGDNTGNHMVTLLHYYEENIMLQVEKELKDICSDILNVLSKHLIPCALTGALLKRERVEKELKDICSDILNVLSKHLIPCALTGESKVFYYKMKDGL***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLHLVNVGIGDNTGNHMVTLLHYYEENIMLQVEKELKDICSDILNVLSKHLIPCALTGALLKRERVEKELKDICSDILNVLSKHLIPCALTGESKVFYYKMKDGLKKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query108 2.2.26 [Sep-21-2011]
P92177 262 14-3-3 protein epsilon OS yes N/A 0.370 0.152 0.85 4e-14
P42657 270 DNA damage checkpoint pro yes N/A 0.416 0.166 0.680 2e-11
P62262 255 14-3-3 protein epsilon OS N/A N/A 0.370 0.156 0.775 4e-10
P62260 255 14-3-3 protein epsilon OS yes N/A 0.370 0.156 0.775 4e-10
P62259 255 14-3-3 protein epsilon OS yes N/A 0.370 0.156 0.775 4e-10
P62258 255 14-3-3 protein epsilon OS yes N/A 0.370 0.156 0.775 4e-10
Q5ZMT0 255 14-3-3 protein epsilon OS yes N/A 0.370 0.156 0.775 4e-10
P62261 255 14-3-3 protein epsilon OS yes N/A 0.370 0.156 0.775 4e-10
P93212 252 14-3-3 protein 7 OS=Solan N/A N/A 0.370 0.158 0.675 4e-10
P42656 270 DNA damage checkpoint pro no N/A 0.370 0.148 0.675 7e-10
>sp|P92177|1433E_DROME 14-3-3 protein epsilon OS=Drosophila melanogaster GN=14-3-3epsilon PE=1 SV=2 Back     alignment and function desciption
 Score = 76.6 bits (187), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 37/40 (92%)

Query: 63  RERVEKELKDICSDILNVLSKHLIPCALTGESKVFYYKMK 102
           R +VEKEL+DICSDILNVL KHLIPCA +GESKVFYYKMK
Sbjct: 86  RGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMK 125




Positively regulates Ras-mediated pathways. Acts downstream or parallel to Raf, but upstream of nuclear factors in Ras signaling. Three mutants have been isolated, that suppress the rough eye phenotype caused by mutated Ras1 (sev-Ras1 v12). Inhibits yki activity by restricting its nuclear localization.
Drosophila melanogaster (taxid: 7227)
>sp|P42657|RAD25_SCHPO DNA damage checkpoint protein rad25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad25 PE=1 SV=1 Back     alignment and function description
>sp|P62262|1433E_SHEEP 14-3-3 protein epsilon OS=Ovis aries GN=YWHAE PE=1 SV=1 Back     alignment and function description
>sp|P62260|1433E_RAT 14-3-3 protein epsilon OS=Rattus norvegicus GN=Ywhae PE=1 SV=1 Back     alignment and function description
>sp|P62259|1433E_MOUSE 14-3-3 protein epsilon OS=Mus musculus GN=Ywhae PE=1 SV=1 Back     alignment and function description
>sp|P62258|1433E_HUMAN 14-3-3 protein epsilon OS=Homo sapiens GN=YWHAE PE=1 SV=1 Back     alignment and function description
>sp|Q5ZMT0|1433E_CHICK 14-3-3 protein epsilon OS=Gallus gallus GN=YWHAE PE=1 SV=1 Back     alignment and function description
>sp|P62261|1433E_BOVIN 14-3-3 protein epsilon OS=Bos taurus GN=YWHAE PE=2 SV=1 Back     alignment and function description
>sp|P93212|14337_SOLLC 14-3-3 protein 7 OS=Solanum lycopersicum GN=TFT7 PE=2 SV=2 Back     alignment and function description
>sp|P42656|RAD24_SCHPO DNA damage checkpoint protein rad24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad24 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query108
194764555 263 GF23073 [Drosophila ananassae] gi|190614 0.370 0.152 0.875 8e-13
312385948 211 hypothetical protein AND_00151 [Anophele 0.370 0.189 0.85 1e-12
195036824 260 GH18560 [Drosophila grimshawi] gi|195110 0.370 0.153 0.85 2e-12
24647891 256 14-3-3epsilon, isoform C [Drosophila mel 0.370 0.156 0.85 2e-12
24647887 261 14-3-3epsilon, isoform B [Drosophila mel 0.370 0.153 0.85 2e-12
332374092 258 unknown [Dendroctonus ponderosae] 0.370 0.155 0.85 2e-12
288784881 259 AT09839p [Drosophila melanogaster] 0.370 0.154 0.85 2e-12
195450008 260 GK22388 [Drosophila willistoni] gi|19416 0.370 0.153 0.85 2e-12
24647889 260 14-3-3epsilon, isoform D [Drosophila mel 0.370 0.153 0.85 2e-12
359843276 256 14-3-3 protein epsilon [Schistocerca gre 0.370 0.156 0.875 2e-12
>gi|194764555|ref|XP_001964394.1| GF23073 [Drosophila ananassae] gi|190614666|gb|EDV30190.1| GF23073 [Drosophila ananassae] Back     alignment and taxonomy information
 Score = 77.8 bits (190), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 35/40 (87%), Positives = 37/40 (92%)

Query: 63  RERVEKELKDICSDILNVLSKHLIPCALTGESKVFYYKMK 102
           R +VEKEL+DICSDILNVL KHLIPCA TGESKVFYYKMK
Sbjct: 86  RGQVEKELRDICSDILNVLEKHLIPCATTGESKVFYYKMK 125




Source: Drosophila ananassae

Species: Drosophila ananassae

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|312385948|gb|EFR30335.1| hypothetical protein AND_00151 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|195036824|ref|XP_001989868.1| GH18560 [Drosophila grimshawi] gi|195110585|ref|XP_001999860.1| GI24759 [Drosophila mojavensis] gi|195392509|ref|XP_002054900.1| GJ22546 [Drosophila virilis] gi|193894064|gb|EDV92930.1| GH18560 [Drosophila grimshawi] gi|193916454|gb|EDW15321.1| GI24759 [Drosophila mojavensis] gi|194152986|gb|EDW68420.1| GJ22546 [Drosophila virilis] Back     alignment and taxonomy information
>gi|24647891|ref|NP_732312.1| 14-3-3epsilon, isoform C [Drosophila melanogaster] gi|195497576|ref|XP_002096159.1| GE25525 [Drosophila yakuba] gi|23171618|gb|AAN13766.1| 14-3-3epsilon, isoform C [Drosophila melanogaster] gi|194182260|gb|EDW95871.1| GE25525 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|24647887|ref|NP_732310.1| 14-3-3epsilon, isoform B [Drosophila melanogaster] gi|23171616|gb|AAN13764.1| 14-3-3epsilon, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|332374092|gb|AEE62187.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|288784881|gb|ADC53751.1| AT09839p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195450008|ref|XP_002072323.1| GK22388 [Drosophila willistoni] gi|194168408|gb|EDW83309.1| GK22388 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|24647889|ref|NP_732311.1| 14-3-3epsilon, isoform D [Drosophila melanogaster] gi|1814377|gb|AAC47519.1| 14-3-3 epsilon isoform [Drosophila melanogaster] gi|1814382|gb|AAC47520.1| 14-3-3 epsilon isoform [Drosophila melanogaster] gi|23171617|gb|AAN13765.1| 14-3-3epsilon, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|359843276|gb|AEV89773.1| 14-3-3 protein epsilon [Schistocerca gregaria] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query108
FB|FBgn0020238 262 14-3-3epsilon "14-3-3epsilon" 0.370 0.152 0.85 6.2e-14
POMBASE|SPAC17A2.13c 270 rad25 "14-3-3 protein Rad25" [ 0.407 0.162 0.695 5.8e-12
ZFIN|ZDB-GENE-050306-44 255 ywhae2 "tyrosine 3-monooxygena 0.370 0.156 0.775 1.2e-11
ZFIN|ZDB-GENE-030131-779 255 ywhae1 "tyrosine 3-monooxygena 0.370 0.156 0.75 3.7e-11
UNIPROTKB|F1P2P9 234 YWHAE "14-3-3 protein epsilon" 0.370 0.170 0.775 5.8e-11
UNIPROTKB|I3LLI8 232 I3LLI8 "Uncharacterized protei 0.370 0.172 0.775 5.8e-11
UNIPROTKB|F1NGW3 255 YWHAE "14-3-3 protein epsilon" 0.370 0.156 0.775 8.3e-11
UNIPROTKB|Q5ZMT0 255 YWHAE "14-3-3 protein epsilon" 0.370 0.156 0.775 8.3e-11
UNIPROTKB|P62261 255 YWHAE "14-3-3 protein epsilon" 0.370 0.156 0.775 8.3e-11
UNIPROTKB|P62258 255 YWHAE "14-3-3 protein epsilon" 0.370 0.156 0.775 8.3e-11
FB|FBgn0020238 14-3-3epsilon "14-3-3epsilon" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 180 (68.4 bits), Expect = 6.2e-14, P = 6.2e-14
 Identities = 34/40 (85%), Positives = 37/40 (92%)

Query:    63 RERVEKELKDICSDILNVLSKHLIPCALTGESKVFYYKMK 102
             R +VEKEL+DICSDILNVL KHLIPCA +GESKVFYYKMK
Sbjct:    86 RGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMK 125


GO:0008426 "protein kinase C inhibitor activity" evidence=NAS
GO:0007265 "Ras protein signal transduction" evidence=NAS
GO:0000077 "DNA damage checkpoint" evidence=IMP;TAS
GO:0007444 "imaginal disc development" evidence=TAS
GO:0009314 "response to radiation" evidence=TAS
GO:0007093 "mitotic cell cycle checkpoint" evidence=TAS
GO:0005737 "cytoplasm" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0007088 "regulation of mitosis" evidence=IMP
GO:0005694 "chromosome" evidence=IDA
GO:0008103 "oocyte microtubule cytoskeleton polarization" evidence=IMP
GO:0045172 "germline ring canal" evidence=IDA
GO:0007294 "germarium-derived oocyte fate determination" evidence=IMP
GO:0046958 "nonassociative learning" evidence=NAS
GO:0019904 "protein domain specific binding" evidence=IEA
GO:0048190 "wing disc dorsal/ventral pattern formation" evidence=IGI
GO:0005515 "protein binding" evidence=IPI
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0009411 "response to UV" evidence=IMP
GO:0040008 "regulation of growth" evidence=IGI
GO:0045927 "positive regulation of growth" evidence=IMP
GO:0008340 "determination of adult lifespan" evidence=IMP
GO:0046982 "protein heterodimerization activity" evidence=IPI
GO:0007095 "mitotic G2 DNA damage checkpoint" evidence=IGI
GO:0007280 "pole cell migration" evidence=IMP
GO:0007411 "axon guidance" evidence=IMP
POMBASE|SPAC17A2.13c rad25 "14-3-3 protein Rad25" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050306-44 ywhae2 "tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-779 ywhae1 "tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1P2P9 YWHAE "14-3-3 protein epsilon" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LLI8 I3LLI8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGW3 YWHAE "14-3-3 protein epsilon" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMT0 YWHAE "14-3-3 protein epsilon" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P62261 YWHAE "14-3-3 protein epsilon" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P62258 YWHAE "14-3-3 protein epsilon" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P42657RAD25_SCHPONo assigned EC number0.68080.41660.1666yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
cd10020 230 cd10020, 14-3-3_epsilon, 14-3-3 epsilon, an isofor 3e-18
pfam00244 236 pfam00244, 14-3-3, 14-3-3 protein 8e-16
cd11309 231 cd11309, 14-3-3_fungi, Fungal 14-3-3 protein domai 1e-15
COG5040 268 COG5040, BMH1, 14-3-3 family protein [Signal trans 7e-15
cd08774225 cd08774, 14-3-3, 14-3-3 domain 2e-14
cd11310 230 cd11310, 14-3-3_1, 14-3-3 protein domain 6e-13
smart00101 244 smart00101, 14_3_3, 14-3-3 homologues 2e-12
cd10026 237 cd10026, 14-3-3_plant, Plant 14-3-3 protein domain 5e-12
cd10022 229 cd10022, 14-3-3_beta_zeta, 14-3-3 beta and zeta is 7e-12
cd10023 234 cd10023, 14-3-3_theta, 14-3-3 theta/tau (theta in 3e-10
cd10019 242 cd10019, 14-3-3_sigma, 14-3-3 sigma, an isoform of 6e-08
cd10024 246 cd10024, 14-3-3_gamma, 14-3-3 gamma, an isoform of 2e-06
cd10025 239 cd10025, 14-3-3_eta, 14-3-3 eta, an isoform of 14- 4e-06
>gnl|CDD|206757 cd10020, 14-3-3_epsilon, 14-3-3 epsilon, an isoform of 14-3-3 protein Back     alignment and domain information
 Score = 75.9 bits (186), Expect = 3e-18
 Identities = 32/40 (80%), Positives = 37/40 (92%)

Query: 63  RERVEKELKDICSDILNVLSKHLIPCALTGESKVFYYKMK 102
           R++VEKELKDIC+DIL+VL KHLIP A +GESKVFYYKMK
Sbjct: 83  RQQVEKELKDICNDILDVLDKHLIPAANSGESKVFYYKMK 122


14-3-3 protein epsilon isoform (isoform (also known as tyrosine 3-monooxygenase/ tryptophan 5-monooxygenase activation protein, epsilon polypeptide) is encoded by the YWHAE gene in humans and is involved in cancer cell survival and growth. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. Overexpression of 14-3-3 epsilon in primary hepatocellular carcinoma (HCC) tissues predicts a high risk of extrahepatic metastasis and worse survival, and is a potential therapeutic target. It has also been implicated in the pathogenesis of small cell lung cancer. 14-3-3 epsilon overexpression protects colorectal cancer and endothelial cells from oxidative stress-induced apoptosis, while its suppression by non-steroidal anti-inflammatory drugs induces cancer and endothelial cell death. Cellular levels of 14-3-3 epsilon could possibly serve as an important regulator of cell survival in response to oxidative stress and other death signals. 14-3-3 domains are an essential part of 14-3-3 proteins, a ubiquitous class of regulatory, phosphoserine/threonine-binding proteins found in all eukaryotic cells, including yeast, protozoa and mammalian cells. Length = 230

>gnl|CDD|215815 pfam00244, 14-3-3, 14-3-3 protein Back     alignment and domain information
>gnl|CDD|206763 cd11309, 14-3-3_fungi, Fungal 14-3-3 protein domain Back     alignment and domain information
>gnl|CDD|227373 COG5040, BMH1, 14-3-3 family protein [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|206755 cd08774, 14-3-3, 14-3-3 domain Back     alignment and domain information
>gnl|CDD|206764 cd11310, 14-3-3_1, 14-3-3 protein domain Back     alignment and domain information
>gnl|CDD|128412 smart00101, 14_3_3, 14-3-3 homologues Back     alignment and domain information
>gnl|CDD|206762 cd10026, 14-3-3_plant, Plant 14-3-3 protein domain Back     alignment and domain information
>gnl|CDD|206758 cd10022, 14-3-3_beta_zeta, 14-3-3 beta and zeta isoforms of 14-3-3 protein Back     alignment and domain information
>gnl|CDD|206759 cd10023, 14-3-3_theta, 14-3-3 theta/tau (theta in mice, tau in human), an isoform of 14-3-3 protein Back     alignment and domain information
>gnl|CDD|206756 cd10019, 14-3-3_sigma, 14-3-3 sigma, an isoform of 14-3-3 protein Back     alignment and domain information
>gnl|CDD|206760 cd10024, 14-3-3_gamma, 14-3-3 gamma, an isoform of 14-3-3 protein Back     alignment and domain information
>gnl|CDD|206761 cd10025, 14-3-3_eta, 14-3-3 eta, an isoform of 14-3-3 protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 108
COG5040268 BMH1 14-3-3 family protein [Signal transduction me 99.86
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 99.81
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 99.74
COG5040 268 BMH1 14-3-3 family protein [Signal transduction me 99.72
KOG0841|consensus247 99.68
smart00101 244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 99.68
PF00244 236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 99.57
KOG0841|consensus 247 99.42
>COG5040 BMH1 14-3-3 family protein [Signal transduction mechanisms] Back     alignment and domain information
Probab=99.86  E-value=3.4e-22  Score=150.71  Aligned_cols=88  Identities=33%  Similarity=0.514  Sum_probs=77.2

Q ss_pred             CC-chhhHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHhcccccc---------hhhhHHHHHHH-----HHHHHHHHHHH
Q psy11576         13 TG-NHMVTLLHYYEENIMLQVEKELKDICSDILNVLSKHLIPCA---------LTGALLKRERV-----EKELKDICSDI   77 (108)
Q Consensus        13 ~~-~~~~~~~~~y~~~~~~kie~EL~~~C~~vL~lid~~Lip~~---------~Km~~dY~rki-----e~El~~ic~e~   77 (108)
                      +| ..++.+|++||+    +||.||..||+|||++++++|+|.+         .||+|||+|..     +++..+.++.+
T Consensus        74 k~~~~qv~lI~eyrk----kiE~EL~~icddiL~vl~~hlipaa~~~EskvFyyKMKGDYyRYlAEf~~G~~~~e~a~~s  149 (268)
T COG5040          74 KGNTHQVELIKEYRK----KIETELTKICDDILSVLEKHLIPAATTGESKVFYYKMKGDYYRYLAEFSVGEAREEAADSS  149 (268)
T ss_pred             CCChhHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHhcccccccccceEEEEeecchHHHHHHHhccchHhHHHHHhH
Confidence            44 468899999999    9999999999999999999999986         89999999943     56666666554


Q ss_pred             H------------HhhhhCcCCCCCccchhhhHhhhccc
Q psy11576         78 L------------NVLSKHLIPCALTGESKVFYYKMKDG  104 (108)
Q Consensus        78 l------------~Lid~~lI~~~~~ln~sVFYykmkgD  104 (108)
                      +            +|+++|||++|+++|+|||||+|.+|
T Consensus       150 lE~YK~AseiA~teLpPT~PirLGLALNfSVFyYEIlns  188 (268)
T COG5040         150 LEAYKAASEIATTELPPTHPIRLGLALNFSVFYYEILNS  188 (268)
T ss_pred             HHHHHHHHHHhhccCCCCCchhhhheecceeeeeecccC
Confidence            4            49999999999999999999999886



>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>COG5040 BMH1 14-3-3 family protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0841|consensus Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>KOG0841|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
3ubw_A 261 Complex Of 14-3-3 Isoform Epsilon, A Mlf1 Phosphope 1e-11
2br9_A 234 14-3-3 Protein Epsilon (Human) Complexed To Peptide 3e-11
3ual_A 232 Crystal Structure Of 14-3-3 Epsilon With Mlf1 Pepti 3e-11
2npm_A 260 Crystal Structure Of Cryptosporidium Parvum 14-3-3 5e-10
2bq0_A 245 14-3-3 Protein Beta (Human) Length = 245 3e-09
2c1j_A 258 Molecular Basis For The Recognition Of Phosphorylat 3e-09
4fj3_A 235 14-3-3 Isoform Zeta In Complex With A Diphoyphoryla 3e-09
2o02_A 230 Phosphorylation Independent Interactions Between 14 3e-09
2v7d_A 247 14-3-3 Protein Zeta In Complex With Thr758 Phosphor 3e-09
1a38_A 245 14-3-3 Protein Zeta Bound To R18 Peptide Length = 2 3e-09
3rdh_A 248 X-Ray Induced Covalent Inhibition Of 14-3-3 Length 3e-09
4dnk_A 247 Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYP 2e-08
4dx0_A 243 Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY A 3e-08
4gnt_A 245 Complex Of Chrebp And 14-3-3beta Length = 245 4e-08
2btp_A 256 14-3-3 Protein Theta (Human) Complexed To Peptide L 6e-07
1o9c_A 260 Structural View Of A Fungal Toxin Acting On A 14-3- 1e-06
2o98_A 242 Structure Of The 14-3-3 H+-Atpase Plant Complex Len 1e-06
3m50_A 240 Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY E 1e-06
3axy_C 240 Structure Of Florigen Activation Complex Consisting 2e-06
3lw1_A 253 Binary Complex Of 14-3-3 Sigma And P53 Pt387-Peptid 9e-06
3p1p_A 236 Crystal Structure Of Human 14-3-3 Sigma C38nN166H I 9e-06
3iqj_A 236 Crystal Structure Of Human 14-3-3 Sigma In Complex 9e-06
3p1r_A 236 Crystal Structure Of Human 14-3-3 Sigma C38vN166H I 9e-06
3o8i_A 239 Structure Of 14-3-3 Isoform Sigma In Complex With A 9e-06
3smo_A 235 Crystal Structure Of Human 14-3-3 Sigma C38vN166H I 9e-06
3p1n_A 235 Crystal Structure Of Human 14-3-3 Sigma In Complex 9e-06
4hqw_A 236 Molecular Tweezers Modulate 14-3-3 Protein-protein 1e-05
4dat_A 234 Structure Of 14-3-3 Sigma In Complex With Padi6 14- 1e-05
3t0l_A 235 Small-Molecule Inhibitors Of 14-3-3 Protein-Protein 1e-05
1ywt_A 248 Crystal Structure Of The Human Sigma Isoform Of 14- 1e-05
2b05_A 246 Crystal Structure Of 14-3-3 Gamma In Complex With A 2e-05
3uzd_A 248 Crystal Structure Of 14-3-3 Gamma Length = 248 2e-05
3u9x_A 235 Covalent Attachment Of Pyridoxal-Phosphate Derivati 4e-05
2c63_A 247 14-3-3 Protein Eta (Human) Complexed To Peptide Len 5e-05
4e2e_A 248 Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYP 1e-04
>pdb|3UBW|A Chain A, Complex Of 14-3-3 Isoform Epsilon, A Mlf1 Phosphopeptide And A Small Fragment Hit From A Fbdd Screen Length = 261 Back     alignment and structure

Iteration: 1

Score = 64.3 bits (155), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 31/40 (77%), Positives = 33/40 (82%) Query: 63 RERVEKELKDICSDILNVLSKHLIPCALTGESKVFYYKMK 102 R+ VE ELK IC DIL+VL KHLIP A TGESKVFYYKMK Sbjct: 113 RQMVETELKLICXDILDVLDKHLIPAANTGESKVFYYKMK 152
>pdb|2BR9|A Chain A, 14-3-3 Protein Epsilon (Human) Complexed To Peptide Length = 234 Back     alignment and structure
>pdb|3UAL|A Chain A, Crystal Structure Of 14-3-3 Epsilon With Mlf1 Peptide Length = 232 Back     alignment and structure
>pdb|2NPM|A Chain A, Crystal Structure Of Cryptosporidium Parvum 14-3-3 Protein In Complex With Peptide Length = 260 Back     alignment and structure
>pdb|2BQ0|A Chain A, 14-3-3 Protein Beta (Human) Length = 245 Back     alignment and structure
>pdb|2C1J|A Chain A, Molecular Basis For The Recognition Of Phosphorylated And Phosphoacetylated Histone H3 By 14-3-3 Length = 258 Back     alignment and structure
>pdb|4FJ3|A Chain A, 14-3-3 Isoform Zeta In Complex With A Diphoyphorylated C-Raf Peptide Length = 235 Back     alignment and structure
>pdb|2O02|A Chain A, Phosphorylation Independent Interactions Between 14-3-3 And Exoenzyme S: From Structure To Pathogenesis Length = 230 Back     alignment and structure
>pdb|2V7D|A Chain A, 14-3-3 Protein Zeta In Complex With Thr758 Phosphorylated Integrin Beta2 Peptide Length = 247 Back     alignment and structure
>pdb|1A38|A Chain A, 14-3-3 Protein Zeta Bound To R18 Peptide Length = 245 Back     alignment and structure
>pdb|3RDH|A Chain A, X-Ray Induced Covalent Inhibition Of 14-3-3 Length = 248 Back     alignment and structure
>pdb|4DNK|A Chain A, Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYPTOPHAN 5- Monooxygenase Activation Protein, Beta Polypeptide (Ywhab) From Homo Sapiens At 2.20 A Resolution. Length = 247 Back     alignment and structure
>pdb|4DX0|A Chain A, Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY A PYRAZOLE Derivative Length = 243 Back     alignment and structure
>pdb|4GNT|A Chain A, Complex Of Chrebp And 14-3-3beta Length = 245 Back     alignment and structure
>pdb|2BTP|A Chain A, 14-3-3 Protein Theta (Human) Complexed To Peptide Length = 256 Back     alignment and structure
>pdb|1O9C|A Chain A, Structural View Of A Fungal Toxin Acting On A 14-3-3 Regulatory Complex Length = 260 Back     alignment and structure
>pdb|2O98|A Chain A, Structure Of The 14-3-3 H+-Atpase Plant Complex Length = 242 Back     alignment and structure
>pdb|3M50|A Chain A, Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY EPIBESTAT Length = 240 Back     alignment and structure
>pdb|3AXY|C Chain C, Structure Of Florigen Activation Complex Consisting Of Rice Florigen Hd3a, 14-3-3 Protein Gf14 And Rice Fd Homolog Osfd1 Length = 240 Back     alignment and structure
>pdb|3LW1|A Chain A, Binary Complex Of 14-3-3 Sigma And P53 Pt387-Peptide Length = 253 Back     alignment and structure
>pdb|3P1P|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38nN166H IN COMPLEX WITH Task-3 Peptide Length = 236 Back     alignment and structure
>pdb|3IQJ|A Chain A, Crystal Structure Of Human 14-3-3 Sigma In Complex With Raf1 Peptide (10mer) Length = 236 Back     alignment and structure
>pdb|3P1R|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38vN166H IN COMPLEX WITH Task-3 Peptide Length = 236 Back     alignment and structure
>pdb|3O8I|A Chain A, Structure Of 14-3-3 Isoform Sigma In Complex With A C-Raf1 Peptide And A Stabilizing Small Molecule Fragment Length = 239 Back     alignment and structure
>pdb|3SMO|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38vN166H IN COMPLEX WITH Task-3 Peptide And Stabilizer Fusicoccin J Aglycone Length = 235 Back     alignment and structure
>pdb|3P1N|A Chain A, Crystal Structure Of Human 14-3-3 Sigma In Complex With Task-3 Peptide Length = 235 Back     alignment and structure
>pdb|4HQW|A Chain A, Molecular Tweezers Modulate 14-3-3 Protein-protein Interactions Length = 236 Back     alignment and structure
>pdb|4DAT|A Chain A, Structure Of 14-3-3 Sigma In Complex With Padi6 14-3-3 Binding Motif Ii Length = 234 Back     alignment and structure
>pdb|3T0L|A Chain A, Small-Molecule Inhibitors Of 14-3-3 Protein-Protein Interactions From Virtual Screening Length = 235 Back     alignment and structure
>pdb|1YWT|A Chain A, Crystal Structure Of The Human Sigma Isoform Of 14-3-3 In Complex With A Mode-1 Phosphopeptide Length = 248 Back     alignment and structure
>pdb|2B05|A Chain A, Crystal Structure Of 14-3-3 Gamma In Complex With A Phosphoserine Peptide Length = 246 Back     alignment and structure
>pdb|3UZD|A Chain A, Crystal Structure Of 14-3-3 Gamma Length = 248 Back     alignment and structure
>pdb|3U9X|A Chain A, Covalent Attachment Of Pyridoxal-Phosphate Derivatives To 14-3-3 Proteins Length = 235 Back     alignment and structure
>pdb|2C63|A Chain A, 14-3-3 Protein Eta (Human) Complexed To Peptide Length = 247 Back     alignment and structure
>pdb|4E2E|A Chain A, Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYPTOPHAN 5- Monooxygenase Activation Protein, Gamma Polypeptide (Ywhag) From Homo Sapiens At 2.25 A Resolution Length = 248 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
2o8p_A227 14-3-3 domain containing protein; signaling protei 2e-11
2npm_A 260 14-3-3 domain containing protein; cell regulator p 6e-09
3iqu_A 236 14-3-3 protein sigma; signal transuction, nucleus, 1e-08
2br9_A 234 14-3-3E, 14-3-3 protein epsilon; cell regulator pr 4e-08
3ubw_A 261 14-3-3E, 14-3-3 protein epsilon; adapter protein, 5e-08
1o9d_A 260 14-3-3-like protein C; protein-binding, fusicoccin 9e-08
3uzd_A 248 14-3-3 protein gamma; structural genomics, SGC, st 4e-07
3efz_A 268 14-3-3 protein; 14-3-3, cell regulation, structura 5e-07
>2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Length = 227 Back     alignment and structure
 Score = 57.3 bits (138), Expect = 2e-11
 Identities = 7/40 (17%), Positives = 16/40 (40%), Gaps = 3/40 (7%)

Query: 63  RERVEKELKDICSDILNVLSKHLIPCALTGESKVFYYKMK 102
              + K++K       + + + +     +  SK F  K+K
Sbjct: 90  VFSLRKDIKAFLQSFEDCVDRLVEK---SFFSKFFKLKVK 126


>2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} Length = 260 Back     alignment and structure
>3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3p1s_A* 3p1r_A* 3p1q_A* 3p1p_A* 1ywt_A* 1yz5_A 2v7d_A* 2o02_A 1qja_A* 1a37_A 1a38_A 1a4o_A* 1ib1_A* ... Length = 236 Back     alignment and structure
>2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Length = 234 Back     alignment and structure
>3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Length = 261 Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Length = 260 Back     alignment and structure
>3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Length = 248 Back     alignment and structure
>3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* Length = 268 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query108
3iqu_A236 14-3-3 protein sigma; signal transuction, nucleus, 99.84
3ubw_A261 14-3-3E, 14-3-3 protein epsilon; adapter protein, 99.84
3uzd_A248 14-3-3 protein gamma; structural genomics, SGC, st 99.84
3efz_A268 14-3-3 protein; 14-3-3, cell regulation, structura 99.83
2br9_A234 14-3-3E, 14-3-3 protein epsilon; cell regulator pr 99.83
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 99.83
2npm_A260 14-3-3 domain containing protein; cell regulator p 99.82
2o8p_A227 14-3-3 domain containing protein; signaling protei 99.81
3iqu_A 236 14-3-3 protein sigma; signal transuction, nucleus, 99.73
3uzd_A 248 14-3-3 protein gamma; structural genomics, SGC, st 99.72
3ubw_A 261 14-3-3E, 14-3-3 protein epsilon; adapter protein, 99.71
2o8p_A227 14-3-3 domain containing protein; signaling protei 99.7
2br9_A 234 14-3-3E, 14-3-3 protein epsilon; cell regulator pr 99.69
1o9d_A 260 14-3-3-like protein C; protein-binding, fusicoccin 99.69
2npm_A 260 14-3-3 domain containing protein; cell regulator p 99.69
3efz_A 268 14-3-3 protein; 14-3-3, cell regulation, structura 99.68
>3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} SCOP: a.118.7.1 PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3t0l_A* 3t0m_A* 3u9x_A* 3ux0_A* 4dat_A* 4dau_A* 3p1s_A* 3p1r_A* 3smk_A* 3spr_A* 3p1q_A* 3p1p_A* 3sml_A* ... Back     alignment and structure
Probab=99.84  E-value=4.7e-22  Score=151.15  Aligned_cols=86  Identities=24%  Similarity=0.309  Sum_probs=74.3

Q ss_pred             chhhHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHhcccccc---------hhhhHHHHHHH-----HHHHHHHHHHHH--
Q psy11576         15 NHMVTLLHYYEENIMLQVEKELKDICSDILNVLSKHLIPCA---------LTGALLKRERV-----EKELKDICSDIL--   78 (108)
Q Consensus        15 ~~~~~~~~~y~~~~~~kie~EL~~~C~~vL~lid~~Lip~~---------~Km~~dY~rki-----e~El~~ic~e~l--   78 (108)
                      +.+++++++||+    |||+||.++|++||++||++|+|+.         .||+|||+|.+     +++..++++.+.  
T Consensus        80 ~~~~~~i~~yr~----kie~EL~~iC~dil~lld~~Lip~a~~~eskVFY~KmKGDyyRYlAE~~~g~~r~~~~e~a~~a  155 (236)
T 3iqu_A           80 EEKGPEVREYRE----KVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSA  155 (236)
T ss_dssp             CCCCSHHHHHHH----HHHHHHHHHHHHHHHHHHTTHHHHCCSHHHHHHHHHHHHHHHHHHHHHCCSTTHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHhcCccCCchHHHHHHHHhhhhHHHHHHHhcCchHHHHHHHHHHHH
Confidence            467899999999    9999999999999999999999975         89999999955     344444444332  


Q ss_pred             ----------HhhhhCcCCCCCccchhhhHhhhccc
Q psy11576         79 ----------NVLSKHLIPCALTGESKVFYYKMKDG  104 (108)
Q Consensus        79 ----------~Lid~~lI~~~~~ln~sVFYykmkgD  104 (108)
                                +|.++|||++|+++|+|||||++.|+
T Consensus       156 Y~~A~~iA~~~L~pthPirLGLaLNfSVFyyEiln~  191 (236)
T 3iqu_A          156 YQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANS  191 (236)
T ss_dssp             HHHHHHHHHHHSCTTCHHHHHHHHHHHHHHHHTSSC
T ss_pred             HHHHHHHHHhhCCCCCcHHHHHHHHHHHHHHHHcCC
Confidence                      58899999999999999999999987



>3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Back     alignment and structure
>3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Back     alignment and structure
>3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* Back     alignment and structure
>2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} Back     alignment and structure
>2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Back     alignment and structure
>3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} SCOP: a.118.7.1 PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3t0l_A* 3t0m_A* 3u9x_A* 3ux0_A* 4dat_A* 4dau_A* 3p1s_A* 3p1r_A* 3smk_A* 3spr_A* 3p1q_A* 3p1p_A* 3sml_A* ... Back     alignment and structure
>3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Back     alignment and structure
>3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Back     alignment and structure
>2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Back     alignment and structure
>2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} Back     alignment and structure
>3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 108
d3efza1 223 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cry 1e-09
d3efza1223 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cry 5e-05
d1o9da_ 236 a.118.7.1 (A:) 14-3-3-like protein C {Common tobac 1e-09
d1o9da_236 a.118.7.1 (A:) 14-3-3-like protein C {Common tobac 0.002
d2o02a1 230 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) 4e-09
d2o8pa1220 a.118.7.1 (A:8-227) 14-3-3 domain containing prote 6e-08
>d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} Length = 223 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: 14-3-3 protein
family: 14-3-3 protein
domain: 14-3-3 protein cgd1 2980
species: Cryptosporidium parvum [TaxId: 5807]
 Score = 51.0 bits (122), Expect = 1e-09
 Identities = 6/40 (15%), Positives = 19/40 (47%), Gaps = 1/40 (2%)

Query: 63  RERVEKELKDICSDILNVLSKHLIPCALTGESKVFYYKMK 102
           +   E+ +     D++ ++  +L+  +    ++ F  K+K
Sbjct: 65  KRDFEESILLESEDVIRIIDDNLLMYS-EEGARAFCIKLK 103


>d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} Length = 223 Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 236 Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 236 Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Length = 220 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query108
d3efza1223 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [ 99.8
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 99.79
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 99.79
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 99.71
d1o9da_ 236 14-3-3-like protein C {Common tobacco (Nicotiana t 99.63
d2o02a1 230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 99.61
d3efza1 223 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [ 99.61
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 99.49
>d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: 14-3-3 protein
family: 14-3-3 protein
domain: 14-3-3 protein cgd1 2980
species: Cryptosporidium parvum [TaxId: 5807]
Probab=99.80  E-value=1.8e-20  Score=139.64  Aligned_cols=87  Identities=8%  Similarity=0.117  Sum_probs=74.1

Q ss_pred             CchhhHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHhcccccc--------hhhhHHHHHHH-----HHHHHHHHHHHH--
Q psy11576         14 GNHMVTLLHYYEENIMLQVEKELKDICSDILNVLSKHLIPCA--------LTGALLKRERV-----EKELKDICSDIL--   78 (108)
Q Consensus        14 ~~~~~~~~~~y~~~~~~kie~EL~~~C~~vL~lid~~Lip~~--------~Km~~dY~rki-----e~El~~ic~e~l--   78 (108)
                      ++..++.+++||+    +||+||..+|++|+++||++|+|..        .||+|||+|.+     ++|..++.+.+.  
T Consensus        54 ~~~~~~~i~~yr~----kie~EL~~~C~dii~lid~~Lip~~~~eskvFY~KmKgDYyRYlaE~~~~~e~~~~~~~a~~a  129 (223)
T d3efza1          54 NNEFIQVIEDIKR----DFEESILLESEDVIRIIDDNLLMYSEEGARAFCIKLKGDLMRYKAEILKDEEKNQCIKQAVEF  129 (223)
T ss_dssp             CHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHTGGGCCHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHH
T ss_pred             cHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHhccCCCChHHHHHHHHHhchHHHHHHHHcCcHHHHHHHHHHHHH
Confidence            4468899999999    9999999999999999999999965        89999999955     455555543322  


Q ss_pred             ------------HhhhhCcCCCCCccchhhhHhhhccc
Q psy11576         79 ------------NVLSKHLIPCALTGESKVFYYKMKDG  104 (108)
Q Consensus        79 ------------~Lid~~lI~~~~~ln~sVFYykmkgD  104 (108)
                                  ++.++|||++|+++|++||||+++||
T Consensus       130 Y~~A~~~a~~~l~l~pt~PirLGLaLN~SVF~YEi~~~  167 (223)
T d3efza1         130 YEDALQRERSFLEKYPSDPLYLATILNYTILKYDLLGN  167 (223)
T ss_dssp             HHHHHHHHHHHCTTGGGCHHHHHHHHHHHHHHHTTTCC
T ss_pred             HHHHHHHHHhhhccCccCHHHHHHHHHHHHHHHHHcCC
Confidence                        35689999999999999999999987



>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure