Psyllid ID: psy11680

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MPKFYSIKLYCCITLWSFTFMVVLDSQYRPSNCPFMNTLMTRKYFLFSESTAADFQRKVDSACVFHNASSRFADGYRFGLGAEVGISTARIHARGPVGVEGLLTTKWVLNGDGHVASEFAEGGPCTFVHEHLPIN
cccEEEEEEEEEEEEEcccHHHHHHHHHcccccccccEEEccccccccHHHHHHHHHHHccEEEEEcccccccccccccccEEEEEccccccccccccccccEEEEEEEEcccEEEcEEcccccEEEEccccccc
cccEEEEEEEEEEEEEEEEEEEEcccEEEccccccccEEEEcHHccccHHHHHHHHHHccccEEEEcccHHHcccccccccccccEEcccccccEEcccHHHEEEEEEEEcccccEEcccccccEEEEEcccccc
MPKFYSIKLYCCITLWSFTFMVVLdsqyrpsncpfmntlmtrKYFLFSESTAADFqrkvdsacvfhnassrfadgyrfglgaevgistarihargpvgvegLLTTKWvlngdghvasefaeggpctfvhehlpin
MPKFYSIKLYCCITLWSFTFMVVLDSQYRPSNCPFMNTLMTRKYFLFSESTAADFQRKVDSACVFHNASSRFADGYRFGLGAEVGISTARIHARGPVGVEGLLTTKWVLNGDGHVASEFAEGGPCTFVHEHLPIN
MPKFYSIKLYCCITLWSFTFMVVLDSQYRPSNCPFMNTLMTRKYFLFSESTAADFQRKVDSACVFHNASSRFADGYRFGLGAEVGISTARIHARGPVGVEGLLTTKWVLNGDGHVASEFAEGGPCTFVHEHLPIN
***FYSIKLYCCITLWSFTFMVVLDSQYRPSNCPFMNTLMTRKYFLFSESTAADFQRKVDSACVFHNASSRFADGYRFGLGAEVGISTARIHARGPVGVEGLLTTKWVLNGDGHVASEFAEGGPCTFVHE*****
**KFYSIKLYCCITLWSFTFMVVLDSQYRPSNCPFMNTLMTRKYFLFSESTAADFQRKVDSACVFHNASSRFADGYRFGLGAEVGISTARIHARGPVGVEGLLTTKWVLNGDGHVASEFAEGGPCTFVHEHLP**
MPKFYSIKLYCCITLWSFTFMVVLDSQYRPSNCPFMNTLMTRKYFLFSESTAADFQRKVDSACVFHNASSRFADGYRFGLGAEVGISTARIHARGPVGVEGLLTTKWVLNGDGHVASEFAEGGPCTFVHEHLPIN
MPKFYSIKLYCCITLWSFTFMVVLDSQYRPSNCPFMNTLMTRKYFLFSESTAADFQRKVDSACVFHNASSRFADGYRFGLGAEVGISTARIHARGPVGVEGLLTTKWVLNGDGHVASEFAEGGPCTFVHEHL***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPKFYSIKLYCCITLWSFTFMVVLDSQYRPSNCPFMNTLMTRKYFLFSESTAADFQRKVDSACVFHNASSRFADGYRFGLGAEVGISTARIHARGPVGVEGLLTTKWVLNGDGHVASEFAEGGPCTFVHEHLPIN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query135 2.2.26 [Sep-21-2011]
Q5R4M8795 Delta-1-pyrroline-5-carbo yes N/A 0.644 0.109 0.701 6e-32
Q9Z110795 Delta-1-pyrroline-5-carbo yes N/A 0.644 0.109 0.689 1e-31
P54886795 Delta-1-pyrroline-5-carbo yes N/A 0.644 0.109 0.701 2e-30
P54889800 Probable delta-1-pyrrolin yes N/A 0.607 0.102 0.698 4e-30
P54888726 Delta-1-pyrroline-5-carbo yes N/A 0.570 0.106 0.65 1e-25
O04226716 Delta-1-pyrroline-5-carbo yes N/A 0.614 0.115 0.616 2e-25
P54887717 Delta-1-pyrroline-5-carbo no N/A 0.570 0.107 0.637 3e-25
Q3IP72438 Gamma-glutamyl phosphate yes N/A 0.622 0.191 0.595 1e-24
Q96480717 Delta-1-pyrroline-5-carbo N/A N/A 0.496 0.093 0.731 2e-24
O65361719 Delta-1-pyrroline-5-carbo N/A N/A 0.592 0.111 0.638 5e-24
>sp|Q5R4M8|P5CS_PONAB Delta-1-pyrroline-5-carboxylate synthase OS=Pongo abelii GN=ALDH18A1 PE=2 SV=1 Back     alignment and function desciption
 Score =  135 bits (341), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 74/87 (85%)

Query: 48  SESTAADFQRKVDSACVFHNASSRFADGYRFGLGAEVGISTARIHARGPVGVEGLLTTKW 107
           +E+TA  F + VDSACVF NAS+RF+DGYRFGLGAEVGIST+RIHARGPVG+EGLLTTKW
Sbjct: 703 NENTAEFFLQHVDSACVFWNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKW 762

Query: 108 VLNGDGHVASEFAEGGPCTFVHEHLPI 134
           +L G  HV S+F+E G   ++HE+LPI
Sbjct: 763 LLRGKDHVVSDFSEHGSLKYLHENLPI 789

Pongo abelii (taxid: 9601)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 4EC: 1
>sp|Q9Z110|P5CS_MOUSE Delta-1-pyrroline-5-carboxylate synthase OS=Mus musculus GN=Aldh18a1 PE=2 SV=2 Back     alignment and function description
>sp|P54886|P5CS_HUMAN Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens GN=ALDH18A1 PE=1 SV=2 Back     alignment and function description
>sp|P54889|ALH13_CAEEL Probable delta-1-pyrroline-5-carboxylate synthase OS=Caenorhabditis elegans GN=alh-13 PE=2 SV=1 Back     alignment and function description
>sp|P54888|P5CS2_ARATH Delta-1-pyrroline-5-carboxylate synthase B OS=Arabidopsis thaliana GN=P5CSB PE=2 SV=1 Back     alignment and function description
>sp|O04226|P5CS_ORYSJ Delta-1-pyrroline-5-carboxylate synthase OS=Oryza sativa subsp. japonica GN=P5CS PE=2 SV=2 Back     alignment and function description
>sp|P54887|P5CS1_ARATH Delta-1-pyrroline-5-carboxylate synthase A OS=Arabidopsis thaliana GN=P5CSA PE=1 SV=1 Back     alignment and function description
>sp|Q3IP72|PROA_NATPD Gamma-glutamyl phosphate reductase OS=Natronomonas pharaonis (strain DSM 2160 / ATCC 35678) GN=proA PE=3 SV=1 Back     alignment and function description
>sp|Q96480|P5CS_SOLLC Delta-1-pyrroline-5-carboxylate synthase OS=Solanum lycopersicum GN=PRO2 PE=2 SV=1 Back     alignment and function description
>sp|O65361|P5CS_MESCR Delta-1-pyrroline-5-carboxylate synthase OS=Mesembryanthemum crystallinum GN=P5CS PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
193657053 795 PREDICTED: delta-1-pyrroline-5-carboxyla 0.651 0.110 0.806 1e-37
270002534 798 hypothetical protein TcasGA2_TC004842 [T 0.629 0.106 0.823 9e-37
189234141 816 PREDICTED: similar to CG7470 CG7470-PA [ 0.629 0.104 0.823 1e-36
156538301 786 PREDICTED: delta-1-pyrroline-5-carboxyla 0.644 0.110 0.793 2e-36
239791794177 ACYPI000665 [Acyrthosiphon pisum] 0.622 0.474 0.845 2e-35
242010763 740 delta 1-pyrroline-5-carboxylate syntheta 0.651 0.118 0.772 1e-34
350413003 785 PREDICTED: delta-1-pyrroline-5-carboxyla 0.629 0.108 0.776 1e-34
350413000 775 PREDICTED: delta-1-pyrroline-5-carboxyla 0.629 0.109 0.776 1e-34
332029765 690 Delta-1-pyrroline-5-carboxylate syntheta 0.629 0.123 0.788 2e-34
340708704 785 PREDICTED: delta-1-pyrroline-5-carboxyla 0.651 0.112 0.75 2e-34
>gi|193657053|ref|XP_001947489.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 1 [Acyrthosiphon pisum] gi|328704972|ref|XP_003242657.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 2 [Acyrthosiphon pisum] gi|328704974|ref|XP_003242658.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 71/88 (80%), Positives = 78/88 (88%)

Query: 48  SESTAADFQRKVDSACVFHNASSRFADGYRFGLGAEVGISTARIHARGPVGVEGLLTTKW 107
           +   A  FQR VDSACVFHNASSRFADG+RFGLGAEVGISTARIHARGPVGVEGLLTTKW
Sbjct: 707 NSEAATKFQRDVDSACVFHNASSRFADGFRFGLGAEVGISTARIHARGPVGVEGLLTTKW 766

Query: 108 VLNGDGHVASEFAEGGPCTFVHEHLPIN 135
           +L GDGH A+EFAEGG  T+VHEHLP++
Sbjct: 767 ILKGDGHAAAEFAEGGGRTYVHEHLPVD 794

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270002534|gb|EEZ98981.1| hypothetical protein TcasGA2_TC004842 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189234141|ref|XP_970358.2| PREDICTED: similar to CG7470 CG7470-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|156538301|ref|XP_001603792.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|239791794|dbj|BAH72316.1| ACYPI000665 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242010763|ref|XP_002426128.1| delta 1-pyrroline-5-carboxylate synthetase, putative [Pediculus humanus corporis] gi|212510175|gb|EEB13390.1| delta 1-pyrroline-5-carboxylate synthetase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|350413003|ref|XP_003489845.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|350413000|ref|XP_003489844.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|332029765|gb|EGI69634.1| Delta-1-pyrroline-5-carboxylate synthetase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340708704|ref|XP_003392962.1| PREDICTED: delta-1-pyrroline-5-carboxylate synthase-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
ZFIN|ZDB-GENE-030131-5602784 aldh18a1 "aldehyde dehydrogena 0.644 0.110 0.724 1.2e-30
FB|FBgn0037146776 CG7470 [Drosophila melanogaste 0.651 0.113 0.727 2.4e-30
UNIPROTKB|F1SC47795 ALDH18A1 "Uncharacterized prot 0.644 0.109 0.689 2.2e-28
UNIPROTKB|Q2KJH7795 ALDH18A1 "Aldehyde dehydrogena 0.644 0.109 0.701 2.8e-28
UNIPROTKB|Q5R4M8795 ALDH18A1 "Delta-1-pyrroline-5- 0.644 0.109 0.701 2.8e-28
UNIPROTKB|E2R3N2747 ALDH18A1 "Uncharacterized prot 0.644 0.116 0.689 3.2e-28
UNIPROTKB|E2QYZ0795 ALDH18A1 "Uncharacterized prot 0.644 0.109 0.689 3.6e-28
UNIPROTKB|P54886795 ALDH18A1 "Delta-1-pyrroline-5- 0.637 0.108 0.709 3.6e-28
MGI|MGI:1888908795 Aldh18a1 "aldehyde dehydrogena 0.644 0.109 0.689 3.6e-28
RGD|1311431795 Aldh18a1 "aldehyde dehydrogena 0.644 0.109 0.689 4.7e-28
ZFIN|ZDB-GENE-030131-5602 aldh18a1 "aldehyde dehydrogenase 18 family, member A1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 347 (127.2 bits), Expect = 1.2e-30, P = 1.2e-30
 Identities = 63/87 (72%), Positives = 77/87 (88%)

Query:    48 SESTAADFQRKVDSACVFHNASSRFADGYRFGLGAEVGISTARIHARGPVGVEGLLTTKW 107
             +E+TA  F +++DSACVF NASSRFADGYRFGLGAEVGISTARIHARGPVG+EGLLTTKW
Sbjct:   687 NENTAEQFLQQLDSACVFWNASSRFADGYRFGLGAEVGISTARIHARGPVGLEGLLTTKW 746

Query:   108 VLNGDGHVASEFAEGGPCTFVHEHLPI 134
             VL G+GH  ++F+E G  T++HE+LP+
Sbjct:   747 VLRGEGHTVADFSEHGSMTYLHENLPV 773
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016620 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0004349 "glutamate 5-kinase activity" evidence=IEA
GO:0004350 "glutamate-5-semialdehyde dehydrogenase activity" evidence=IEA
GO:0006561 "proline biosynthetic process" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0008652 "cellular amino acid biosynthetic process" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0016740 "transferase activity" evidence=IEA
FB|FBgn0037146 CG7470 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1SC47 ALDH18A1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJH7 ALDH18A1 "Aldehyde dehydrogenase 18 family, member A1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R4M8 ALDH18A1 "Delta-1-pyrroline-5-carboxylate synthase" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|E2R3N2 ALDH18A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QYZ0 ALDH18A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P54886 ALDH18A1 "Delta-1-pyrroline-5-carboxylate synthase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1888908 Aldh18a1 "aldehyde dehydrogenase 18 family, member A1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311431 Aldh18a1 "aldehyde dehydrogenase 18 family, member A1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A3PBW4PROA_PROM01, ., 2, ., 1, ., 4, 10.54870.60.1857yesN/A
Q31KX4PROA_SYNE71, ., 2, ., 1, ., 4, 10.560.55550.1740yesN/A
A2BQ71PROA_PROMS1, ., 2, ., 1, ., 4, 10.53650.60.1857yesN/A
Q7V8C3PROA_PROMM1, ., 2, ., 1, ., 4, 10.54650.62960.1940yesN/A
B8HYG3PROA_CYAP41, ., 2, ., 1, ., 4, 10.53570.62220.1939yesN/A
Q7VBM1PROA_PROMA1, ., 2, ., 1, ., 4, 10.53650.60.1857yesN/A
Q0VN49PROA_ALCBS1, ., 2, ., 1, ., 4, 10.57140.53330.1702yesN/A
Q5N0Z7PROA_SYNP61, ., 2, ., 1, ., 4, 10.560.55550.1740yesN/A
P54889ALH13_CAEEL1, ., 2, ., 1, ., 4, 10.69870.60740.1025yesN/A
P54888P5CS2_ARATH1, ., 2, ., 1, ., 4, 10.650.57030.1060yesN/A
P54886P5CS_HUMAN1, ., 2, ., 1, ., 4, 10.70110.64440.1094yesN/A
P54885PROA_YEAST1, ., 2, ., 1, ., 4, 10.53400.64440.1907yesN/A
A2C148PROA_PROM11, ., 2, ., 1, ., 4, 10.54210.60740.1872yesN/A
Q8DKU1PROA_THEEB1, ., 2, ., 1, ., 4, 10.51800.61480.1890yesN/A
Q7WH30PROA_BORBR1, ., 2, ., 1, ., 4, 10.65150.48880.1575yesN/A
B0CFL0PROA_ACAM11, ., 2, ., 1, ., 4, 10.52380.62220.1948yesN/A
Q9Z110P5CS_MOUSE1, ., 2, ., 1, ., 4, 10.68960.64440.1094yesN/A
A3DC22PROA_CLOTH1, ., 2, ., 1, ., 4, 10.56750.54810.1716yesN/A
Q7W9M7PROA_BORPA1, ., 2, ., 1, ., 4, 10.65150.48880.1575yesN/A
Q7U654PROA_SYNPX1, ., 2, ., 1, ., 4, 10.52320.62960.1954yesN/A
Q47IN4PROA_DECAR1, ., 2, ., 1, ., 4, 10.68750.47400.1531yesN/A
Q31BU4PROA_PROM91, ., 2, ., 1, ., 4, 10.51760.62220.1926yesN/A
A5GSH0PROA_SYNR31, ., 2, ., 1, ., 4, 10.55950.61480.1865yesN/A
Q606Y1PROA_METCA1, ., 2, ., 1, ., 4, 10.65620.47400.1488yesN/A
Q7VWZ0PROA_BORPE1, ., 2, ., 1, ., 4, 10.65150.48880.1575yesN/A
A5GJS5PROA_SYNPW1, ., 2, ., 1, ., 4, 10.54020.62960.1954yesN/A
C1D6E4PROA_LARHH1, ., 2, ., 1, ., 4, 10.55690.54810.1761yesN/A
Q5R4M8P5CS_PONAB1, ., 2, ., 1, ., 4, 10.70110.64440.1094yesN/A
A1WYZ4PROA_HALHL1, ., 2, ., 1, ., 4, 10.65150.48880.1556yesN/A
A2BVQ3PROA_PROM51, ., 2, ., 1, ., 4, 10.53010.60740.1880yesN/A
O04226P5CS_ORYSJ1, ., 2, ., 1, ., 4, 10.61620.61480.1159yesN/A
A9HWX2PROA_BORPD1, ., 2, ., 1, ., 4, 10.66150.48140.1543yesN/A
Q7V293PROA_PROMP1, ., 2, ., 1, ., 4, 10.54790.54070.1674yesN/A
Q3SG61PROA_THIDA1, ., 2, ., 1, ., 4, 10.68750.47400.1505yesN/A
Q18J39PROA_HALWD1, ., 2, ., 1, ., 4, 10.59250.60.1776yesN/A
A8G3V6PROA_PROM21, ., 2, ., 1, ., 4, 10.51760.62220.1926yesN/A
Q3AKU8PROA_SYNSC1, ., 2, ., 1, ., 4, 10.54760.61480.1908yesN/A
Q46LW0PROA_PROMT1, ., 2, ., 1, ., 4, 10.54210.60740.1872yesN/A
Q0I8Z0PROA_SYNS31, ., 2, ., 1, ., 4, 10.56970.62960.1931yesN/A
Q3AYD4PROA_SYNS91, ., 2, ., 1, ., 4, 10.55290.62220.1922yesN/A
A2CAS7PROA_PROM31, ., 2, ., 1, ., 4, 10.53480.62960.1940yesN/A
Q0AEA6PROA_NITEC1, ., 2, ., 1, ., 4, 10.54430.54810.1753yesN/A
Q9UT44PROA_SCHPO1, ., 2, ., 1, ., 4, 10.51130.64440.1929yesN/A
Q3IP72PROA_NATPD1, ., 2, ., 1, ., 4, 10.59520.62220.1917yesN/A
B0JWW5PROA_MICAN1, ., 2, ., 1, ., 4, 10.53010.61480.1925yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.2.1.41LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
cd07079406 cd07079, ALDH_F18-19_ProA-GPR, Gamma-glutamyl phos 5e-41
PRK00197417 PRK00197, proA, gamma-glutamyl phosphate reductase 6e-41
PLN02418718 PLN02418, PLN02418, delta-1-pyrroline-5-carboxylat 1e-40
TIGR01092715 TIGR01092, P5CS, delta l-pyrroline-5-carboxylate s 7e-40
COG0014417 COG0014, ProA, Gamma-glutamyl phosphate reductase 9e-38
TIGR00407398 TIGR00407, proA, gamma-glutamyl phosphate reductas 5e-27
cd07077397 cd07077, ALDH-like, NAD(P)+-dependent aldehyde deh 5e-16
>gnl|CDD|143398 cd07079, ALDH_F18-19_ProA-GPR, Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19 Back     alignment and domain information 
 Score =  140 bits (355), Expect = 5e-41
 Identities = 38/65 (58%), Positives = 50/65 (76%)

Query: 48  SESTAADFQRKVDSACVFHNASSRFADGYRFGLGAEVGISTARIHARGPVGVEGLLTTKW 107
           +  TA  F R+VDSA V+ NAS+RF DG  FGLGAE+GIST ++HARGP+G+E L T K+
Sbjct: 342 NYETAERFLREVDSAAVYVNASTRFTDGGEFGLGAEIGISTQKLHARGPMGLEELTTYKY 401

Query: 108 VLNGD 112
           ++ GD
Sbjct: 402 IVRGD 406

Gamma-glutamyl phosphate reductase (GPR), a L-proline biosynthetic pathway (PBP) enzyme that catalyzes the NADPH dependent reduction of L-gamma-glutamyl 5-phosphate into L-glutamate 5-semialdehyde and phosphate. The glutamate route of the PBP involves two enzymatic steps catalyzed by gamma-glutamyl kinase (GK, EC 2.7.2.11) and GPR (EC 1.2.1.41). These enzymes are fused into the bifunctional enzyme, ProA or delta(1)-pyrroline-5-carboxylate synthetase (P5CS) in plants and animals, whereas they are separate enzymes in bacteria and yeast. In humans, the P5CS (ALDH18A1), an inner mitochondrial membrane enzyme, is essential to the de novo synthesis of the amino acids proline and arginine. Tomato (Lycopersicon esculentum) has both the prokaryotic-like polycistronic operons encoding GK and GPR (PRO1, ALDH19) and the full-length, bifunctional P5CS (PRO2, ALDH18B1). Length = 406
>gnl|CDD|234685 PRK00197, proA, gamma-glutamyl phosphate reductase; Provisional Back     alignment and domain information
>gnl|CDD|215230 PLN02418, PLN02418, delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>gnl|CDD|130164 TIGR01092, P5CS, delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>gnl|CDD|223093 COG0014, ProA, Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|161862 TIGR00407, proA, gamma-glutamyl phosphate reductase Back     alignment and domain information
>gnl|CDD|143396 cd07077, ALDH-like, NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 135
KOG4165|consensus433 100.0
COG0014417 ProA Gamma-glutamyl phosphate reductase [Amino aci 100.0
PLN02418718 delta-1-pyrroline-5-carboxylate synthase 99.78
TIGR02518488 EutH_ACDH acetaldehyde dehydrogenase (acetylating) 99.78
TIGR00407398 proA gamma-glutamyl phosphate reductase. The prosi 99.77
TIGR01092715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 99.74
PRK00197417 proA gamma-glutamyl phosphate reductase; Provision 99.36
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 99.3
cd07079406 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate redu 99.07
cd07077397 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase 99.01
PRK15398465 aldehyde dehydrogenase EutE; Provisional 98.93
cd06534367 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase s 98.51
cd07150451 ALDH_VaniDH_like Pseudomonas putida vanillin dehyd 98.4
cd07152443 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogen 98.33
cd07099453 ALDH_DDALDH Methylomonas sp. 4,4'-diapolycopene-di 98.31
cd07104431 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependen 98.28
cd07120455 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde deh 98.19
cd07078432 ALDH NAD(P)+ dependent aldehyde dehydrogenase fami 98.04
cd07103451 ALDH_F5_SSADH_GabD Mitochondrial succinate-semiald 97.91
cd07151465 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyd 97.9
cd07082473 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylat 97.78
cd07110456 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydro 97.74
cd07114457 ALDH_DhaS Uncharacterized Candidatus pelagibacter 97.73
cd07121429 ALDH_EutE Ethanolamine utilization protein EutE-li 97.7
cd07091476 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 97.7
PLN02278498 succinic semialdehyde dehydrogenase 97.67
cd07115453 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxy 97.62
cd07105432 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-l 97.59
cd07106446 ALDH_AldA-AAD23400 Streptomyces aureofaciens putat 97.58
cd07088468 ALDH_LactADH-AldA Escherichia coli lactaldehyde de 97.53
cd07089459 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric 97.53
cd07143481 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde deh 97.51
cd07119482 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent be 97.44
PLN00412496 NADP-dependent glyceraldehyde-3-phosphate dehydrog 97.38
cd07147452 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1 97.37
cd07116479 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependen 97.36
cd07090457 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobuty 97.36
cd07145456 ALDH_LactADH_F420-Bios Methanocaldococcus jannasch 97.27
cd07100429 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succi 97.24
cd07144484 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyd 97.24
cd07148455 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with si 97.22
cd07094453 ALDH_F21_LactADH-like ALDH subfamily: NAD+-depende 97.21
cd07102452 ALDH_EDX86601 Uncharacterized aldehyde dehydrogena 97.17
TIGR01722477 MMSDH methylmalonic acid semialdehyde dehydrogenas 97.17
cd07131478 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuen 97.15
cd07107456 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde 97.14
cd07125518 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate d 97.14
cd07559480 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dep 97.12
PLN02467503 betaine aldehyde dehydrogenase 97.1
cd07142476 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 97.04
PRK09847494 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogen 97.0
PLN02466538 aldehyde dehydrogenase family 2 member 96.99
cd07092450 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent g 96.96
cd07149453 ALDH_y4uC Uncharacterized ALDH (y4uC) with similar 96.95
cd07139471 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehy 96.93
TIGR02299488 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyd 96.93
cd07085478 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrog 96.93
cd07135436 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde 96.92
cd07132443 ALDH_F3AB Aldehyde dehydrogenase family 3 members 96.88
PRK13473475 gamma-aminobutyraldehyde dehydrogenase; Provisiona 96.84
cd07117475 ALDH_StaphAldA1 Uncharacterized Staphylococcus aur 96.83
PRK13252488 betaine aldehyde dehydrogenase; Provisional 96.81
cd07097473 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent 96.77
cd07113477 ALDH_PADH_NahF Escherichia coli NAD+-dependent phe 96.77
cd07122436 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydr 96.75
PRK13968462 putative succinate semialdehyde dehydrogenase; Pro 96.72
cd07109454 ALDH_AAS00426 Uncharacterized Saccharopolyspora sp 96.72
cd07146451 ALDH_PhpJ Streptomyces putative phosphonoformaldeh 96.71
cd07108457 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent a 96.7
TIGR03216481 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehy 96.69
cd07118454 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydr 96.69
cd07124512 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxyl 96.69
cd07083500 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)- 96.61
TIGR03240484 arg_catab_astD succinylglutamic semialdehyde dehyd 96.6
PRK09406457 gabD1 succinic semialdehyde dehydrogenase; Reviewe 96.58
TIGR01238500 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehy 96.54
cd07112462 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent 96.54
PRK11905 1208 bifunctional proline dehydrogenase/pyrroline-5-car 96.54
PRK10090409 aldehyde dehydrogenase A; Provisional 96.54
cd07086478 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadip 96.53
cd07141481 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydro 96.53
cd07093455 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 96.5
TIGR01237511 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehy 96.46
cd07138466 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric ac 96.36
PRK11809 1318 putA trifunctional transcriptional regulator/proli 96.32
cd07101454 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succi 96.25
TIGR01804467 BADH glycine betaine aldehyde dehydrogenase. Betai 96.2
cd07111480 ALDH_F16 Aldehyde dehydrogenase family 16A1-like. 96.19
cd07130474 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic se 96.18
cd07087426 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl 96.15
cd07137432 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 m 96.11
cd07134433 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydro 96.07
PRK09407524 gabD2 succinic semialdehyde dehydrogenase; Reviewe 96.04
cd07136449 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydr 95.97
cd07098465 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 95.94
PRK03137514 1-pyrroline-5-carboxylate dehydrogenase; Provision 95.77
cd07133434 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-l 95.66
PLN02203484 aldehyde dehydrogenase 95.58
PRK09457487 astD succinylglutamic semialdehyde dehydrogenase; 95.56
PLN02174484 aldehyde dehydrogenase family 3 member H1 95.23
PF00171462 Aldedh: Aldehyde dehydrogenase family; InterPro: I 95.16
PTZ00381493 aldehyde dehydrogenase family protein; Provisional 95.09
cd07081439 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldeh 94.95
PLN02315508 aldehyde dehydrogenase family 7 member 94.8
PRK119041038 bifunctional proline dehydrogenase/pyrroline-5-car 94.72
cd07095431 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde 94.68
PRK11241482 gabD succinate-semialdehyde dehydrogenase I; Provi 94.62
TIGR03374472 ABALDH 1-pyrroline dehydrogenase. Members of this 94.56
PLN02766501 coniferyl-aldehyde dehydrogenase 94.51
TIGR03250472 PhnAcAld_DH putative phosphonoacetaldehyde dehydro 94.34
PLN02419604 methylmalonate-semialdehyde dehydrogenase [acylati 93.54
cd07140486 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydroge 93.43
TIGR01236533 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehy 92.48
COG1012472 PutA NAD-dependent aldehyde dehydrogenases [Energy 91.74
TIGR01780448 SSADH succinate-semialdehyde dehydrogenase. SSADH 90.41
cd07123522 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate 89.6
TIGR02288551 PaaN_2 phenylacetic acid degradation protein paaN. 85.96
cd07129454 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydr 83.11
COG3688173 Predicted RNA-binding protein containing a PIN dom 82.87
cd07084442 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent 82.83
PRK11563 675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 82.67
>KOG4165|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.1e-47  Score=330.70  Aligned_cols=101  Identities=64%  Similarity=1.053  Sum_probs=98.2

Q ss_pred             CCCCCCceeEEeCCHHHHHHHHhhccceeEeecccccccCCccccCceEEEeecCCcccccccccccceEEEEEEeCCce
Q psy11680         35 FMNTLMTRKYFLFSESTAADFQRKVDSACVFHNASSRFADGYRFGLGAEVGISTARIHARGPVGVEGLLTTKWVLNGDGH  114 (135)
Q Consensus        35 ~~~s~HTd~IVTed~~~a~~F~~~VDSA~V~vNASTRFsDG~~fGlGaEvGIST~KlHaRGPvGLe~Ltt~Kyvv~G~Gq  114 (135)
                      -++|.|||||||||.++|+.|+++||||+|||||||||+||||||+||||||||+|+|||||||||+|+||||+++|+||
T Consensus       329 ~hgS~HTD~IvTe~~~~Ae~Fl~~VDSa~vf~NASTRFaDGfRfGlGaEVGIST~rIHARGPvGveGLlttkw~lRG~gq  408 (433)
T KOG4165|consen  329 THGSSHTDCIVTENEATAEHFLKHVDSACVFHNASTRFADGFRFGLGAEVGISTSRIHARGPVGVEGLLTTKWLLRGKGQ  408 (433)
T ss_pred             hcCCcccceEEecCHHHHHHHHhccchhheeecccccccccccccccceeeeeccceeccCCccccceeeeeeEEecCCc
Confidence            36899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeccccCCCCceeeeccCCCC
Q psy11680        115 VASEFAEGGPCTFVHEHLPIN  135 (135)
Q Consensus       115 ~r~~y~~~~~~~~~h~~l~~~  135 (135)
                      ++.+|.++|.++|+|++||++
T Consensus       409 vvsd~~~~G~~~y~H~~l~i~  429 (433)
T KOG4165|consen  409 VVSDFNEGGKRAYLHEDLPID  429 (433)
T ss_pred             eeccccCCCceeeeecCCChh
Confidence            999999889999999999874

>COG0014 ProA Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>TIGR02518 EutH_ACDH acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>TIGR00407 proA gamma-glutamyl phosphate reductase Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>PRK00197 proA gamma-glutamyl phosphate reductase; Provisional Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd07079 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19 Back     alignment and domain information
>cd07077 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family Back     alignment and domain information
>PRK15398 aldehyde dehydrogenase EutE; Provisional Back     alignment and domain information
>cd06534 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>cd07150 ALDH_VaniDH_like Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>cd07152 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07099 ALDH_DDALDH Methylomonas sp Back     alignment and domain information
>cd07104 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07120 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>cd07078 ALDH NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>cd07103 ALDH_F5_SSADH_GabD Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>cd07151 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>cd07082 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>cd07110 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>cd07114 ALDH_DhaS Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>cd07121 ALDH_EutE Ethanolamine utilization protein EutE-like Back     alignment and domain information
>cd07091 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>PLN02278 succinic semialdehyde dehydrogenase Back     alignment and domain information
>cd07115 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>cd07105 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>cd07106 ALDH_AldA-AAD23400 Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>cd07088 ALDH_LactADH-AldA Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07089 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>cd07143 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>cd07119 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>PLN00412 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd07147 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>cd07116 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07090 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>cd07145 ALDH_LactADH_F420-Bios Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>cd07100 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>cd07144 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>cd07148 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07094 ALDH_F21_LactADH-like ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>cd07102 ALDH_EDX86601 Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>TIGR01722 MMSDH methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>cd07131 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>cd07107 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>cd07125 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>cd07559 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>PLN02467 betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07142 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>PRK09847 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN02466 aldehyde dehydrogenase family 2 member Back     alignment and domain information
>cd07092 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>cd07149 ALDH_y4uC Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07139 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>TIGR02299 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>cd07085 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>cd07135 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>cd07132 ALDH_F3AB Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>PRK13473 gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07117 ALDH_StaphAldA1 Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>PRK13252 betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07097 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>cd07113 ALDH_PADH_NahF Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>cd07122 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydrogenase (ACDH), ALDH family 20-like Back     alignment and domain information
>PRK13968 putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07109 ALDH_AAS00426 Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>cd07146 ALDH_PhpJ Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>cd07108 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>TIGR03216 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>cd07118 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>cd07124 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>cd07083 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>TIGR03240 arg_catab_astD succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>PRK09406 gabD1 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01238 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>cd07112 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>PRK11905 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>PRK10090 aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>cd07086 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07141 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>cd07093 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>TIGR01237 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>cd07138 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>PRK11809 putA trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07101 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>TIGR01804 BADH glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07111 ALDH_F16 Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>cd07130 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>cd07087 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>cd07137 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>cd07134 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>PRK09407 gabD2 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07136 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>cd07098 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>PRK03137 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>cd07133 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>PLN02203 aldehyde dehydrogenase Back     alignment and domain information
>PRK09457 astD succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PLN02174 aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
>PF00171 Aldedh: Aldehyde dehydrogenase family; InterPro: IPR015590 Aldehyde dehydrogenases (1 Back     alignment and domain information
>PTZ00381 aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>cd07081 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldehyde dehydrogenase (ACDH), Ethanolamine utilization protein EutE, and related proteins Back     alignment and domain information
>PLN02315 aldehyde dehydrogenase family 7 member Back     alignment and domain information
>PRK11904 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07095 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>PRK11241 gabD succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>TIGR03374 ABALDH 1-pyrroline dehydrogenase Back     alignment and domain information
>PLN02766 coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>TIGR03250 PhnAcAld_DH putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>PLN02419 methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>cd07140 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>TIGR01236 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>COG1012 PutA NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>TIGR01780 SSADH succinate-semialdehyde dehydrogenase Back     alignment and domain information
>cd07123 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>TIGR02288 PaaN_2 phenylacetic acid degradation protein paaN Back     alignment and domain information
>cd07129 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydrogenase Back     alignment and domain information
>COG3688 Predicted RNA-binding protein containing a PIN domain [General function prediction only] Back     alignment and domain information
>cd07084 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
2h5g_A463 Crystal Structure Of Human Pyrroline-5-carboxylate 7e-33
1vlu_A468 Crystal Structure Of Gamma-Glutamyl Phosphate Reduc 4e-23
4ghk_A444 X-Ray Crystal Structure Of Gamma-Glutamyl Phosphate 1e-17
1o20_A427 Crystal Structure Of Gamma-glutamyl Phosphate Reduc 3e-16
>pdb|2H5G|A Chain A, Crystal Structure Of Human Pyrroline-5-carboxylate Synthetase Length = 463 Back     alignment and structure 
Iteration: 1

 Score =  135 bits (340), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 61/86 (70%), Positives = 73/86 (84%)
Query: 49  ESTAADFQRKVDSACVFHNASSRFADGYRFGLGAEVGISTARIHARGPVGVEGLLTTKWV 108
           E+TA  F + VDSACVF NAS+RF+DGYRFGLGAEVGIST+RIHARGPVG+EGLLTTKW+
Sbjct: 372 ENTAEFFLQHVDSACVFWNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWL 431
Query: 109 LNGDGHVASEFAEGGPCTFVHEHLPI 134
           L G  HV S+F+E G   ++HE+LPI
Sbjct: 432 LRGKDHVVSDFSEHGSLKYLHENLPI 457
>pdb|1VLU|A Chain A, Crystal Structure Of Gamma-Glutamyl Phosphate Reductase (Yor323c) From Saccharomyces Cerevisiae At 2.40 A Resolution Length = 468 Back     alignment and structure
>pdb|4GHK|A Chain A, X-Ray Crystal Structure Of Gamma-Glutamyl Phosphate Reductase From Burkholderia Thailandensis Length = 444 Back     alignment and structure
>pdb|1O20|A Chain A, Crystal Structure Of Gamma-glutamyl Phosphate Reductase (tm0293) From Thermotoga Maritima At 2.00 A Resolution Length = 427 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
2h5g_A463 Delta 1-pyrroline-5-carboxylate synthetase; dehydr 1e-51
1vlu_A468 Gamma-glutamyl phosphate reductase; YOR323C, struc 4e-47
1o20_A427 Gamma-glutamyl phosphate reductase; TM0293, struct 7e-38
>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens} Length = 463 Back     alignment and structure
 Score =  168 bits (429), Expect = 1e-51
 Identities = 61/88 (69%), Positives = 73/88 (82%)

Query: 48  SESTAADFQRKVDSACVFHNASSRFADGYRFGLGAEVGISTARIHARGPVGVEGLLTTKW 107
            E+TA  F + VDSACVF NAS+RF+DGYRFGLGAEVGIST+RIHARGPVG+EGLLTTKW
Sbjct: 371 DENTAEFFLQHVDSACVFWNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKW 430

Query: 108 VLNGDGHVASEFAEGGPCTFVHEHLPIN 135
           +L G  HV S+F+E G   ++HE+LPI 
Sbjct: 431 LLRGKDHVVSDFSEHGSLKYLHENLPIP 458
>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1 Length = 468 Back     alignment and structure
>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genom JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: c.82.1.1 Length = 427 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
1vlu_A468 Gamma-glutamyl phosphate reductase; YOR323C, struc 99.73
2h5g_A463 Delta 1-pyrroline-5-carboxylate synthetase; dehydr 99.64
4ghk_A444 Gamma-glutamyl phosphate reductase; structural gen 99.41
1o20_A427 Gamma-glutamyl phosphate reductase; TM0293, struct 99.34
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 99.12
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 98.93
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 98.93
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 98.8
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 98.74
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 98.69
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 98.68
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 98.61
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 98.51
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 98.5
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 98.5
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 98.48
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 98.47
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 98.43
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 98.42
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 98.4
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 98.38
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 98.38
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 98.38
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 98.37
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 98.37
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 98.33
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 98.31
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 98.29
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 98.29
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 98.28
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 98.28
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 98.27
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 98.23
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 98.22
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 98.2
2wme_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 98.17
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 98.13
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 98.13
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 98.12
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 98.08
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 98.08
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 98.07
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 97.99
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 97.98
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 97.97
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 97.84
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 97.75
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 97.74
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 97.68
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 97.64
4h7n_A474 Aldehyde dehydrogenase; structural genomics, PSI-b 97.57
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 97.07
>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1 Back     alignment and structure
Probab=99.73  E-value=3.3e-18  Score=145.48  Aligned_cols=99  Identities=48%  Similarity=0.848  Sum_probs=59.9

Q ss_pred             CCCCCceeEEeCCHHHHHHHHhhccceeEeecccccccCCccccCceEEEeecCCcccccccccccceEEEEEEeCCcee
Q psy11680         36 MNTLMTRKYFLFSESTAADFQRKVDSACVFHNASSRFADGYRFGLGAEVGISTARIHARGPVGVEGLLTTKWVLNGDGHV  115 (135)
Q Consensus        36 ~~s~HTd~IVTed~~~a~~F~~~VDSA~V~vNASTRFsDG~~fGlGaEvGIST~KlHaRGPvGLe~Ltt~Kyvv~G~Gq~  115 (135)
                      ...+|+.+|.|+|.+.+++|.+++++..|+||.++++.++..||+|.|.|++++.++++||.|+++++..|+|+.+.||+
T Consensus       364 ~~~gL~a~v~t~d~~~a~~~~~~l~aG~V~vN~~~~~~~~~pfG~Gg~~G~~~SG~g~~G~~gl~~f~~~K~v~~~~~~~  443 (468)
T 1vlu_A          364 HSSRHTDAIVTENKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVSYQYQIRGDGQV  443 (468)
T ss_dssp             SCSSCEEEEECSCHHHHHHHHHHCCCSEEEESSCGGGCC----------------------CCSGGGEEEEEEEECSSCC
T ss_pred             CCCCceEEEEeCCHHHHHHHHHhCCeeEEEEcCCCCCCCCCCCCCCCCcceecCCCCCCcchHHHHhcceEEEEECCCCc
Confidence            35689999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eccccC-CCCceeeeccCCC
Q psy11680        116 ASEFAE-GGPCTFVHEHLPI  134 (135)
Q Consensus       116 r~~y~~-~~~~~~~h~~l~~  134 (135)
                      |++|.+ .+++.|+|++|++
T Consensus       444 r~py~~~~~~~~~~~~~~~~  463 (468)
T 1vlu_A          444 ASDYLGAGGNKAFVHKDLDI  463 (468)
T ss_dssp             SCCC----------------
T ss_pred             CccccccccccceecCCCCc
Confidence            999973 5789999999864
>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens} Back     alignment and structure
>4ghk_A Gamma-glutamyl phosphate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Burkholderia thailandensis} Back     alignment and structure
>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genom JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: c.82.1.1 Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Back     alignment and structure
>2wme_A BADH, betaine aldehyde dehydrogenase; aldehyde oxidation, NAD, NADP complex, oxidoreductase; HET: NAP CSO; 2.10A {Pseudomonas aeruginosa} PDB: 2wox_A* 3zqa_A* 2xdr_A* Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} SCOP: c.82.1.0 PDB: 3iwk_A* 4a0m_A* Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} SCOP: c.82.1.1 PDB: 3szb_A* 1ad3_A* Back     alignment and structure
>4h7n_A Aldehyde dehydrogenase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ALDH_ddaldh, COG1012, glyco_hydro_97; 2.00A {Anabaena variabilis} Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 135
d1vlua_436 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 2e-36
d1o20a_414 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 3e-25
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 436 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Gamma-glutamyl phosphate reductase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  126 bits (318), Expect = 2e-36
 Identities = 40/72 (55%), Positives = 60/72 (83%)

Query: 48  SESTAADFQRKVDSACVFHNASSRFADGYRFGLGAEVGISTARIHARGPVGVEGLLTTKW 107
           +++ A  F + VDS+ V+ NAS+RFADG+R+G GAEVGIST++IHARGPVG++GL++ ++
Sbjct: 365 NKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVSYQY 424

Query: 108 VLNGDGHVASEF 119
            + GDG VAS++
Sbjct: 425 QIRGDGQVASDY 436
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Length = 414 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
d1vlua_436 Gamma-glutamyl phosphate reductase {Baker's yeast 100.0
d1o20a_414 Gamma-glutamyl phosphate reductase {Thermotoga mar 99.85
d1euha_474 Aldehyde reductase (dehydrogenase), ALDH {Streptoc 98.5
d1a4sa_503 Aldehyde reductase (dehydrogenase), ALDH {Baltic c 98.49
d1wnda_474 Putative betaine aldehyde dehydrogenase YdcW {Esch 98.23
d1ad3a_446 Aldehyde reductase (dehydrogenase), ALDH {Rat (Rat 98.23
d1bxsa_494 Aldehyde reductase (dehydrogenase), ALDH {Sheep (O 97.68
d1o04a_494 Aldehyde reductase (dehydrogenase), ALDH {Human (H 97.6
d1ky8a_499 Non-phosphorylating glyceraldehyde-3-phosphate deh 97.18
d1uzba_516 1-pyrroline-5-carboxylate dehydrogenase {Thermus t 96.0
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Gamma-glutamyl phosphate reductase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=5.4e-42  Score=287.71  Aligned_cols=87  Identities=47%  Similarity=0.822  Sum_probs=62.4

Q ss_pred             CCCCCCCCceeEEeCCHHHHHHHHhhccceeEeecccccccCCccccCceEEEeecCCcccccccccccceEEEEEEeCC
Q psy11680         33 CPFMNTLMTRKYFLFSESTAADFQRKVDSACVFHNASSRFADGYRFGLGAEVGISTARIHARGPVGVEGLLTTKWVLNGD  112 (135)
Q Consensus        33 ~~~~~s~HTd~IVTed~~~a~~F~~~VDSA~V~vNASTRFsDG~~fGlGaEvGIST~KlHaRGPvGLe~Ltt~Kyvv~G~  112 (135)
                      |...+++||++|+|+|++.|++|.++|||++||||+||||+||++||||+||||||+|+|+|||||||+||||||+|+|+
T Consensus       350 in~~g~ghta~I~T~d~~~a~~F~~~vda~~V~vNasTrf~Dg~~~g~g~e~Gist~k~h~rGp~gl~~ltt~k~~~~g~  429 (436)
T d1vlua_         350 INTHSSRHTDAIVTENKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVSYQYQIRGD  429 (436)
T ss_dssp             HTTSCSSCEEEEECSCHHHHHHHHHHCCCSEEEESSCGGGCC----------------------CCSGGGEEEEEEEECS
T ss_pred             HHHhCCCCceEEEECCHHHHHHHHHhCCceEEEEcCCCccCCCCcccCcceeeEecCCCCCCCCcChHHhceEEEEEECC
Confidence            34578999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeeccc
Q psy11680        113 GHVASEF  119 (135)
Q Consensus       113 Gq~r~~y  119 (135)
                      ||+|.+|
T Consensus       430 g~~r~~~  436 (436)
T d1vlua_         430 GQVASDY  436 (436)
T ss_dssp             SCCSCCC
T ss_pred             CEecCCC
Confidence            9999987
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure