Psyllid ID: psy11688

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540------
MARVYLSLEYLSMSSTTNASNPAPKEVSVEDKERAEKLKAEANEHFKNQAYNKAIELYSAAIEVNPTAIYYANRSFAYLKTEAIGYALNDASKAIELDQTYTKAYYRRAAAYMSLGKFKLALRDYEAVHKARPNDKDAKAKFTECNKIVKRMQIKGKLHRKYAYRILMDIKALFMTQDSLVHITVEDEAKFTVCGDIHGQFYDLMNIFELNGLPSPDNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARGNHESAYMNQIYGFEGEVKSKYTDLMAQFFTEVYNWLPLCHCINNKVLVMHGGLFSSDNVTLEDIRTIDRNRQPPDEGLMCELLWSDPQIPNGRAPSKRGVGVHFGPDVTKAFLERNKLEYIIRSHEVKQDGYEVAHDGRCITVFSAPNYCDSVGNKGAFITMKGKDMVPHFTTYEAVGVSPPEPALENDKVTLKFMTDLMQTYKAQGKLHRKYAYRILMDIKKKKILNLDFTQLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARVECIFTLFGFKLLYPNHFFMAR
ccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccEEEEcccccccEEEEccccccHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEccccccccccccccHHHHHHHHccHHHHHHHHHHccccHHHHHccccEEEEEccccccccccHHHHHHcccccccccccccccccccccccccccccccccccEEccHHHHHHHHHHccccEEEEccccccccEEEEcccEEEEEEccccccccccccccEEEEccccccEEEEEEEccccccccccccccHHHHHHHHccccccccccccccccHHHHHHHHHHccccccccccEEccccccccccHHHHHHHHHHHHHHccccEEEEccccccEEEEEEEEccccccccc
cccEcccEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccEEEcEEEEcccEEEEcEccccHHHHHHHHHHHccccccccEEEccccccccccHHHHHHHHHHHHHHccccEEEcccccccHHHHHHHcHHHHHHHHccHHHHHHHHHHHcccccEEEEcccEEEEcccccccccccHHHHHccccccccccccHHHHHHHcEEcccccEEEccccccEEEcHHHHHHHHHHHcccEEEEccccccccEEEEccccEEEEEccccHHHcccccEEEEEEcccccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccEEEccccccEEccccccccccHHHHHHHHHHHHHHccccEEEcccccccHEEcHEEcccccEEccc
MARVYLSLEYLSMssttnasnpapkevsvEDKERAEKLKAEANEHFKNQAYNKAIELYSAAIEVNPTAIYYANRSFAYLKTEAIGYALNDASKAIELDQTYTKAYYRRAAAYMSLGKFKLALRDYEAVhkarpndkdakaKFTECNKIVKRMQIKGKLHRKYAYRILMDIKALFMTQDSLVHItvedeakftvcgdihGQFYDLMNIfelnglpspdnpylfngdfvdrgsfSVECIFTLFgfkllypnhffmargnhesaymNQIYGFEGEVKSKYTDLMAQFFTEVYnwlplchcinnkvlvmhgglfssdnvtledirtidrnrqppdeglmcellwsdpqipngrapskrgvgvhfgpdvtkAFLERNKLEYIIRSHEvkqdgyevahdgrcitvfsapnycdsvgnkgafitmkgkdmvphfttyeavgvsppepalendKVTLKFMTDLMQTYKAQGKLHRKYAYRILMDIKKKkilnldftqlfngdfvdrgsfSVECIFTLFgfkllypnhFFMARVECIFTLFGfkllypnhffmar
MARVYLSLEYLSmssttnasnpapkeVSVEDKERAEKLKAEANEHFKNQAYNKAIELYSAAIEVNPTAIYYANRSFAYLKTEAIGYALNDASKAIELDQTYTKAYYRRAAAYMSLGKFKLALRDYEAVhkarpndkdakakftecnkivkrmqikgklhrKYAYRILMDIKALFMTQDSLVHITVEDEAKFTVCGDIHGQFYDLMNIFELNGLPSPDNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARGNHESAYMNQIYGFEGEVKSKYTDLMAQFFTEVYNWLPLCHCINNKVLVMHGGLFSSDNVTLEDIRTIDRNRQPPDEGLMCELLWSDPQIPNGRAPSKRGVGVHFGPDVTKAFLERNKLEYIIRShevkqdgyevAHDGRCITVfsapnycdsvGNKGAFITMKGKDMVPHFTTYEavgvsppepaLENDKVTLKFMTDLMQTYKAQGKLHRKYAYRILMDIKKKKILNLDFTQLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARVECIFTLFGFKLLYPNHFFMAR
MARVYLSLEYLSMSSTTNASNPAPKEVSVEDKERAEKLKAEANEHFKNQAYNKAIELYSAAIEVNPTAIYYANRSFAYLKTEAIGYALNDASKAIELDQtytkayyrraaayMSLGKFKLALRDYEAVHKARPNDKDAKAKFTECNKIVKRMQIKGKLHRKYAYRILMDIKALFMTQDSLVHITVEDEAKFTVCGDIHGQFYDLMNIFELNGLPSPDNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARGNHESAYMNQIYGFEGEVKSKYTDLMAQFFTEVYNWLPLCHCINNKVLVMHGGLFSSDNVTLEDIRTIDRNRQPPDEGLMCELLWSDPQIPNGRAPSKRGVGVHFGPDVTKAFLERNKLEYIIRSHEVKQDGYEVAHDGRCITVFSAPNYCDSVGNKGAFITMKGKDMVPHFTTYEAVGVSPPEPALENDKVTLKFMTDLMQTYKAQGKLHRKYAYRILMDIKKKKILNLDFTQLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARVECIFTLFGFKLLYPNHFFMAR
***********************************************NQAYNKAIELYSAAIEVNPTAIYYANRSFAYLKTEAIGYALNDASKAIELDQTYTKAYYRRAAAYMSLGKFKLALRDYEAVHKA*******KAKFTECNKIVKRMQIKGKLHRKYAYRILMDIKALFMTQDSLVHITVEDEAKFTVCGDIHGQFYDLMNIFELNGLPSPDNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARGNHESAYMNQIYGFEGEVKSKYTDLMAQFFTEVYNWLPLCHCINNKVLVMHGGLFSSDNVTLEDIRTID********GLMCELLWSD************GVGVHFGPDVTKAFLERNKLEYIIRSHEVKQDGYEVAHDGRCITVFSAPNYCDSVGNKGAFITMKGKDMVPHFTTYEAVGVS*****LENDKVTLKFMTDLMQTYKAQGKLHRKYAYRILMDIKKKKILNLDFTQLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARVECIFTLFGFKLLYPNHFFM**
**************************************KAEANEHFKNQAYNKAIELYSAAIEVNPTAIYYANRSFAYLKTEAIGYALNDASKAIELDQTYTKAYYRRAAAYMSLGKFKLALRDYEAVHK*********AKFTECNKIVKRMQIKGKLHRKYAYRILMDIKALFMTQDSLVHITVEDEAKFTVCGDIHGQFYDLMNIFELNGLPSPDNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARGNHESAYMNQIYGFEGEVKSKYTDLMAQFFTEVYNWLPLCHCINNKVLVMHGGLFSSDNVTLEDIRTIDRNRQPPDEGLMCELLWSDPQIPNGRAPSKRGVGVHFGPDVTKAFLERNKLEYIIRSHEVKQDGYEVAHDGRCITVFSAPNYCDSVGNKGAFITMKGKDMVPHFTTYEAVGVSPPEPALENDKVTLKFMTDLMQTYKAQGKLHRKYAYRILMDIKKKKILNLDFTQLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARVECIFTLFGFKLLYPNHFFMA*
MARVYLSLEYLSMS********************AEKLKAEANEHFKNQAYNKAIELYSAAIEVNPTAIYYANRSFAYLKTEAIGYALNDASKAIELDQTYTKAYYRRAAAYMSLGKFKLALRDYEAVHKARPNDKDAKAKFTECNKIVKRMQIKGKLHRKYAYRILMDIKALFMTQDSLVHITVEDEAKFTVCGDIHGQFYDLMNIFELNGLPSPDNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARGNHESAYMNQIYGFEGEVKSKYTDLMAQFFTEVYNWLPLCHCINNKVLVMHGGLFSSDNVTLEDIRTIDRNRQPPDEGLMCELLWSDPQIPNGRAPSKRGVGVHFGPDVTKAFLERNKLEYIIRSHEVKQDGYEVAHDGRCITVFSAPNYCDSVGNKGAFITMKGKDMVPHFTTYEAVGVSPPEPALENDKVTLKFMTDLMQTYKAQGKLHRKYAYRILMDIKKKKILNLDFTQLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARVECIFTLFGFKLLYPNHFFMAR
****************************VEDKERAEKLKAEANEHFKNQAYNKAIELYSAAIEVNPTAIYYANRSFAYLKTEAIGYALNDASKAIELDQTYTKAYYRRAAAYMSLGKFKLALRDYEAVHKARPNDKDAKAKFTECNKIVKRMQIKGKLHRKYAYRILMDIKALFMTQDSLVHITVEDEAKFTVCGDIHGQFYDLMNIFELNGLPSPDNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARGNHESAYMNQIYGFEGEVKSKYTDLMAQFFTEVYNWLPLCHCINNKVLVMHGGLFSSDNVTLEDIRTIDRNRQPPDEGLMCELLWSDPQIPNGRAPSKRGVGVHFGPDVTKAFLERNKLEYIIRSHEVKQDGYEVAHDGRCITVFSAPNYCDSVGNKGAFITMKGKDMVPHFTTYEAVGVSPPEPALENDKVTLKFMTDLMQTYKAQGKLHRKYAYRILMDIKKKKILNLDFTQLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARVECIFTLFGFKLLYPNHFFMAR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARVYLSLEYLSMSSTTNASNPAPKEVSVEDKERAEKLKAEANEHFKNQAYNKAIELYSAAIEVNPTAIYYANRSFAYLKTEAIGYALNDASKAIELDQTYTKAYYRRAAAYMSLGKFKLALRDYEAVHKARPNDKDAKAKFTECNKIVKRMQIKGKLHRKYAYRILMDIKALFMTQDSLVHITVEDEAKFTVCGDIHGQFYDLMNIFELNGLPSPDNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARGNHESAYMNQIYGFEGEVKSKYTDLMAQFFTEVYNWLPLCHCINNKVLVMHGGLFSSDNVTLEDIRTIDRNRQPPDEGLMCELLWSDPQIPNGRAPSKRGVGVHFGPDVTKAFLERNKLEYIIRSHEVKQDGYEVAHDGRCITVFSAPNYCDSVGNKGAFITMKGKDMVPHFTTYEAVGVSPPEPALENDKVTLKFMTDLMQTYKAQGKLHRKYAYRILMDIKKKKILNLDFTQLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARVECIFTLFGFKLLYPNHFFMAR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query546 2.2.26 [Sep-21-2011]
P53042499 Serine/threonine-protein yes N/A 0.774 0.847 0.574 1e-157
Q60676499 Serine/threonine-protein yes N/A 0.734 0.803 0.594 1e-157
P53041499 Serine/threonine-protein yes N/A 0.734 0.803 0.594 1e-157
O43049473 Serine/threonine-protein yes N/A 0.732 0.845 0.475 1e-115
Q84K11556 Serine/threonine-protein N/A N/A 0.523 0.514 0.613 1e-106
Q84XU2538 Serine/threonine-protein no N/A 0.503 0.511 0.634 1e-105
P53043513 Serine/threonine-protein yes N/A 0.604 0.643 0.448 2e-73
P40421 661 Serine/threonine-protein no N/A 0.507 0.419 0.418 6e-59
P32598312 Serine/threonine-protein no N/A 0.443 0.775 0.453 8e-58
Q3SWT6640 Serine/threonine-protein no N/A 0.545 0.465 0.374 9e-58
>sp|P53042|PPP5_RAT Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus GN=Ppp5c PE=2 SV=1 Back     alignment and function desciption
 Score =  556 bits (1433), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 274/477 (57%), Positives = 331/477 (69%), Gaps = 54/477 (11%)

Query: 11  LSMSSTTNASNPAPKEVSVEDK-ERAEKLKAEANEHFKNQAYNKAIELYSAAIEVNPT-A 68
           ++    T  + P   E   E   +RAE+LK +AN++FK + Y  AI+ YS AIE+NP+ A
Sbjct: 3   MAEGERTECAEPPRDEPPAEGTLKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNA 62

Query: 69  IYYANRSFAYLKTEAIGYALNDASKAIELDQTYTKAYYRRAAAYMSLGKFKLALRDYEAV 128
           IYY NRS AYL+TE  GYAL DA++AIELD+ Y K YYRRAA+ M+LGKF+ ALRDYE V
Sbjct: 63  IYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETV 122

Query: 129 HKARPNDKDAKAKFTECNKIVKR------------------------------------- 151
            K +PNDKDAK K+ EC+KIVK+                                     
Sbjct: 123 VKVKPNDKDAKMKYQECSKIVKQKAFERAIAGDEHRRSVVDSLDIESMTIEDEYSGPKLE 182

Query: 152 ------------MQI---KGKLHRKYAYRILMDIKALFMTQDSLVHITVEDEAKFTVCGD 196
                       MQ    + KLHRK AY+IL+ +K +     +LV  T+++  K TVCGD
Sbjct: 183 DGKVTITFMKDLMQWYKDQKKLHRKCAYQILVQVKEVLCKLSTLVETTLKETEKITVCGD 242

Query: 197 IHGQFYDLMNIFELNGLPSPDNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARG 256
            HGQFYDL+NIFELNGLPS  NPY+FNGDFVDRGSFSVE I TLFGFKLLYP+HF + RG
Sbjct: 243 THGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRG 302

Query: 257 NHESAYMNQIYGFEGEVKSKYTDLMAQFFTEVYNWLPLCHCINNKVLVMHGGLFSSDNVT 316
           NHE+  MNQIYGFEGEVK+KYT  M + F+EV+ WLPL  CIN KVL+MHGGLFS D VT
Sbjct: 303 NHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVT 362

Query: 317 LEDIRTIDRNRQPPDEGLMCELLWSDPQIPNGRAPSKRGVGVHFGPDVTKAFLERNKLEY 376
           L+DIR I+RNRQPPD G MC+LLWSDPQ  NGR+ SKRGV   FGPDVTKAFLE N+L+Y
Sbjct: 363 LDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSVSKRGVSCQFGPDVTKAFLEENQLDY 422

Query: 377 IIRSHEVKQDGYEVAHDGRCITVFSAPNYCDSVGNKGAFITMKGKDMVPHFTTYEAV 433
           IIRSHEVK +GYEVAH GRC+TVFSAPNYCD +GNK ++I ++G D+ P F  + AV
Sbjct: 423 IIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAV 479
May play a role in the regulation of RNA biogenesis and/or mitosis.
Rattus norvegicus (taxid: 10116)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6
>sp|Q60676|PPP5_MOUSE Serine/threonine-protein phosphatase 5 OS=Mus musculus GN=Ppp5c PE=2 SV=2 Back     alignment and function description
>sp|P53041|PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=Homo sapiens GN=PPP5C PE=1 SV=1 Back     alignment and function description
>sp|O43049|PPT1_SCHPO Serine/threonine-protein phosphatase T OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppt1 PE=3 SV=2 Back     alignment and function description
>sp|Q84K11|PPP5_SOLLC Serine/threonine-protein phosphatase 5 OS=Solanum lycopersicum GN=PP5 PE=1 SV=1 Back     alignment and function description
>sp|Q84XU2|PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana GN=PAPP5 PE=1 SV=1 Back     alignment and function description
>sp|P53043|PPT1_YEAST Serine/threonine-protein phosphatase T OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPT1 PE=1 SV=1 Back     alignment and function description
>sp|P40421|RDGC_DROME Serine/threonine-protein phosphatase rdgC OS=Drosophila melanogaster GN=rdgC PE=2 SV=1 Back     alignment and function description
>sp|P32598|PP12_YEAST Serine/threonine-protein phosphatase PP1-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLC7 PE=1 SV=1 Back     alignment and function description
>sp|Q3SWT6|PPE1_RAT Serine/threonine-protein phosphatase with EF-hands 1 OS=Rattus norvegicus GN=Ppef1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query546
156552647490 PREDICTED: serine/threonine-protein phos 0.785 0.875 0.674 0.0
328788255 793 PREDICTED: serine/threonine-protein phos 0.745 0.513 0.673 0.0
350423026 1277 PREDICTED: hypothetical protein LOC10074 0.747 0.319 0.674 0.0
380025782 694 PREDICTED: serine/threonine-protein phos 0.745 0.586 0.673 0.0
340727441 1328 PREDICTED: hypothetical protein LOC10064 0.747 0.307 0.672 0.0
383847785493 PREDICTED: serine/threonine-protein phos 0.780 0.864 0.658 0.0
91086913489 PREDICTED: similar to protein phosphatas 0.756 0.844 0.670 0.0
242009996493 serine/threonine-protein phosphatase PP- 0.760 0.841 0.669 0.0
427779545488 Putative protein phosphatase 2a logues [ 0.739 0.827 0.695 1e-179
427789353502 Putative protein phosphatase 2a logues [ 0.739 0.804 0.673 1e-178
>gi|156552647|ref|XP_001603324.1| PREDICTED: serine/threonine-protein phosphatase 5-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/483 (67%), Positives = 366/483 (75%), Gaps = 54/483 (11%)

Query: 24  PKEVSVEDKERAEKLKAEANEHFKNQAYNKAIELYSAAIEVNPT-AIYYANRSFAYLKTE 82
           P+  S ED   AEK K +ANE FKNQ Y++A+ LY+ AI++NP+ AIYY NRSFA+LKTE
Sbjct: 9   PRVPSPEDIAEAEKYKEKANEFFKNQNYDEAVALYTKAIDLNPSVAIYYGNRSFAFLKTE 68

Query: 83  AIGYALNDASKAIELDQTYTKAYYRRAAAYMSLGKFKLALRDYEAVHKARPNDKDAKAKF 142
             GYAL DASKAIELD+ Y K YYRRAAA MSLGKFKLAL+DYEAV KARPNDKDAKAKF
Sbjct: 69  CFGYALRDASKAIELDRNYLKGYYRRAAANMSLGKFKLALKDYEAVMKARPNDKDAKAKF 128

Query: 143 TECNKIVKRMQIK----------------------------------------------- 155
           TECNKIVK++  +                                               
Sbjct: 129 TECNKIVKKLAFEKAIAVEENKKSIADSINLEAMTIEDEYSGPKLEDDKVTLKFMQDLID 188

Query: 156 -----GKLHRKYAYRILMDIKALFMTQDSLVHITVEDEAKFTVCGDIHGQFYDLMNIFEL 210
                 KLHRKYAY+IL+DIK LFM Q SLV ITV DE KFT+CGDIHGQ+YDL+NIFEL
Sbjct: 189 WYKKENKLHRKYAYKILLDIKTLFMAQPSLVDITVPDENKFTICGDIHGQYYDLLNIFEL 248

Query: 211 NGLPSPDNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARGNHESAYMNQIYGFE 270
           NGLPS  NPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFM+RGNHESA MN +YGFE
Sbjct: 249 NGLPSESNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMSRGNHESATMNHMYGFE 308

Query: 271 GEVKSKYTDLMAQFFTEVYNWLPLCHCINNKVLVMHGGLFSSDNVTLEDIRTIDRNRQPP 330
           GEVK+KYT  MA+ FTEVYNWLPL HCIN +VLVMHGGLFS DNVTL++IR IDRNRQPP
Sbjct: 309 GEVKTKYTAQMAELFTEVYNWLPLAHCINKRVLVMHGGLFSRDNVTLKEIREIDRNRQPP 368

Query: 331 DEGLMCELLWSDPQIPNGRAPSKRGVGVHFGPDVTKAFLERNKLEYIIRSHEVKQDGYEV 390
           DEG MCELLWSDPQ   GRAPSKRGVGV FGPDVT  FL+ N L+YI+RSHEVKQDGYEV
Sbjct: 369 DEGPMCELLWSDPQPQMGRAPSKRGVGVQFGPDVTHKFLQLNNLDYIVRSHEVKQDGYEV 428

Query: 391 AHDGRCITVFSAPNYCDSVGNKGAFITMKGKDMVPHFTTYEAVGVSPPEPALENDKVTLK 450
            HDG+CITVFSAPNYCD++GN+GAFIT+KGKDM+P FT+YEAV      P    + + LK
Sbjct: 429 GHDGKCITVFSAPNYCDTMGNQGAFITLKGKDMIPKFTSYEAVPHPNVRPMAYANSL-LK 487

Query: 451 FMT 453
           FM+
Sbjct: 488 FMS 490

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328788255|ref|XP_624242.2| PREDICTED: serine/threonine-protein phosphatase 5 [Apis mellifera] Back     alignment and taxonomy information
>gi|350423026|ref|XP_003493363.1| PREDICTED: hypothetical protein LOC100749970 [Bombus impatiens] Back     alignment and taxonomy information
>gi|380025782|ref|XP_003696647.1| PREDICTED: serine/threonine-protein phosphatase 5-like [Apis florea] Back     alignment and taxonomy information
>gi|340727441|ref|XP_003402052.1| PREDICTED: hypothetical protein LOC100645178 [Bombus terrestris] Back     alignment and taxonomy information
>gi|383847785|ref|XP_003699533.1| PREDICTED: serine/threonine-protein phosphatase 5-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|91086913|ref|XP_971407.1| PREDICTED: similar to protein phosphatase-5 [Tribolium castaneum] gi|270009672|gb|EFA06120.1| hypothetical protein TcasGA2_TC008963 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242009996|ref|XP_002425763.1| serine/threonine-protein phosphatase PP-V, putative [Pediculus humanus corporis] gi|212509689|gb|EEB13025.1| serine/threonine-protein phosphatase PP-V, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|427779545|gb|JAA55224.1| Putative protein phosphatase 2a logues [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427789353|gb|JAA60128.1| Putative protein phosphatase 2a logues [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query546
ZFIN|ZDB-GENE-050327-75481 zgc:110801 "zgc:110801" [Danio 0.584 0.663 0.620 5.5e-143
WB|WBGene00012665496 pph-5 [Caenorhabditis elegans 0.534 0.588 0.638 1e-141
TAIR|locus:2052345538 PP5.2 "protein phosphatase 5.2 0.556 0.565 0.592 1.5e-123
FB|FBgn0005777520 PpD3 "Protein phosphatase D3" 0.551 0.578 0.677 8.2e-115
UNIPROTKB|A8MU39371 PPP5C "Serine/threonine-protei 0.534 0.787 0.634 6.1e-114
UNIPROTKB|H0YDU8485 PPP5C "Serine/threonine-protei 0.553 0.622 0.645 3e-108
RGD|68415499 Ppp5c "protein phosphatase 5, 0.586 0.641 0.623 3.9e-108
MGI|MGI:102666499 Ppp5c "protein phosphatase 5, 0.586 0.641 0.623 3.9e-108
UNIPROTKB|F1N719499 PPP5C "Serine/threonine-protei 0.551 0.603 0.647 3.9e-108
UNIPROTKB|F1PV61393 PPP5C "Serine/threonine-protei 0.551 0.765 0.647 6.3e-108
ZFIN|ZDB-GENE-050327-75 zgc:110801 "zgc:110801" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 1079 (384.9 bits), Expect = 5.5e-143, Sum P(2) = 5.5e-143
 Identities = 203/327 (62%), Positives = 244/327 (74%)

Query:   131 ARPNDKDAKAKFTECNKIVKRMQIKGKLHRKYAYRILMDIKALFMTQDSLVHITVEDEAK 190
             A P  +D K        ++   + + KLHRK AY+IL+ +K +     SLV IT+++  K
Sbjct:   159 AGPKLEDGKVTLKFMEDLMDWFKDQKKLHRKCAYQILVQVKEVLTKLPSLVEITLKESEK 218

Query:   191 FTVCGDIHGQFYDLMNIFELNGLPSPDNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNH 250
              T+CGD HGQ+YDL+NIFELN LPSP NPYLFNGDFVDRGSFSVE I TLFGFKLLYP H
Sbjct:   219 ITICGDTHGQYYDLLNIFELNSLPSPTNPYLFNGDFVDRGSFSVEVILTLFGFKLLYPEH 278

Query:   251 FFMARGNHESAYMNQIYGFEGEVKSKYTDLMAQFFTEVYNWLPLCHCINNKVLVMHGGLF 310
             F + RGNHE+  MNQ+YGFEGEVK+KY+  M + F+EV+ WLPL  CIN+KVLVMHGGLF
Sbjct:   279 FHLLRGNHETDNMNQMYGFEGEVKAKYSSQMFKLFSEVFQWLPLAQCINDKVLVMHGGLF 338

Query:   311 SSDNVTLEDIRTIDRNRQPPDEGLMCELLWSDPQIPNGRAPSKRGVGVHFGPDVTKAFLE 370
             S D VTL+DIR IDRNRQPPD G MC+LLWSDPQ+ NGR+ SKRGV   FGPDVT+ FLE
Sbjct:   339 SEDGVTLDDIRKIDRNRQPPDSGPMCDLLWSDPQLQNGRSISKRGVSCQFGPDVTERFLE 398

Query:   371 RNKLEYIIRSHEVKQDGYEVAHDGRCITVFSAPNYCDSVGNKGAFITMKGKDMVPHFTTY 430
             +NKLEYI+RSHEVK +GYEV H G+CITVFSAPNYCD +GNKGA+I ++G D+ P F  +
Sbjct:   399 QNKLEYIVRSHEVKAEGYEVTHSGKCITVFSAPNYCDQMGNKGAYIHLRGSDLKPEFHQF 458

Query:   431 EAVGVSPPEPALENDKVTLKFMTDLMQ 457
              AV    P P   N K  + +   LMQ
Sbjct:   459 TAV----PHP---NVK-PMAYANSLMQ 477
GO:0016787 "hydrolase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0004721 "phosphoprotein phosphatase activity" evidence=IEA
GO:0006470 "protein dephosphorylation" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
WB|WBGene00012665 pph-5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TAIR|locus:2052345 PP5.2 "protein phosphatase 5.2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0005777 PpD3 "Protein phosphatase D3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|A8MU39 PPP5C "Serine/threonine-protein phosphatase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YDU8 PPP5C "Serine/threonine-protein phosphatase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|68415 Ppp5c "protein phosphatase 5, catalytic subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:102666 Ppp5c "protein phosphatase 5, catalytic subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1N719 PPP5C "Serine/threonine-protein phosphatase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PV61 PPP5C "Serine/threonine-protein phosphatase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P53042PPP5_RAT3, ., 1, ., 3, ., 1, 60.57440.77470.8476yesN/A
P53043PPT1_YEAST3, ., 1, ., 3, ., 1, 60.44860.60430.6432yesN/A
P53041PPP5_HUMAN3, ., 1, ., 3, ., 1, 60.59470.73440.8036yesN/A
Q60676PPP5_MOUSE3, ., 1, ., 3, ., 1, 60.59470.73440.8036yesN/A
O43049PPT1_SCHPO3, ., 1, ., 3, ., 1, 60.47570.73260.8456yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3.160.914
3rd Layer3.1.30.921
3rd Layer3.6.1.13LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query546
cd07417316 cd07417, MPP_PP5_C, PP5, C-terminal metallophospha 0.0
smart00156271 smart00156, PP2Ac, Protein phosphatase 2A homologu 1e-125
cd07420321 cd07420, MPP_RdgC, Drosophila melanogaster RdgC an 1e-95
cd07415285 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phos 2e-93
cd07416305 cd07416, MPP_PP2B, PP2B, metallophosphatase domain 2e-83
cd07414293 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-li 1e-80
PTZ00244294 PTZ00244, PTZ00244, serine/threonine-protein phosp 8e-70
cd07418377 cd07418, MPP_PP7, PP7, metallophosphatase domain 3e-69
PTZ00480320 PTZ00480, PTZ00480, serine/threonine-protein phosp 5e-69
cd00144225 cd00144, MPP_PPP_family, phosphoprotein phosphatas 3e-68
PTZ00239303 PTZ00239, PTZ00239, serine/threonine protein phosp 1e-64
cd07419311 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 pho 7e-63
cd07417 316 cd07417, MPP_PP5_C, PP5, C-terminal metallophospha 3e-31
pfam00149185 pfam00149, Metallophos, Calcineurin-like phosphoes 9e-26
COG0639155 COG0639, ApaH, Diadenosine tetraphosphatase and re 6e-21
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 3e-18
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-18
PLN03088356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 8e-16
smart00156 271 smart00156, PP2Ac, Protein phosphatase 2A homologu 7e-12
pfam0832195 pfam08321, PPP5, PPP5 TPR repeat region 4e-11
cd07416 305 cd07416, MPP_PP2B, PP2B, metallophosphatase domain 3e-10
pfam1341469 pfam13414, TPR_11, TPR repeat 6e-10
cd07424207 cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophos 5e-09
cd07420 321 cd07420, MPP_RdgC, Drosophila melanogaster RdgC an 3e-07
cd07415 285 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phos 4e-07
cd00838131 cd00838, MPP_superfamily, metallophosphatase super 7e-07
cd07425208 cd07425, MPP_Shelphs, Shewanella-like phosphatases 1e-06
cd07414 293 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-li 3e-06
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 3e-06
PTZ00244 294 PTZ00244, PTZ00244, serine/threonine-protein phosp 5e-06
cd00144 225 cd00144, MPP_PPP_family, phosphoprotein phosphatas 2e-05
cd07419 311 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 pho 3e-05
pfam00149185 pfam00149, Metallophos, Calcineurin-like phosphoes 8e-05
cd07418 377 cd07418, MPP_PP7, PP7, metallophosphatase domain 1e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 1e-04
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 2e-04
PTZ00480 320 PTZ00480, PTZ00480, serine/threonine-protein phosp 3e-04
smart0002834 smart00028, TPR, Tetratricopeptide repeats 4e-04
TIGR03302235 TIGR03302, OM_YfiO, outer membrane assembly lipopr 4e-04
PRK13625245 PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphospha 7e-04
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.001
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.001
PRK11439218 PRK11439, pphA, serine/threonine protein phosphata 0.001
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 0.002
>gnl|CDD|163660 cd07417, MPP_PP5_C, PP5, C-terminal metallophosphatase domain Back     alignment and domain information 
 Score =  567 bits (1463), Expect = 0.0
 Identities = 204/303 (67%), Positives = 237/303 (78%), Gaps = 2/303 (0%)

Query: 131 ARPNDKDAKAKFTECNKIVKRMQIKGKLHRKYAYRILMDIKALFMTQDSLVHITVEDEAK 190
            R  D+    +F +  ++++  + + KLH+KYAY+IL+ +K L     SLV IT+ +  K
Sbjct: 4   PRLEDEKVTLEFVK--EMIEWFKDQKKLHKKYAYQILLQVKELLKKLPSLVEITIPEGEK 61

Query: 191 FTVCGDIHGQFYDLMNIFELNGLPSPDNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNH 250
            TVCGD HGQFYDL+NIFELNGLPS  NPYLFNGDFVDRGSFSVE I TLF FKLLYPNH
Sbjct: 62  ITVCGDTHGQFYDLLNIFELNGLPSETNPYLFNGDFVDRGSFSVEVILTLFAFKLLYPNH 121

Query: 251 FFMARGNHESAYMNQIYGFEGEVKSKYTDLMAQFFTEVYNWLPLCHCINNKVLVMHGGLF 310
           F + RGNHE+  MN++YGFEGEVK+KY + M   F+EV+NWLPL H IN KVLV+HGGLF
Sbjct: 122 FHLNRGNHETDNMNKMYGFEGEVKAKYNEQMFDLFSEVFNWLPLAHLINGKVLVVHGGLF 181

Query: 311 SSDNVTLEDIRTIDRNRQPPDEGLMCELLWSDPQIPNGRAPSKRGVGVHFGPDVTKAFLE 370
           S D VTL+DIR IDR RQPPD GLMCELLWSDPQ   GR+PSKRGVG  FGPDVTK FLE
Sbjct: 182 SDDGVTLDDIRKIDRFRQPPDSGLMCELLWSDPQPQPGRSPSKRGVGCQFGPDVTKRFLE 241

Query: 371 RNKLEYIIRSHEVKQDGYEVAHDGRCITVFSAPNYCDSVGNKGAFITMKGKDMVPHFTTY 430
            N LEYIIRSHEVK +GYEV HDG+CITVFSAPNYCD +GNKGAFI + G D+ P FT +
Sbjct: 242 ENNLEYIIRSHEVKDEGYEVEHDGKCITVFSAPNYCDQMGNKGAFIRITGSDLKPKFTQF 301

Query: 431 EAV 433
           EAV
Sbjct: 302 EAV 304

Serine/threonine protein phosphatase-5 (PP5) is a member of the PPP gene family of protein phosphatases that is highly conserved among eukaryotes and widely expressed in mammalian tissues. PP5 has a C-terminal phosphatase domain and an extended N-terminal TPR (tetratricopeptide repeat) domain containing three TPR motifs. The PPP (phosphoprotein phosphatase) family, to which PP5 belongs, is one of two known protein phosphatase families specific for serine and threonine. The PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 316
>gnl|CDD|197547 smart00156, PP2Ac, Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>gnl|CDD|163663 cd07420, MPP_RdgC, Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163658 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163659 cd07416, MPP_PP2B, PP2B, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163657 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|140271 PTZ00244, PTZ00244, serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>gnl|CDD|163661 cd07418, MPP_PP7, PP7, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|185658 PTZ00480, PTZ00480, serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|163613 cd00144, MPP_PPP_family, phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|173488 PTZ00239, PTZ00239, serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>gnl|CDD|163662 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163660 cd07417, MPP_PP5_C, PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase Back     alignment and domain information
>gnl|CDD|223712 COG0639, ApaH, Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|197547 smart00156, PP2Ac, Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>gnl|CDD|149395 pfam08321, PPP5, PPP5 TPR repeat region Back     alignment and domain information
>gnl|CDD|163659 cd07416, MPP_PP2B, PP2B, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|163667 cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163663 cd07420, MPP_RdgC, Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163658 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163614 cd00838, MPP_superfamily, metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163668 cd07425, MPP_Shelphs, Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163657 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|140271 PTZ00244, PTZ00244, serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>gnl|CDD|163613 cd00144, MPP_PPP_family, phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163662 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase Back     alignment and domain information
>gnl|CDD|163661 cd07418, MPP_PP7, PP7, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|185658 PTZ00480, PTZ00480, serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|234164 TIGR03302, OM_YfiO, outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>gnl|CDD|184187 PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|236911 PRK11439, pphA, serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 546
KOG0372|consensus303 100.0
KOG0376|consensus476 100.0
KOG0373|consensus306 100.0
cd07417316 MPP_PP5_C PP5, C-terminal metallophosphatase domai 100.0
cd07420321 MPP_RdgC Drosophila melanogaster RdgC and related 100.0
cd07415285 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein 100.0
PTZ00480320 serine/threonine-protein phosphatase; Provisional 100.0
cd07416305 MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca 100.0
PTZ00239303 serine/threonine protein phosphatase 2A; Provision 100.0
KOG0374|consensus331 100.0
PTZ00244294 serine/threonine-protein phosphatase PP1; Provisio 100.0
cd07414293 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme 100.0
cd07418377 MPP_PP7 PP7, metallophosphatase domain. PP7 is a p 100.0
smart00156271 PP2Ac Protein phosphatase 2A homologues, catalytic 100.0
KOG0375|consensus517 100.0
cd07419311 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a 100.0
KOG0371|consensus319 100.0
KOG0377|consensus631 100.0
cd00144225 MPP_PPP_family phosphoprotein phosphatases of the 99.97
KOG0372|consensus 303 99.95
KOG0373|consensus 306 99.94
KOG0371|consensus 319 99.9
KOG0374|consensus 331 99.89
KOG0375|consensus 517 99.88
cd07425208 MPP_Shelphs Shewanella-like phosphatases, metallop 99.88
PRK13625245 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision 99.85
KOG0376|consensus 476 99.83
cd07413222 MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat 99.82
cd07422257 MPP_ApaH Escherichia coli ApaH and related protein 99.82
PRK00166275 apaH diadenosine tetraphosphatase; Reviewed 99.82
cd07420 321 MPP_RdgC Drosophila melanogaster RdgC and related 99.8
cd07423234 MPP_PrpE Bacillus subtilis PrpE and related protei 99.8
PRK11439218 pphA serine/threonine protein phosphatase 1; Provi 99.8
TIGR00668279 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric 99.8
KOG0553|consensus304 99.79
cd07424207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 99.78
PHA02239235 putative protein phosphatase 99.78
cd07421304 MPP_Rhilphs Rhilph phosphatases, metallophosphatas 99.77
KOG0377|consensus 631 99.76
PRK09968218 serine/threonine-specific protein phosphatase 2; P 99.73
PTZ00480 320 serine/threonine-protein phosphatase; Provisional 99.73
PTZ00244 294 serine/threonine-protein phosphatase PP1; Provisio 99.73
cd07417 316 MPP_PP5_C PP5, C-terminal metallophosphatase domai 99.72
cd07416 305 MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca 99.72
PTZ00239 303 serine/threonine protein phosphatase 2A; Provision 99.72
cd07415 285 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein 99.72
cd07414 293 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme 99.71
smart00156 271 PP2Ac Protein phosphatase 2A homologues, catalytic 99.68
cd07418 377 MPP_PP7 PP7, metallophosphatase domain. PP7 is a p 99.68
cd07419 311 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a 99.65
KOG4626|consensus 966 99.65
KOG1126|consensus638 99.6
PRK15359144 type III secretion system chaperone protein SscB; 99.59
KOG0548|consensus539 99.56
KOG4626|consensus 966 99.53
KOG4234|consensus271 99.49
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.48
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.46
KOG0543|consensus397 99.46
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.46
KOG0548|consensus539 99.45
PRK11189296 lipoprotein NlpI; Provisional 99.45
KOG0624|consensus504 99.45
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.44
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.44
KOG0547|consensus606 99.42
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.42
KOG0550|consensus486 99.41
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.41
KOG4648|consensus536 99.39
KOG1155|consensus559 99.37
PRK10370198 formate-dependent nitrite reductase complex subuni 99.36
PRK12370553 invasion protein regulator; Provisional 99.36
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.29
KOG1126|consensus638 99.29
KOG1155|consensus559 99.28
KOG0547|consensus606 99.28
PRK12370553 invasion protein regulator; Provisional 99.28
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.27
PRK15359144 type III secretion system chaperone protein SscB; 99.26
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.23
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.22
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.2
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.2
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.19
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.18
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.18
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.17
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.17
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.16
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.15
PRK10370198 formate-dependent nitrite reductase complex subuni 99.15
KOG0545|consensus329 99.14
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.14
PRK13625 245 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision 99.13
PLN02789320 farnesyltranstransferase 99.12
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.12
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.11
KOG2003|consensus840 99.11
PRK11788389 tetratricopeptide repeat protein; Provisional 99.11
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.09
PRK11189296 lipoprotein NlpI; Provisional 99.08
KOG1125|consensus579 99.08
KOG4642|consensus284 99.08
cd07421 304 MPP_Rhilphs Rhilph phosphatases, metallophosphatas 99.08
PRK15331165 chaperone protein SicA; Provisional 99.07
cd07413 222 MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat 99.07
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.07
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.06
KOG0551|consensus390 99.06
PLN02789320 farnesyltranstransferase 99.05
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.04
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.02
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.01
PRK11788389 tetratricopeptide repeat protein; Provisional 99.0
cd00144 225 MPP_PPP_family phosphoprotein phosphatases of the 99.0
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.99
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.98
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.98
KOG0624|consensus504 98.96
PRK10803263 tol-pal system protein YbgF; Provisional 98.95
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.95
PF00149200 Metallophos: Calcineurin-like phosphoesterase; Int 98.94
KOG2076|consensus 895 98.91
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.9
KOG1125|consensus579 98.89
KOG0550|consensus486 98.89
cd07423 234 MPP_PrpE Bacillus subtilis PrpE and related protei 98.89
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.88
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.88
cd07422 257 MPP_ApaH Escherichia coli ApaH and related protein 98.87
KOG2002|consensus 1018 98.83
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.82
PF13512142 TPR_18: Tetratricopeptide repeat 98.82
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.82
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 98.81
PRK14574 822 hmsH outer membrane protein; Provisional 98.81
KOG2002|consensus 1018 98.8
COG0639155 ApaH Diadenosine tetraphosphatase and related seri 98.79
TIGR00668 279 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric 98.78
KOG0553|consensus304 98.78
KOG1173|consensus611 98.77
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.77
PRK10049765 pgaA outer membrane protein PgaA; Provisional 98.76
KOG4555|consensus175 98.76
PRK11439 218 pphA serine/threonine protein phosphatase 1; Provi 98.75
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.74
cd07425 208 MPP_Shelphs Shewanella-like phosphatases, metallop 98.74
KOG1129|consensus478 98.74
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.73
PHA02239 235 putative protein phosphatase 98.73
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.73
KOG1173|consensus611 98.72
PF1337173 TPR_9: Tetratricopeptide repeat 98.71
KOG4162|consensus799 98.71
PRK00166 275 apaH diadenosine tetraphosphatase; Reviewed 98.7
PF12688120 TPR_5: Tetratrico peptide repeat 98.68
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.67
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.66
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.66
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.65
cd00841155 MPP_YfcE Escherichia coli YfcE and related protein 98.64
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.63
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.63
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.61
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.61
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.6
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.6
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.6
KOG2003|consensus840 98.59
PF1337173 TPR_9: Tetratricopeptide repeat 98.58
KOG1128|consensus777 98.58
KOG1840|consensus508 98.56
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.55
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.54
PRK09968 218 serine/threonine-specific protein phosphatase 2; P 98.54
KOG3060|consensus289 98.53
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.52
KOG1308|consensus377 98.52
TIGR00040158 yfcE phosphoesterase, MJ0936 family. Members of th 98.51
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.49
KOG1174|consensus564 98.48
KOG2076|consensus 895 98.48
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.47
PF12850156 Metallophos_2: Calcineurin-like phosphoesterase su 98.47
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.45
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.45
KOG4162|consensus799 98.43
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.42
PRK11906458 transcriptional regulator; Provisional 98.42
PRK11906458 transcriptional regulator; Provisional 98.41
KOG1840|consensus508 98.41
KOG1156|consensus 700 98.41
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.4
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.4
KOG0543|consensus397 98.4
PRK14574 822 hmsH outer membrane protein; Provisional 98.39
KOG3060|consensus289 98.39
KOG1128|consensus777 98.37
cd07424 207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 98.37
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.37
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.35
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.34
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.34
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.34
cd07379135 MPP_239FB Homo sapiens 239FB and related proteins, 98.33
KOG1156|consensus 700 98.32
PRK09453182 phosphodiesterase; Provisional 98.31
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.29
KOG1129|consensus478 98.29
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.28
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.26
KOG1174|consensus564 98.25
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.24
PRK15331165 chaperone protein SicA; Provisional 98.23
cd07397238 MPP_DevT Myxococcus xanthus DevT and related prote 98.21
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.14
cd07394178 MPP_Vps29 Homo sapiens Vps29 and related proteins, 98.1
KOG0495|consensus913 98.09
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.09
cd07388224 MPP_Tt1561 Thermus thermophilus Tt1561 and related 98.08
PRK10803263 tol-pal system protein YbgF; Provisional 98.08
PF12688120 TPR_5: Tetratrico peptide repeat 98.03
PRK05340241 UDP-2,3-diacylglucosamine hydrolase; Provisional 98.01
PF1343134 TPR_17: Tetratricopeptide repeat 98.0
KOG1127|consensus 1238 97.99
cd00838131 MPP_superfamily metallophosphatase superfamily, me 97.99
PF1342844 TPR_14: Tetratricopeptide repeat 97.97
KOG1310|consensus758 97.96
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.94
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.93
KOG4648|consensus536 97.93
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.92
KOG1127|consensus 1238 97.91
cd07404166 MPP_MS158 Microscilla MS158 and related proteins, 97.91
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.89
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.84
PF13512142 TPR_18: Tetratricopeptide repeat 97.83
cd07399214 MPP_YvnB Bacillus subtilis YvnB and related protei 97.82
KOG3785|consensus557 97.81
KOG3785|consensus557 97.81
KOG4234|consensus271 97.8
PF1342844 TPR_14: Tetratricopeptide repeat 97.8
TIGR01854231 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. 97.79
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 97.77
KOG1130|consensus639 97.77
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.76
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.75
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.7
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.7
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.65
cd07392188 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel 97.64
cd07403129 MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel 97.64
PF0832195 PPP5: PPP5 TPR repeat region; InterPro: IPR013235 97.64
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.63
KOG4642|consensus284 97.63
PF1343134 TPR_17: Tetratricopeptide repeat 97.6
cd07400144 MPP_YydB Bacillus subtilis YydB and related protei 97.55
KOG4555|consensus175 97.53
COG4700251 Uncharacterized protein conserved in bacteria cont 97.53
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.52
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.51
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 97.5
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.49
KOG0495|consensus913 97.47
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.45
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.43
KOG1941|consensus518 97.39
PLN032181060 maturation of RBCL 1; Provisional 97.39
COG0622172 Predicted phosphoesterase [General function predic 97.37
PLN03077857 Protein ECB2; Provisional 97.35
PLN032181060 maturation of RBCL 1; Provisional 97.31
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.28
PF06874640 FBPase_2: Firmicute fructose-1,6-bisphosphatase; I 97.25
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.25
KOG2796|consensus366 97.2
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.18
COG4700251 Uncharacterized protein conserved in bacteria cont 97.18
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.14
cd07395262 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, 97.13
KOG2796|consensus366 97.11
KOG1130|consensus639 97.1
KOG2376|consensus652 97.1
KOG2376|consensus 652 97.07
PRK11340271 phosphodiesterase YaeI; Provisional 97.04
KOG3824|consensus472 97.03
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.0
KOG2471|consensus696 96.99
PLN03077857 Protein ECB2; Provisional 96.99
KOG0546|consensus372 96.99
cd07383199 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase 96.97
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 96.95
KOG4340|consensus459 96.91
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.9
PRK10941269 hypothetical protein; Provisional 96.88
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.87
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.85
KOG4340|consensus459 96.82
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.8
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.8
KOG2053|consensus 932 96.75
cd07385223 MPP_YkuE_C Bacillus subtilis YkuE and related prot 96.74
PF00149 200 Metallophos: Calcineurin-like phosphoesterase; Int 96.71
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.7
KOG4507|consensus886 96.66
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 96.66
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 96.62
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 96.6
cd07398217 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat 96.58
cd07390168 MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro 96.56
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.56
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.53
KOG0551|consensus390 96.52
PRK04036504 DNA polymerase II small subunit; Validated 96.5
cd07384171 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re 96.44
COG2908237 Uncharacterized protein conserved in bacteria [Fun 96.32
COG4976287 Predicted methyltransferase (contains TPR repeat) 96.32
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.29
cd08163257 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related 96.27
cd07391172 MPP_PF1019 Pyrococcus furiosus PF1019 and related 96.24
KOG0545|consensus329 96.15
TIGR03729239 acc_ester putative phosphoesterase. Members of thi 96.14
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.14
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.13
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.11
KOG3824|consensus472 96.09
TIGR00024225 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 96.02
PRK04841903 transcriptional regulator MalT; Provisional 96.0
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.0
KOG1586|consensus288 96.0
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.96
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.94
TIGR00619253 sbcd exonuclease SbcD. This family is based on the 95.91
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.9
PRK09453182 phosphodiesterase; Provisional 95.89
PRK04841903 transcriptional regulator MalT; Provisional 95.88
KOG1308|consensus377 95.86
cd07396267 MPP_Nbla03831 Homo sapiens Nbla03831 and related p 95.82
KOG4507|consensus 886 95.8
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.77
cd07402240 MPP_GpdQ Enterobacter aerogenes GpdQ and related p 95.75
PRK11148275 cyclic 3',5'-adenosine monophosphate phosphodieste 95.74
KOG4814|consensus872 95.72
PRK10941269 hypothetical protein; Provisional 95.69
KOG3081|consensus299 95.6
KOG3081|consensus299 95.59
PHA02546340 47 endonuclease subunit; Provisional 95.58
cd08165156 MPP_MPPE1 human MPPE1 and related proteins, metall 95.54
cd00844262 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t 95.53
KOG1585|consensus308 95.52
KOG3364|consensus149 95.48
KOG2471|consensus696 95.43
KOG2610|consensus491 95.43
cd08166195 MPP_Cdc1_like_1 uncharacterized subgroup related t 95.42
KOG2610|consensus491 95.26
cd00840223 MPP_Mre11_N Mre11 nuclease, N-terminal metallophos 95.24
KOG1915|consensus677 95.17
KOG2053|consensus 932 95.16
KOG0530|consensus318 95.05
cd00838131 MPP_superfamily metallophosphatase superfamily, me 95.05
KOG1941|consensus518 95.03
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.02
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 95.02
KOG1915|consensus677 95.0
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 94.98
COG2129226 Predicted phosphoesterases, related to the Icc pro 94.81
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.76
KOG1070|consensus1710 94.76
cd07393232 MPP_DR1119 Deinococcus radiodurans DR1119 and rela 94.71
cd08164193 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related 94.55
COG2912269 Uncharacterized conserved protein [Function unknow 94.45
KOG1586|consensus288 94.36
KOG4151|consensus 748 94.34
cd00841155 MPP_YfcE Escherichia coli YfcE and related protein 94.24
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.11
PRK10966407 exonuclease subunit SbcD; Provisional 94.08
COG1409301 Icc Predicted phosphohydrolases [General function 94.05
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.04
KOG3364|consensus149 94.03
TIGR00583405 mre11 DNA repair protein (mre11). All proteins in 94.0
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.82
PF09986214 DUF2225: Uncharacterized protein conserved in bact 93.77
COG1407235 Predicted ICC-like phosphoesterases [General funct 93.61
COG3898531 Uncharacterized membrane-bound protein [Function u 93.58
COG4976287 Predicted methyltransferase (contains TPR repeat) 93.52
COG3118304 Thioredoxin domain-containing protein [Posttransla 93.5
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 93.38
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 93.31
COG4186186 Predicted phosphoesterase or phosphohydrolase [Gen 93.23
cd07380150 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re 93.16
KOG3662|consensus410 93.16
cd00839294 MPP_PAPs purple acid phosphatases of the metalloph 93.15
cd07401256 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal 93.15
cd07385 223 MPP_YkuE_C Bacillus subtilis YkuE and related prot 93.08
KOG1070|consensus1710 93.0
KOG1585|consensus308 92.97
COG1408284 Predicted phosphohydrolases [General function pred 92.94
KOG2396|consensus568 92.91
cd07386243 MPP_DNA_pol_II_small_archeal_C archeal DNA polymer 92.88
cd07388 224 MPP_Tt1561 Thermus thermophilus Tt1561 and related 92.83
KOG1550|consensus552 92.75
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 92.68
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 92.65
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 92.64
KOG0529|consensus421 92.59
PF13281374 DUF4071: Domain of unknown function (DUF4071) 92.39
cd07379135 MPP_239FB Homo sapiens 239FB and related proteins, 91.96
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 91.92
PF12850156 Metallophos_2: Calcineurin-like phosphoesterase su 91.84
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.68
PF1286294 Apc5: Anaphase-promoting complex subunit 5 91.45
PF1286294 Apc5: Anaphase-promoting complex subunit 5 91.41
cd07391172 MPP_PF1019 Pyrococcus furiosus PF1019 and related 91.37
cd07397 238 MPP_DevT Myxococcus xanthus DevT and related prote 91.09
KOG2047|consensus835 90.99
cd08165156 MPP_MPPE1 human MPPE1 and related proteins, metall 90.79
cd07392 188 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel 90.69
COG2912269 Uncharacterized conserved protein [Function unknow 90.66
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 90.66
cd00845252 MPP_UshA_N_like Escherichia coli UshA-like family, 90.58
cd07384171 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re 90.14
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 90.06
cd07404166 MPP_MS158 Microscilla MS158 and related proteins, 90.05
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 90.05
COG0420390 SbcD DNA repair exonuclease [DNA replication, reco 90.03
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 90.01
PRK11340 271 phosphodiesterase YaeI; Provisional 89.94
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 89.9
COG2976207 Uncharacterized protein conserved in bacteria [Fun 89.84
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 89.82
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 89.65
COG3629280 DnrI DNA-binding transcriptional activator of the 89.47
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 89.4
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 89.28
COG3898531 Uncharacterized membrane-bound protein [Function u 89.06
KOG4814|consensus872 88.86
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 88.85
KOG1550|consensus552 88.7
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 88.63
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 88.54
PF09986214 DUF2225: Uncharacterized protein conserved in bact 88.46
KOG2041|consensus1189 88.4
PRK05340 241 UDP-2,3-diacylglucosamine hydrolase; Provisional 88.27
cd08163 257 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related 87.92
KOG3617|consensus1416 87.56
KOG3325|consensus183 87.44
cd08166195 MPP_Cdc1_like_1 uncharacterized subgroup related t 87.41
KOG2047|consensus835 87.4
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 87.39
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 86.79
TIGR00040158 yfcE phosphoesterase, MJ0936 family. Members of th 86.52
cd07400144 MPP_YydB Bacillus subtilis YydB and related protei 86.51
PF14582255 Metallophos_3: Metallophosphoesterase, calcineurin 86.47
cd07390168 MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro 86.22
TIGR03729 239 acc_ester putative phosphoesterase. Members of thi 86.07
KOG0530|consensus318 86.05
COG1311481 HYS2 Archaeal DNA polymerase II, small subunit/DNA 85.7
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 85.27
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 85.02
KOG0918|consensus 476 85.01
TIGR01854 231 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. 84.73
cd07378277 MPP_ACP5 Homo sapiens acid phosphatase 5 and relat 84.1
COG4941415 Predicted RNA polymerase sigma factor containing a 84.07
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 84.03
COG5191435 Uncharacterized conserved protein, contains HAT (H 84.01
COG3947361 Response regulator containing CheY-like receiver a 83.98
cd00840 223 MPP_Mre11_N Mre11 nuclease, N-terminal metallophos 83.93
PF13281374 DUF4071: Domain of unknown function (DUF4071) 83.61
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 83.49
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 83.42
PLN02533427 probable purple acid phosphatase 83.19
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 83.08
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 83.01
cd07399 214 MPP_YvnB Bacillus subtilis YvnB and related protei 83.01
TIGR00619 253 sbcd exonuclease SbcD. This family is based on the 83.0
KOG2300|consensus629 82.64
KOG0546|consensus372 82.39
KOG0529|consensus421 82.32
COG3629280 DnrI DNA-binding transcriptional activator of the 82.31
cd07410277 MPP_CpdB_N Escherichia coli CpdB and related prote 82.28
COG4649221 Uncharacterized protein conserved in bacteria [Fun 82.15
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 82.11
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 81.78
KOG3617|consensus1416 81.71
TIGR00024 225 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 81.48
COG5191435 Uncharacterized conserved protein, contains HAT (H 81.16
cd07396 267 MPP_Nbla03831 Homo sapiens Nbla03831 and related p 80.68
KOG3807|consensus556 80.41
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 80.24
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 80.07
>KOG0372|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.8e-74  Score=522.66  Aligned_cols=282  Identities=38%  Similarity=0.737  Sum_probs=267.9

Q ss_pred             hhhhhhhhchHHHHHHHHHHHHhhhhcCCcccccccccccccccccccchhHhhHHHHHHHhCCCCCCCCeeeecccccc
Q psy11688        150 KRMQIKGKLHRKYAYRILMDIKALFMTQDSLVHITVEDEAKFTVCGDIHGQFYDLMNIFELNGLPSPDNPYLFNGDFVDR  229 (546)
Q Consensus       150 ~~~~~~~~l~~~~~~~il~~a~eiL~~~p~~~~i~~~~~~~~~viGDihg~~~~l~~il~~~~~~~~~~~~~~lGD~vdr  229 (546)
                      ++......+.+..+..++.+++++|.+++++..+..|    +.++||+||++.|+..+|+..|.+++++ |+||||||||
T Consensus         8 e~L~~~~li~E~eV~~LC~~~~eiL~~E~NV~~i~tP----vtvcGDIHGQf~Dllelf~igG~~~~t~-YLFLGDyVDR   82 (303)
T KOG0372|consen    8 EQLRRCELIAESEVKALCAKVREILVEESNVQRIDTP----VTVCGDIHGQFYDLLELFRIGGDVPETN-YLFLGDYVDR   82 (303)
T ss_pred             HHHHhcCCCcHHHHHHHHHHHHHHHhcCCCceecCCC----cEEeecccchHHHHHHHHHhCCCCCCCc-eEeecchhcc
Confidence            3344445677889999999999999999999999988    9999999999999999999988887765 9999999999


Q ss_pred             CCChHHHHHHHhhhhhcCCCeEEEEccccccchhhhhhcchhhhhhhc-hHHHHHHHHHhhccccceeeecceEEEEeCC
Q psy11688        230 GSFSVECIFTLFGFKLLYPNHFFMARGNHESAYMNQIYGFEGEVKSKY-TDLMAQFFTEVYNWLPLCHCINNKVLVMHGG  308 (546)
Q Consensus       230 G~~~~e~l~~l~~l~~~~p~~v~~lrGNHE~~~~~~~~~~~~e~~~~~-~~~~~~~~~~~~~~lP~~~~~~~~~~~vHgG  308 (546)
                      |.+|+|++.+|+.||.+||++|.+||||||++.++..|||++||.+|| +..+|+.+.+.|+.||++|+|++++||||||
T Consensus        83 G~~SvEt~lLLl~lK~rYP~ritLiRGNHEsRqitqvYGFY~EclrKYG~~~vWr~c~eiFdyL~l~aiid~kifCVHGG  162 (303)
T KOG0372|consen   83 GYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSANVWRYCTEIFDYLSLAAIIDGKIFCVHGG  162 (303)
T ss_pred             ccchHHHHHHHHHHhhcCcceeEEeeccchhhhhhhhhhHHHHHHHHcCChHHHHHHHHHHHhhhHhheecCcEEEEcCC
Confidence            999999999999999999999999999999999999999999999999 5789999999999999999999999999999


Q ss_pred             ccCCCCCChhhhhccCCCCCCCCchhhhhhhcCCCCCCCCCCCCCCCCeeeeCHHHHHHHHHhcCCcEEEEeccccccCc
Q psy11688        309 LFSSDNVTLEDIRTIDRNRQPPDEGLMCELLWSDPQIPNGRAPSKRGVGVHFGPDVTKAFLERNKLEYIIRSHEVKQDGY  388 (546)
Q Consensus       309 i~~~~~~~~~~i~~~~r~~~~~~~~~~~dllWsdp~~~~~~~~~~rg~~~~fg~~~~~~fl~~~~~~~iir~H~~~~~G~  388 (546)
                      + ||...++++|+.++|..+.|+++.++|+|||||.+..+|..++||+|+.||.++++.||+.||+++|+|+||.+.+||
T Consensus       163 l-SP~i~~lDqIr~lDR~~Eiph~g~m~DllWSDPee~~g~~~SPRGaGylFG~dvv~~F~~~N~~~~I~RaHQLv~eGy  241 (303)
T KOG0372|consen  163 L-SPSIQTLDQIRVLDRKQEVPHDGAMCDLLWSDPEEGPGWGLSPRGAGYLFGEDVVESFLEANGLSLICRAHQLVMEGY  241 (303)
T ss_pred             C-CcchhhHHHHHHhhccccCCCCCcchheeccCcccCCCcccCCCCccccccHHHHHHHHHhCChHHHHHHHHHHHhhH
Confidence            9 999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEeCCCeEEEEeCCCCCCCCCCCceeEEEeeCCCCceeEEEEeecCCCCC
Q psy11688        389 EVAHDGRCITVFSAPNYCDSVGNKGAFITMKGKDMVPHFTTYEAVGVSPP  438 (546)
Q Consensus       389 ~~~~~~~~itifsa~~y~~~~~n~~a~~~~~~~~~~~~~~~~~~~~~~~~  438 (546)
                      ++.++++|+|||||||||+.++|.||||.| +.+....|..|++.|....
T Consensus       242 k~~F~~~v~TVWSAPNYCYrCGN~AsIl~l-de~~~~~F~vFeaa~~~~~  290 (303)
T KOG0372|consen  242 KWHFDEKVVTVWSAPNYCYRCGNVAAILEL-DEDLDKDFRVFEAAPQESR  290 (303)
T ss_pred             HHhcCCceEEEecCCchhhhcCChHHheee-ccccCcceEeeecchhhhc
Confidence            999999999999999999999999999999 6678889999999875443

>KOG0376|consensus Back     alignment and domain information
>KOG0373|consensus Back     alignment and domain information
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>PTZ00480 serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>cd07416 MPP_PP2B PP2B, metallophosphatase domain Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>KOG0374|consensus Back     alignment and domain information
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07418 MPP_PP7 PP7, metallophosphatase domain Back     alignment and domain information
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>KOG0375|consensus Back     alignment and domain information
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>KOG0371|consensus Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>KOG0372|consensus Back     alignment and domain information
>KOG0373|consensus Back     alignment and domain information
>KOG0371|consensus Back     alignment and domain information
>KOG0374|consensus Back     alignment and domain information
>KOG0375|consensus Back     alignment and domain information
>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK00166 apaH diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>PHA02239 putative protein phosphatase Back     alignment and domain information
>cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>PTZ00480 serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07416 MPP_PP2B PP2B, metallophosphatase domain Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>cd07418 MPP_PP7 PP7, metallophosphatase domain Back     alignment and domain information
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>COG0639 ApaH Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PHA02239 putative protein phosphatase Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>PRK00166 apaH diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>TIGR00040 yfcE phosphoesterase, MJ0936 family Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>PRK09453 phosphodiesterase; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF08321 PPP5: PPP5 TPR repeat region; InterPro: IPR013235 This domain is specific to the PPP5 subfamily of serine/threonine phosphatases Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>COG0622 Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06874 FBPase_2: Firmicute fructose-1,6-bisphosphatase; InterPro: IPR009164 Fructose 1,6-bisphosphatase catalyses the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate [] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG0546|consensus Back     alignment and domain information
>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG2908 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>TIGR03729 acc_ester putative phosphoesterase Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>TIGR00619 sbcd exonuclease SbcD Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK09453 phosphodiesterase; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional Back     alignment and domain information
>KOG4814|consensus Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>PHA02546 47 endonuclease subunit; Provisional Back     alignment and domain information
>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>KOG0530|consensus Back     alignment and domain information
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>KOG4151|consensus Back     alignment and domain information
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PRK10966 exonuclease subunit SbcD; Provisional Back     alignment and domain information
>COG1409 Icc Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>TIGR00583 mre11 DNA repair protein (mre11) Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG1407 Predicted ICC-like phosphoesterases [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] Back     alignment and domain information
>cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>KOG3662|consensus Back     alignment and domain information
>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>COG1408 Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>KOG2396|consensus Back     alignment and domain information
>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG1550|consensus Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG0529|consensus Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG4814|consensus Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>KOG1550|consensus Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional Back     alignment and domain information
>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG3325|consensus Back     alignment and domain information
>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain Back     alignment and domain information
>KOG2047|consensus Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>TIGR00040 yfcE phosphoesterase, MJ0936 family Back     alignment and domain information
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A Back     alignment and domain information
>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR03729 acc_ester putative phosphoesterase Back     alignment and domain information
>KOG0530|consensus Back     alignment and domain information
>COG1311 HYS2 Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG0918|consensus Back     alignment and domain information
>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase Back     alignment and domain information
>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00619 sbcd exonuclease SbcD Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>KOG0546|consensus Back     alignment and domain information
>KOG0529|consensus Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG3807|consensus Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query546
1wao_1477 Pp5 Structure Length = 477 1e-151
1wao_1 477 Pp5 Structure Length = 477 3e-19
1s95_A333 Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 1e-119
1s95_A 333 Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 3e-19
3h60_A315 Catalytic Domain Of Human SerineTHREONINE PHOSPHATA 1e-119
3h60_A 315 Catalytic Domain Of Human SerineTHREONINE PHOSPHATA 4e-19
3icf_A335 Structure Of Protein SerineTHREONINE PHOSPHATASE FR 3e-70
3icf_A 335 Structure Of Protein SerineTHREONINE PHOSPHATASE FR 3e-06
3n5u_B300 Crystal Structure Of An Rb C-Terminal Peptide Bound 2e-57
2o8a_A329 Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Leng 3e-57
1fjm_A330 Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isofor 3e-57
1jk7_A323 Crystal Structure Of The Tumor-Promoter Okadaic Aci 3e-57
4g9j_A331 Protein SerTHR PHOSPHATASE-1 In Complex With Cell-P 3e-57
3e7a_A299 Crystal Structure Of Protein Phosphatase-1 Bound To 3e-57
3v4y_A306 Crystal Structure Of The First Nuclear Pp1 Holoenzy 3e-57
3egg_A329 Crystal Structure Of A Complex Between Protein Phos 4e-57
1u32_A293 Crystal Structure Of A Protein Phosphatase-1: Calci 2e-56
1s70_A330 Complex Between Protein Ser/thr Phosphatase-1 (delt 8e-56
3p71_C304 Crystal Structure Of The Complex Of Lcmt-1 And Pp2a 6e-54
2nyl_C293 Crystal Structure Of Protein Phosphatase 2a (Pp2a) 9e-54
2ie3_C309 Structure Of The Protein Phosphatase 2a Core Enzyme 1e-53
2ie4_C309 Structure Of The Protein Phosphatase 2a Core Enzyme 1e-53
3c5w_C310 Complex Between Pp2a-Specific Methylesterase Pme-1 1e-53
3fga_C309 Structural Basis Of Pp2a And Sgo Interaction Length 4e-53
2iae_C309 Crystal Structure Of A Protein Phosphatase 2a (Pp2a 4e-53
1aui_A521 Human Calcineurin Heterodimer Length = 521 2e-51
1aui_A 521 Human Calcineurin Heterodimer Length = 521 9e-06
1m63_A372 Crystal Structure Of Calcineurin-Cyclophilin-Cyclos 3e-51
1m63_A 372 Crystal Structure Of Calcineurin-Cyclophilin-Cyclos 1e-05
3ll8_A357 Crystal Structure Of Calcineurin In Complex With Ak 4e-51
3ll8_A 357 Crystal Structure Of Calcineurin In Complex With Ak 1e-05
2p6b_A383 Crystal Structure Of Human Calcineurin In Complex W 4e-51
2p6b_A 383 Crystal Structure Of Human Calcineurin In Complex W 1e-05
1tco_A375 Ternary Complex Of A Calcineurin A Fragment, Calcin 4e-51
1tco_A 375 Ternary Complex Of A Calcineurin A Fragment, Calcin 1e-05
1mf8_A373 Crystal Structure Of Human Calcineurin Complexed Wi 4e-51
1mf8_A 373 Crystal Structure Of Human Calcineurin Complexed Wi 1e-05
2jog_A327 Structure Of The Calcineurin-Nfat Complex Length = 4e-51
2jog_A 327 Structure Of The Calcineurin-Nfat Complex Length = 2e-05
2bug_A140 Solution Structure Of The Tpr Domain From Protein P 1e-32
1a17_A166 Tetratricopeptide Repeats Of Protein Phosphatase 5 3e-32
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 3e-07
3q47_B137 Crystal Structure Of Tpr Domain Of Chip Complexed W 1e-06
2c2l_A281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 2e-06
2dba_A148 The Solution Structure Of The Tetratrico Peptide Re 1e-05
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 3e-05
1g5b_A221 Bacteriophage Lambda SerTHR PROTEIN PHOSPHATASE Len 8e-05
3sz7_A164 Crystal Structure Of The Sgt2 Tpr Domain From Asper 9e-05
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 1e-04
2gw1_A514 Crystal Structure Of The Yeast Tom70 Length = 514 9e-04
>pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 Back     alignment and structure 
Iteration: 1

 Score =  533 bits (1373), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 264/461 (57%), Positives = 316/461 (68%), Gaps = 57/461 (12%)
Query: 33  ERAEKLKAEANEHFKNQAYNKAIELYSAAIEVNPT-AIYYANRSFAYLKTEAIGYALNDA 91
           +RAE+LK +AN++FK + Y  AI+ YS AIE+NP+ AIYY NRS AYL+TE  GYAL DA
Sbjct: 4   KRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDA 63
Query: 92  SKAIELDQXXXXXXXXXXXXXMSLGKFKLALRDYEAVHKARPNDKDAKAKFTECNKIVKR 151
           ++AIELD+             M+LGKF+ ALRDYE V K +P+DKDAK K+ ECNKIVK+
Sbjct: 64  TRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQ 123
Query: 152 -------------------------------------------------MQI---KGKLH 159
                                                            MQ    + KLH
Sbjct: 124 KAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKDQKKLH 183
Query: 160 RKYAYRILMDIKALFMTQDSLVHITVEDEAKFTVCGDIHGQFYDLMNIFELNGLPSPDNP 219
           RK AY+IL+ +K +     +LV  T+++  K TVCGD HGQFYDL+NIFELNGLPS  NP
Sbjct: 184 RKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNP 243
Query: 220 YLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARGNHESAYMNQIYGFEGEVKSKYTD 279
           Y+FNGDFVDRGSFSVE I TLFGFKLLYP+HF + RGNHE+  MNQIYGFEGEVK+KYT 
Sbjct: 244 YIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTA 303
Query: 280 LMAQFFTEVYNWLPLCHCINNKVLVMHGGLFSSDNVTLEDIRTIDRNRQPPDEGLMCELL 339
            M + F+EV+ WLPL  CIN KVL+MHGGLFS D VTL+DIR I+RNRQPPD G MC+LL
Sbjct: 304 QMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLL 363
Query: 340 WSDPQIPNGRAPSKRGVGVHFGPDVTKAFLERNKLEYIIRSHEVKQDGYEVAHDGRCITV 399
           WSDPQ  NGR+ SKRGV   FGPDVTKAFLE N L+YIIRSHEVK +GYEVAH GRC+TV
Sbjct: 364 WSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTV 423
Query: 400 FSAPNYCDSVGNKGAFITMKGKDMVPHFTTYEAVGVSPPEP 440
           FSAPNYCD +GNK ++I ++G D+ P F  + AV    P P
Sbjct: 424 FSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAV----PHP 460
>pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 Back     alignment and structure
>pdb|1S95|A Chain A, Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 Length = 333 Back     alignment and structure
>pdb|1S95|A Chain A, Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 Length = 333 Back     alignment and structure
>pdb|3H60|A Chain A, Catalytic Domain Of Human SerineTHREONINE PHOSPHATASE 5 (Pp5c)with Two Mn2+ Atoms Length = 315 Back     alignment and structure
>pdb|3H60|A Chain A, Catalytic Domain Of Human SerineTHREONINE PHOSPHATASE 5 (Pp5c)with Two Mn2+ Atoms Length = 315 Back     alignment and structure
>pdb|3ICF|A Chain A, Structure Of Protein SerineTHREONINE PHOSPHATASE FROM SACCHAROMYCES Cerevisiae With Similarity To Human Phosphatase Pp5 Length = 335 Back     alignment and structure
>pdb|3ICF|A Chain A, Structure Of Protein SerineTHREONINE PHOSPHATASE FROM SACCHAROMYCES Cerevisiae With Similarity To Human Phosphatase Pp5 Length = 335 Back     alignment and structure
>pdb|2O8A|A Chain A, Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Length = 329 Back     alignment and structure
>pdb|1FJM|A Chain A, Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isoform, Type 1) Complexed With Microcystin-Lr Toxin Length = 330 Back     alignment and structure
>pdb|1JK7|A Chain A, Crystal Structure Of The Tumor-Promoter Okadaic Acid Bound To Protein Phosphatase-1 Length = 323 Back     alignment and structure
>pdb|4G9J|A Chain A, Protein SerTHR PHOSPHATASE-1 In Complex With Cell-Permeable Peptide Length = 331 Back     alignment and structure
>pdb|3E7A|A Chain A, Crystal Structure Of Protein Phosphatase-1 Bound To The Natural Toxin Nodularin-R Length = 299 Back     alignment and structure
>pdb|3V4Y|A Chain A, Crystal Structure Of The First Nuclear Pp1 Holoenzyme Length = 306 Back     alignment and structure
>pdb|3EGG|A Chain A, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Spinophilin Length = 329 Back     alignment and structure
>pdb|1U32|A Chain A, Crystal Structure Of A Protein Phosphatase-1: Calcineurin Hybrid Bound To Okadaic Acid Length = 293 Back     alignment and structure
>pdb|1S70|A Chain A, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 330 Back     alignment and structure
>pdb|3P71|C Chain C, Crystal Structure Of The Complex Of Lcmt-1 And Pp2a Length = 304 Back     alignment and structure
>pdb|2NYL|C Chain C, Crystal Structure Of Protein Phosphatase 2a (Pp2a) Holoenzyme With The Catalytic Subunit Carboxyl Terminus Truncated Length = 293 Back     alignment and structure
>pdb|2IE3|C Chain C, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Tumor- Inducing Toxins Length = 309 Back     alignment and structure
>pdb|2IE4|C Chain C, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Okadaic Acid Length = 309 Back     alignment and structure
>pdb|3C5W|C Chain C, Complex Between Pp2a-Specific Methylesterase Pme-1 And Pp2a Core Enzyme Length = 310 Back     alignment and structure
>pdb|3FGA|C Chain C, Structural Basis Of Pp2a And Sgo Interaction Length = 309 Back     alignment and structure
>pdb|2IAE|C Chain C, Crystal Structure Of A Protein Phosphatase 2a (Pp2a) Holoenzyme. Length = 309 Back     alignment and structure
>pdb|1AUI|A Chain A, Human Calcineurin Heterodimer Length = 521 Back     alignment and structure
>pdb|1AUI|A Chain A, Human Calcineurin Heterodimer Length = 521 Back     alignment and structure
>pdb|1M63|A Chain A, Crystal Structure Of Calcineurin-Cyclophilin-Cyclosporin Shows Common But Distinct Recognition Of Immunophilin-Drug Complexes Length = 372 Back     alignment and structure
>pdb|1M63|A Chain A, Crystal Structure Of Calcineurin-Cyclophilin-Cyclosporin Shows Common But Distinct Recognition Of Immunophilin-Drug Complexes Length = 372 Back     alignment and structure
>pdb|3LL8|A Chain A, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 357 Back     alignment and structure
>pdb|3LL8|A Chain A, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 357 Back     alignment and structure
>pdb|2P6B|A Chain A, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 383 Back     alignment and structure
>pdb|2P6B|A Chain A, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 383 Back     alignment and structure
>pdb|1TCO|A Chain A, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 375 Back     alignment and structure
>pdb|1TCO|A Chain A, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 375 Back     alignment and structure
>pdb|1MF8|A Chain A, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 373 Back     alignment and structure
>pdb|1MF8|A Chain A, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 373 Back     alignment and structure
>pdb|2JOG|A Chain A, Structure Of The Calcineurin-Nfat Complex Length = 327 Back     alignment and structure
>pdb|2JOG|A Chain A, Structure Of The Calcineurin-Nfat Complex Length = 327 Back     alignment and structure
>pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 Length = 166 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 Back     alignment and structure
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure
>pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|1G5B|A Chain A, Bacteriophage Lambda SerTHR PROTEIN PHOSPHATASE Length = 221 Back     alignment and structure
>pdb|3SZ7|A Chain A, Crystal Structure Of The Sgt2 Tpr Domain From Aspergillus Fumigatus Length = 164 Back     alignment and structure
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure
>pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70 Length = 514 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query546
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 0.0
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 6e-20
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 1e-169
3h63_A 315 Serine/threonine-protein phosphatase 5; metalloenz 4e-21
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 1e-161
3icf_A 335 PPT, serine/threonine-protein phosphatase T; IRO m 2e-15
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 1e-113
3e7a_A 299 PP-1A, serine/threonine-protein phosphatase PP1-al 2e-10
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 1e-113
2ie4_C 309 PP2A-alpha;, serine/threonine-protein phosphatase 2e-10
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 1e-113
1fjm_A 330 Protein serine/threonine phosphatase-1 (alpha ISO 2e-10
3ll8_A357 Serine/threonine-protein phosphatase 2B catalytic 1e-111
3ll8_A 357 Serine/threonine-protein phosphatase 2B catalytic 2e-11
1aui_A521 Calcineurin, serine/threonine phosphatase 2B; hydr 1e-106
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 3e-10
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 4e-52
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 3e-49
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 3e-47
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 8e-46
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 1e-45
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 1e-45
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 7e-45
3q49_B137 STIP1 homology and U box-containing protein 1; E3 8e-43
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-42
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 1e-39
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 4e-36
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 3e-33
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 7e-33
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 3e-32
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-31
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 9e-31
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, 1e-26
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-25
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-17
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-14
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-14
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-06
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-25
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-22
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-17
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-11
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-10
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-24
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-21
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-17
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-10
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-10
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-10
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-08
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 9e-24
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-18
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-12
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-09
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 4e-21
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-21
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-15
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-13
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-12
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-11
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-09
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-09
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-08
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 4e-20
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 4e-18
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 4e-16
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-15
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-10
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 9e-05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 8e-15
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-14
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-13
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-13
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-13
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-13
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-13
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-12
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-12
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-12
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-12
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-14
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-12
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-12
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-08
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-13
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-12
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-12
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-11
3u4t_A272 TPR repeat-containing protein; structural genomics 7e-11
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-07
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-12
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-12
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-11
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-11
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 9e-11
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-07
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-12
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-11
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-12
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-12
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-11
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-11
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-11
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-11
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-11
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-10
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-10
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-09
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-09
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-08
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-08
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-05
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 3e-12
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-12
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 5e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 6e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-11
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-08
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-06
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-04
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-11
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 7e-07
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 6e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-11
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 8e-11
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 8e-08
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 9e-11
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-10
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 5e-07
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-05
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 2e-10
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-10
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-09
4eqf_A365 PEX5-related protein; accessory protein, tetratric 4e-08
4eqf_A365 PEX5-related protein; accessory protein, tetratric 6e-08
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-07
4eqf_A365 PEX5-related protein; accessory protein, tetratric 6e-07
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-10
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-10
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-09
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-09
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-09
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-09
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-10
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-09
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-10
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-08
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-08
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-06
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-04
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-04
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-04
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-10
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 3e-07
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 8e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 7e-10
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-09
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-07
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-09
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-04
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 3e-09
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 7e-09
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 8e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-09
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 6e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 9e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-07
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-08
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-08
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 8e-08
2dfj_A280 Diadenosinetetraphosphatase; helices and strands m 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 6e-08
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 5e-05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 7e-08
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-07
4g1t_A472 Interferon-induced protein with tetratricopeptide 6e-06
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-05
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-05
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-04
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 1e-07
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 2e-05
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 1e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-07
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-07
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-04
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 3e-07
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 4e-06
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-06
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-05
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 2e-06
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 5e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 3e-06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 6e-06
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 5e-05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 5e-04
3rqz_A246 Metallophosphoesterase; PSI-biology, midwest cente 1e-04
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 1e-04
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
 Score =  629 bits (1625), Expect = 0.0
 Identities = 270/465 (58%), Positives = 323/465 (69%), Gaps = 57/465 (12%)

Query: 31  DKERAEKLKAEANEHFKNQAYNKAIELYSAAIEVNPT-AIYYANRSFAYLKTEAIGYALN 89
             +RAE+LK +AN++FK + Y  AI+ YS AIE+NP+ AIYY NRS AYL+TE  GYAL 
Sbjct: 2   ALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALG 61

Query: 90  DASKAIELDQTYTKAYYRRAAAYMSLGKFKLALRDYEAVHKARPNDKDAKAKFTECNKIV 149
           DA++AIELD+ Y K YYRRAA+ M+LGKF+ ALRDYE V K +P+DKDAK K+ ECNKIV
Sbjct: 62  DATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIV 121

Query: 150 KRMQI---------------------------------------------------KGK- 157
           K+                                                        K 
Sbjct: 122 KQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKDQKK 181

Query: 158 LHRKYAYRILMDIKALFMTQDSLVHITVEDEAKFTVCGDIHGQFYDLMNIFELNGLPSPD 217
           LHRK AY+IL+ +K +     +LV  T+++  K TVCGD HGQFYDL+NIFELNGLPS  
Sbjct: 182 LHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSET 241

Query: 218 NPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARGNHESAYMNQIYGFEGEVKSKY 277
           NPY+FNGDFVDRGSFSVE I TLFGFKLLYP+HF + RGNHE+  MNQIYGFEGEVK+KY
Sbjct: 242 NPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKY 301

Query: 278 TDLMAQFFTEVYNWLPLCHCINNKVLVMHGGLFSSDNVTLEDIRTIDRNRQPPDEGLMCE 337
           T  M + F+EV+ WLPL  CIN KVL+MHGGLFS D VTL+DIR I+RNRQPPD G MC+
Sbjct: 302 TAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCD 361

Query: 338 LLWSDPQIPNGRAPSKRGVGVHFGPDVTKAFLERNKLEYIIRSHEVKQDGYEVAHDGRCI 397
           LLWSDPQ  NGR+ SKRGV   FGPDVTKAFLE N L+YIIRSHEVK +GYEVAH GRC+
Sbjct: 362 LLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCV 421

Query: 398 TVFSAPNYCDSVGNKGAFITMKGKDMVPHFTTYEAVGVSPPEPAL 442
           TVFSAPNYCD +GNK ++I ++G D+ P F  + AV    P P +
Sbjct: 422 TVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAV----PHPNV 462
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Length = 315 Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Length = 315 Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Length = 335 Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Length = 335 Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Length = 299 Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Length = 299 Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Length = 309 Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Length = 309 Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Length = 330 Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Length = 330 Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Length = 357 Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Length = 357 Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Length = 521 Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Length = 521 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Length = 342 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Length = 221 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Length = 262 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Length = 280 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} Length = 246 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query546
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 100.0
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 100.0
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 100.0
3ll8_A357 Serine/threonine-protein phosphatase 2B catalytic 100.0
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 100.0
1aui_A521 Calcineurin, serine/threonine phosphatase 2B; hydr 100.0
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 100.0
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 100.0
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, 100.0
2dfj_A280 Diadenosinetetraphosphatase; helices and strands m 99.95
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.88
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.84
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 99.8
3h63_A 315 Serine/threonine-protein phosphatase 5; metalloenz 99.78
3e7a_A 299 PP-1A, serine/threonine-protein phosphatase PP1-al 99.77
3ll8_A 357 Serine/threonine-protein phosphatase 2B catalytic 99.76
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.74
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.74
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 99.74
3icf_A 335 PPT, serine/threonine-protein phosphatase T; IRO m 99.73
1fjm_A 330 Protein serine/threonine phosphatase-1 (alpha ISO 99.72
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.72
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 99.71
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.71
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.71
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.7
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.7
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.7
2ie4_C 309 PP2A-alpha;, serine/threonine-protein phosphatase 99.69
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.68
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.68
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.68
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.67
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.67
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.66
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.65
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.62
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.62
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.61
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.6
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.6
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.6
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.6
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.59
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.59
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.59
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.59
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.59
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.57
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.57
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.56
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.55
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.55
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.55
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.54
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.54
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.53
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.53
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.52
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.52
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.52
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.52
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.51
3u4t_A272 TPR repeat-containing protein; structural genomics 99.51
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.51
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.5
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.5
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.5
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.49
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.49
3rqz_A246 Metallophosphoesterase; PSI-biology, midwest cente 99.49
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.48
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.48
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.48
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.48
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.48
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.48
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.48
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.47
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.47
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.47
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.47
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.46
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.46
1nnw_A252 Hypothetical protein; structural genomics, PSI, pr 99.46
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.45
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.45
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.45
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.44
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.43
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.43
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.42
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.42
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.42
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.42
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.41
3k9i_A117 BH0479 protein; putative protein binding protein, 99.41
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.41
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.4
3u4t_A272 TPR repeat-containing protein; structural genomics 99.4
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.4
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.4
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.39
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.38
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.37
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.37
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.37
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.37
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.37
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.37
3qfm_A270 SAPH, putative uncharacterized protein; sandwich f 99.36
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.36
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.35
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.34
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.33
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.33
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.31
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.31
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.29
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.28
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.28
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.27
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.27
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.26
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.25
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.25
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.24
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.24
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.23
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.23
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.23
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.22
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.21
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.2
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.19
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.19
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.19
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.19
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.17
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.17
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.17
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.16
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.13
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.13
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.13
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.13
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.12
2z72_A 342 Protein-tyrosine-phosphatase; cold-active enzyme, 99.12
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.11
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.11
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.1
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.09
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.07
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.07
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.07
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.06
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.06
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.05
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.05
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.04
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.04
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.04
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.03
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.03
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.02
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.02
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.01
3k9i_A117 BH0479 protein; putative protein binding protein, 99.0
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.0
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.0
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.0
2dfj_A 280 Diadenosinetetraphosphatase; helices and strands m 98.99
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.98
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.98
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.97
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.97
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.96
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.96
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.96
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.96
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.96
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.95
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.94
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.94
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.93
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.92
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.92
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.92
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.92
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.91
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.89
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.88
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.86
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.86
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.84
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.84
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.83
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.82
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.82
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.82
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.8
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.75
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.75
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.73
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.71
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 98.69
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.69
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.68
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.63
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.61
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.58
1uf3_A228 Hypothetical protein TT1561; metallo-dependent pho 98.56
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.55
2qjc_A 262 Diadenosine tetraphosphatase, putative; putative d 98.53
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 98.51
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.5
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.5
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.49
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.49
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.48
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 98.46
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.45
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.41
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 98.41
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.38
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 98.38
3ck2_A176 Conserved uncharacterized protein (predicted phosp 98.37
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.36
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.31
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.29
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.24
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.22
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.18
1xm7_A195 Hypothetical protein AQ_1665; structural genomics, 98.17
1g5b_A 221 Serine/threonine protein phosphatase; bacteriophag 98.15
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.15
3ib7_A330 ICC protein; metallophosphoesterase, alpha-beta fo 98.11
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.1
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.04
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.03
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.99
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.99
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metall 97.97
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 97.95
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.92
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.83
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 97.73
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.66
3rqz_A 246 Metallophosphoesterase; PSI-biology, midwest cente 97.65
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.62
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.61
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.59
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.53
3qfm_A 270 SAPH, putative uncharacterized protein; sandwich f 97.53
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.51
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.5
1nnw_A 252 Hypothetical protein; structural genomics, PSI, pr 97.48
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, 97.43
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.21
3rl5_A296 Metallophosphoesterase mpped2; alpha-beta fold, me 97.16
2xmo_A443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 97.15
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.13
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.02
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.99
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.87
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.82
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 96.77
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 96.36
2nxf_A322 Putative dimetal phosphatase; dinuclear metal cent 96.23
2q8u_A336 Exonuclease, putative; structural genomics, joint 96.21
3av0_A386 DNA double-strand break repair protein MRE11; DNA 96.08
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 96.03
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 95.9
1ii7_A333 MRE11 nuclease; RAD50, DNA double-strand break rep 95.89
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 95.84
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.54
1ute_A313 Protein (II purple acid phosphatase); tartrate res 95.43
1uf3_A 228 Hypothetical protein TT1561; metallo-dependent pho 94.7
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 94.69
3tho_B379 Exonuclease, putative; adenosine triphosphate, bac 94.35
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 94.27
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 94.1
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 94.07
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 93.92
3t1i_A431 Double-strand break repair protein MRE11A; DNA rep 93.84
4fbk_A472 DNA repair and telomere maintenance protein NBS1, 93.71
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.63
4fbw_A417 DNA repair protein RAD32; DNA double-strand break 93.45
2qfp_A424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 92.97
2yvt_A 260 Hypothetical protein AQ_1956; structural genomics, 92.73
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 92.17
1xm7_A195 Hypothetical protein AQ_1665; structural genomics, 92.15
1xzw_A426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 91.94
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 91.68
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 90.47
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 89.93
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 89.25
2a22_A 215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 88.97
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 88.92
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 88.14
2q8u_A 336 Exonuclease, putative; structural genomics, joint 88.13
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 87.99
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 87.74
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 87.69
3ib7_A 330 ICC protein; metallophosphoesterase, alpha-beta fo 86.13
3tgh_A342 Glideosome-associated protein 50; phosphatase fold 85.8
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 85.29
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 83.27
1ii7_A 333 MRE11 nuclease; RAD50, DNA double-strand break rep 83.21
2nxf_A 322 Putative dimetal phosphatase; dinuclear metal cent 83.0
3d03_A 274 Phosphohydrolase; glycerophosphodiesterase, metall 82.61
3av0_A 386 DNA double-strand break repair protein MRE11; DNA 81.93
4fbk_A 472 DNA repair and telomere maintenance protein NBS1, 80.84
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 80.66
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 80.64
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 80.44
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
Probab=100.00  E-value=6e-78  Score=645.80  Aligned_cols=411  Identities=64%  Similarity=1.116  Sum_probs=366.5

Q ss_pred             HHHHHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCC-HHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCcHHHHHHHHH
Q psy11688         32 KERAEKLKAEANEHFKNQAYNKAIELYSAAIEVNPT-AIYYANRSFAYLKTEAIGYALNDASKAIELDQTYTKAYYRRAA  110 (546)
Q Consensus        32 ~~~a~~~~~~g~~~~~~g~~~~Ai~~~~~al~~~p~-~~a~~nla~~~~~~g~~~~Al~~~~~al~l~p~~~~a~~~lg~  110 (546)
                      ++.++++..+|..++++|+|++|+..|++|++++|+ +.+|.++|.+|.++|++++|++++++|++++|+++.+|+++|.
T Consensus         3 ~~~a~~~~~lg~~~~~~g~~~~A~~~~~~Al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~l~p~~~~~~~~lg~   82 (477)
T 1wao_1            3 LKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAA   82 (477)
T ss_dssp             HHHHTTSSSSSSSTTTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHSCTTCHHHHHHHHH
T ss_pred             HhHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCCHHHHHHHHH
Confidence            455667777778888888888888888888888884 7788888888888888888888888888888888888888888


Q ss_pred             HHHHhcChHHHHHHHHHhhccCCCCcchhcccccc--hhhhhhh------------------------------------
Q psy11688        111 AYMSLGKFKLALRDYEAVHKARPNDKDAKAKFTEC--NKIVKRM------------------------------------  152 (546)
Q Consensus       111 ~~~~~g~~~eA~~~~~kal~l~P~~~~~~~~l~~~--~~~l~~~------------------------------------  152 (546)
                      +|..+|++++|++.|+++++++|++..++..++.+  +...+++                                    
T Consensus        83 ~~~~~g~~~eA~~~~~~al~~~p~~~~~~~~l~~~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~al~~~~~~~~~~~~~~  162 (477)
T 1wao_1           83 SNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDG  162 (477)
T ss_dssp             HHHHHTCHHHHHHHHHHHHHHSTTCTTHHHHHHHHHHHHHHHHHCCC------CCSTTTCCTTSSCCCCTTCCSCCCGGG
T ss_pred             HHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHHHHHHHHHhccccccchhHhhhhhhhccccccccccccccc
Confidence            88888888888888888888888877766666555  2211111                                    


Q ss_pred             --------------hhhhhchHHHHHHHHHHHHhhhhcCCcccccccccccccccccccchhHhhHHHHHHHhCCCCCCC
Q psy11688        153 --------------QIKGKLHRKYAYRILMDIKALFMTQDSLVHITVEDEAKFTVCGDIHGQFYDLMNIFELNGLPSPDN  218 (546)
Q Consensus       153 --------------~~~~~l~~~~~~~il~~a~eiL~~~p~~~~i~~~~~~~~~viGDihg~~~~l~~il~~~~~~~~~~  218 (546)
                                    .....+++..+..++..+.+++..+|+++++..|...+++++||+||++.+|.++++..+.++..+
T Consensus       163 ~itl~~l~~lie~l~~~~~l~e~~v~~L~~~a~eil~~e~~~~~~~~~~~~~~~vigDiHG~~~~l~~~l~~~~~~~~~~  242 (477)
T 1wao_1          163 KVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETN  242 (477)
T ss_dssp             SCCHHHHHHHHHHHHTCCCCCHHHHHHHHHHHHHHHHTSCSEEEECCCSSCEEEEECBCTTCHHHHHHHHHHHCCCBTTB
T ss_pred             cccHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHccCCCeEEeecCCCcceEEEeCCCCCHHHHHHHHHHcCCCCCcC
Confidence                          113456677888899999999999999999998888889999999999999999999999887777


Q ss_pred             CeeeeccccccCCChHHHHHHHhhhhhcCCCeEEEEccccccchhhhhhcchhhhhhhchHHHHHHHHHhhccccceeee
Q psy11688        219 PYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFFMARGNHESAYMNQIYGFEGEVKSKYTDLMAQFFTEVYNWLPLCHCI  298 (546)
Q Consensus       219 ~~~~lGD~vdrG~~~~e~l~~l~~l~~~~p~~v~~lrGNHE~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~lP~~~~~  298 (546)
                      .++|+|||||||++|.||+.+++++++.+|.+|++||||||.+.++..|||.+++..+|+..+|+.+.++|++||+++++
T Consensus       243 ~~v~lGD~vdrG~~s~e~~~~l~~l~~~~~~~~~~lrGNHE~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~lp~~~~~  322 (477)
T 1wao_1          243 PYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCI  322 (477)
T ss_dssp             CEEEESCCSSSSTTHHHHHHHHHHHHHHSTTTEEEECCTTSSHHHHHHHSHHHHHHHHSCTTHHHHHHHHHTTSCSEEEE
T ss_pred             eEEEeccccCCCcchHHHHHHHHHHHhhCCCceEeecCCccHHHHhhhcChHHHHHHHhhHHHHHHHHHHhccCCcEEEE
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cceEEEEeCCccCCCCCChhhhhccCCCCCCCCchhhhhhhcCCCCCCCCCCCCCCCCeeeeCHHHHHHHHHhcCCcEEE
Q psy11688        299 NNKVLVMHGGLFSSDNVTLEDIRTIDRNRQPPDEGLMCELLWSDPQIPNGRAPSKRGVGVHFGPDVTKAFLERNKLEYII  378 (546)
Q Consensus       299 ~~~~~~vHgGi~~~~~~~~~~i~~~~r~~~~~~~~~~~dllWsdp~~~~~~~~~~rg~~~~fg~~~~~~fl~~~~~~~ii  378 (546)
                      +++++|||||+++|...++++|+++.|+.+++.++.++|+|||||....+|.+++||.|+.||++++++||+++|+++||
T Consensus       323 ~~~~~~vHgg~~~~~~~~l~~i~~~~r~~~~~~~~~~~dllWsdp~~~~~~~~~~rg~~~~fg~~~~~~fl~~~~~~~ii  402 (477)
T 1wao_1          323 NGKVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYII  402 (477)
T ss_dssp             TTTEEECSSCCCSSSCCCHHHHHTCCCSSCCCSSSHHHHHHHCEECSSSSCEECTTSSSEEECHHHHHHHHHHTTCCEEE
T ss_pred             cCcEEEECCCCCccccCCHHHHHhccCCCCCchhhhhhhhccCCCCccCCcCcCCCCCceeECHHHHHHHHHHcCCeEEE
Confidence            99999999999888889999999999999999999999999999999889999999999999999999999999999999


Q ss_pred             EeccccccCceEeCCCeEEEEeCCCCCCCCCCCceeEEEeeCCCCceeEEEEeecCCCCCCCCc
Q psy11688        379 RSHEVKQDGYEVAHDGRCITVFSAPNYCDSVGNKGAFITMKGKDMVPHFTTYEAVGVSPPEPAL  442 (546)
Q Consensus       379 r~H~~~~~G~~~~~~~~~itifsa~~y~~~~~n~~a~~~~~~~~~~~~~~~~~~~~~~~~~p~l  442 (546)
                      ||||++++||+++++++|||||||||||+.++|.||||.|++++++++|++|+++|+|.++|+-
T Consensus       403 r~H~~~~~g~~~~~~~~~~tvfsa~~y~~~~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  466 (477)
T 1wao_1          403 RSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMA  466 (477)
T ss_dssp             ECCSCCTEEEEEEGGGTEEEEBCCTTTTSSSCCEEEEEEEETTEEEEEEEEECCCCCCSCCTTC
T ss_pred             ECCCCCcCCeEEecCCeEEEEeCCcccccCCCccEEEEEEECCCCeEEEEEEeCCCCCCCChhh
Confidence            9999999999999999999999999999999999999999778899999999999999998864
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A Back     alignment and structure
>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} Back     alignment and structure
>4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* Back     alignment and structure
>4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 546
d1s95a_324 d.159.1.3 (A:) Serine/threonine protein phosphatas 1e-121
d1s95a_ 324 d.159.1.3 (A:) Serine/threonine protein phosphatas 5e-13
d1auia_473 d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calc 1e-100
d1auia_ 473 d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calc 4e-11
d3c5wc1288 d.159.1.3 (C:6-293) Protein phosphatase 2A catalyt 7e-97
d3c5wc1 288 d.159.1.3 (C:6-293) Protein phosphatase 2A catalyt 1e-07
d1jk7a_294 d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human 3e-93
d1jk7a_ 294 d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human 3e-06
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 1e-16
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 0.001
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 3e-16
d1g5ba_219 d.159.1.3 (A:) lambda ser/thr protein phosphatase 6e-16
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 3e-12
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 8e-11
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 9e-11
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-10
d1nnwa_251 d.159.1.5 (A:) Hypothetical protein PF1291 {Archae 9e-10
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 3e-09
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 7e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-08
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-08
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-07
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-04
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 3e-07
d1su1a_184 d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia 3e-05
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 4e-05
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 3e-04
d1uf3a_228 d.159.1.6 (A:) Hypothetical protein TT1561 {Thermu 8e-05
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-04
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 2e-04
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 2e-04
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 2e-04
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 0.001
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Protein serine/threonine phosphatase
domain: Serine/threonine protein phosphatase 5, PP5
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  357 bits (917), Expect = e-121
 Identities = 196/311 (63%), Positives = 238/311 (76%), Gaps = 4/311 (1%)

Query: 133 PNDKDAKAKFTECNKIVKRMQIKGKLHRKYAYRILMDIKALFMTQDSLVHITVEDEAKFT 192
           P  +D K   +   ++++  + + KLHRK AY+IL+ +K +     +LV  T+++  K T
Sbjct: 4   PKLEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKIT 63

Query: 193 VCGDIHGQFYDLMNIFELNGLPSPDNPYLFNGDFVDRGSFSVECIFTLFGFKLLYPNHFF 252
           VCGD HGQFYDL+NIFELNGLPS  NPY+FNGDFVDRGSFSVE I TLFGFKLLYP+HF 
Sbjct: 64  VCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFH 123

Query: 253 MARGNHESAYMNQIYGFEGEVKSKYTDLMAQFFTEVYNWLPLCHCINNKVLVMHGGLFSS 312
           + RGNHE+  MNQIYGFEGEVK+KYT  M + F+EV+ WLPL  CIN KVL+MHGGLFS 
Sbjct: 124 LLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSE 183

Query: 313 DNVTLEDIRTIDRNRQPPDEGLMCELLWSDPQIPNGRAPSKRGVGVHFGPDVTKAFLERN 372
           D VTL+DIR I+RNRQPPD G MC+LLWSDPQ  NGR+ SKRGV   FGPDVTKAFLE N
Sbjct: 184 DGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEEN 243

Query: 373 KLEYIIRSHEVKQDGYEVAHDGRCITVFSAPNYCDSVGNKGAFITMKGKDMVPHFTTYEA 432
            L+YIIRSHEVK +GYEVAH GRC+TVFSAPNYCD +GNK ++I ++G D+ P F  + A
Sbjct: 244 NLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTA 303

Query: 433 VGVSPPEPALE 443
           V    P P ++
Sbjct: 304 V----PHPNVK 310
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 473 Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 473 Back     information, alignment and structure
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Length = 219 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 251 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Length = 228 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query546
d1s95a_324 Serine/threonine protein phosphatase 5, PP5 {Human 100.0
d1jk7a_294 Protein phosphatase-1 (PP-1) {Human (Homo sapiens) 100.0
d3c5wc1288 Protein phosphatase 2A catalytic subunit alpha iso 100.0
d1auia_473 Protein phosphatase-2B (PP-2B, calcineurin A subun 100.0
d1s95a_ 324 Serine/threonine protein phosphatase 5, PP5 {Human 99.89
d1jk7a_ 294 Protein phosphatase-1 (PP-1) {Human (Homo sapiens) 99.89
d1auia_ 473 Protein phosphatase-2B (PP-2B, calcineurin A subun 99.88
d3c5wc1 288 Protein phosphatase 2A catalytic subunit alpha iso 99.87
d1g5ba_219 lambda ser/thr protein phosphatase {Bacteriophage 99.81
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.77
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.71
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.7
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.68
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.68
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.67
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.64
d1nnwa_251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 99.6
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.6
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.58
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.56
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.56
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.55
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.53
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.52
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.46
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.45
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.44
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.44
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.42
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.38
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.32
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.29
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.26
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.23
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.22
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.18
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.17
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.13
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.12
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.07
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.04
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.03
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.02
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.98
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.96
d1uf3a_228 Hypothetical protein TT1561 {Thermus thermophilus 98.95
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.94
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1g5ba_ 219 lambda ser/thr protein phosphatase {Bacteriophage 98.91
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.84
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.74
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.61
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.55
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.54
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus j 98.49
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.44
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.43
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.38
d2a22a1193 Vacuolar protein sorting 29, VPS29 {Cryptosporidiu 98.36
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.32
d3ck2a1173 Uncharacterized protein SP1879 {Streptococcus pneu 98.32
d1nnwa_ 251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 98.27
d2yvta1257 Uncharacterized protein Aq_1956 {Aquifex aeolicus 98.26
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.22
d1z2wa1182 Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus 98.2
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.19
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.17
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 98.14
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.12
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.9
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.65
d1uf3a_ 228 Hypothetical protein TT1561 {Thermus thermophilus 97.5
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.38
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.08
d3d03a1271 Glycerophosphodiesterase GpdQ {Enterobacter aeroge 97.07
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 96.65
d1xm7a_188 Hypothetical protein aq_1666 {Aquifex aeolicus [Ta 96.5
d1ii7a_333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.97
d2hy1a1256 Rv0805 cyclic nucleotide phosphodiesterase {Mycoba 95.43
d2nxfa1320 Uncharacterized C17orf48 homolog zgc:64213 {Zebraf 93.62
d1utea_302 Mammalian purple acid phosphatase {Pig (Sus scrofa 93.05
d2yvta1 257 Uncharacterized protein Aq_1956 {Aquifex aeolicus 92.96
d2qfra2312 Plant purple acid phosphatase, catalytic domain {K 90.54
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus j 89.53
d1ii7a_ 333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.05
d1xm7a_188 Hypothetical protein aq_1666 {Aquifex aeolicus [Ta 86.99
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 83.24
d3d03a1 271 Glycerophosphodiesterase GpdQ {Enterobacter aeroge 81.57
d2a22a1 193 Vacuolar protein sorting 29, VPS29 {Cryptosporidiu 81.24
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Protein serine/threonine phosphatase
domain: Serine/threonine protein phosphatase 5, PP5
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=6.1e-73  Score=559.61  Aligned_cols=301  Identities=64%  Similarity=1.133  Sum_probs=283.3

Q ss_pred             cchhhhhhhhhhhhchHHHHHHHHHHHHhhhhcCCcccccccccccccccccccchhHhhHHHHHHHhCCCCCCCCeeee
Q psy11688        144 ECNKIVKRMQIKGKLHRKYAYRILMDIKALFMTQDSLVHITVEDEAKFTVCGDIHGQFYDLMNIFELNGLPSPDNPYLFN  223 (546)
Q Consensus       144 ~~~~~l~~~~~~~~l~~~~~~~il~~a~eiL~~~p~~~~i~~~~~~~~~viGDihg~~~~l~~il~~~~~~~~~~~~~~l  223 (546)
                      .+...++..+..+.++.+.+.+++.+++++++++|+++++......++.|+||+||++.||.++|+..|+|++.++|+||
T Consensus        15 ~~~~li~~~~~~~~l~~~~~~~ll~~~~~il~~e~~l~~i~~~~~~pv~VvGDiHGq~~DL~~if~~~g~p~~~~~ylFL   94 (324)
T d1s95a_          15 FMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFN   94 (324)
T ss_dssp             HHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHHTSCSEEEECCCTTCEEEEECCCTTCHHHHHHHHHHHCCCBTTBCEEEE
T ss_pred             HHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHhCCCeEEeecCCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCCeEEEe
Confidence            34455555666778899999999999999999999999997665667999999999999999999999999887789999


Q ss_pred             ccccccCCChHHHHHHHhhhhhcCCCeEEEEccccccchhhhhhcchhhhhhhchHHHHHHHHHhhccccceeeecceEE
Q psy11688        224 GDFVDRGSFSVECIFTLFGFKLLYPNHFFMARGNHESAYMNQIYGFEGEVKSKYTDLMAQFFTEVYNWLPLCHCINNKVL  303 (546)
Q Consensus       224 GD~vdrG~~~~e~l~~l~~l~~~~p~~v~~lrGNHE~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~lP~~~~~~~~~~  303 (546)
                      |||||||++|+||+.+|++||+.+|++|++||||||...++..|||.+|+..+|+.++|+.+.+.|++||++|+|++++|
T Consensus        95 GDYVDRG~~slEvi~lL~~lKi~yP~~v~LLRGNHE~~~~n~~ygF~~e~~~k~~~~l~~~~~~~F~~LPlaa~I~~~il  174 (324)
T d1s95a_          95 GDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVL  174 (324)
T ss_dssp             SCCSSSSTTHHHHHHHHHHHHHHSTTTEEEECCTTSSHHHHHHHSHHHHHHHHSCHHHHHHHHHHHTTSCSEEEETTTEE
T ss_pred             cccccCcCcceeehHHHHHHHHhCCCcEEeccCCccccccccccccchHhhhhcCHHHHHHHHHHHhhcchhhhccCcEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeCCccCCCCCChhhhhccCCCCCCCCchhhhhhhcCCCCCCCCCCCCCCCCeeeeCHHHHHHHHHhcCCcEEEEeccc
Q psy11688        304 VMHGGLFSSDNVTLEDIRTIDRNRQPPDEGLMCELLWSDPQIPNGRAPSKRGVGVHFGPDVTKAFLERNKLEYIIRSHEV  383 (546)
Q Consensus       304 ~vHgGi~~~~~~~~~~i~~~~r~~~~~~~~~~~dllWsdp~~~~~~~~~~rg~~~~fg~~~~~~fl~~~~~~~iir~H~~  383 (546)
                      |||||||++...++++|++++|+.+++++++++|+|||||....++.++.||.|+.||++++++||++||+++||||||+
T Consensus       175 cvHGGi~~~~~~~l~~i~~i~r~~~~~~~~~~~dlLWSDP~~~~~~~~~~Rg~g~~FG~~~~~~Fl~~n~l~lIIR~He~  254 (324)
T d1s95a_         175 IMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEV  254 (324)
T ss_dssp             ECSSCCCSSSCCCHHHHHTCCCSSSCCSSSHHHHHHHCEECSSSSEEECTTSSSEEECHHHHHHHHHHHTCCEEEECCSC
T ss_pred             EecCCcCccccCCHHHHHhccCCCCCcchhhhhhhhccCccccCCcCcCCCCCcCCcCHHHHHHHHHHcCCcEEEEcCcc
Confidence            99999966778999999999999999999999999999999988899999999999999999999999999999999999


Q ss_pred             cccCceEeCCCeEEEEeCCCCCCCCCCCceeEEEeeCCCCceeEEEEeecCCCCCCCCccc
Q psy11688        384 KQDGYEVAHDGRCITVFSAPNYCDSVGNKGAFITMKGKDMVPHFTTYEAVGVSPPEPALEN  444 (546)
Q Consensus       384 ~~~G~~~~~~~~~itifsa~~y~~~~~n~~a~~~~~~~~~~~~~~~~~~~~~~~~~p~l~~  444 (546)
                      +++||++.+++||||||||||||+..+|+||+|.|++++++++|+||+++|+|..+|+.-.
T Consensus       255 v~~G~~~~~~~kviTvFSa~nY~~~~~N~~a~l~i~~~~~~~~~~~f~~~p~p~~~p~~~~  315 (324)
T d1s95a_         255 KAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYA  315 (324)
T ss_dssp             CTTSEEEEGGGTEEEECCCSSGGGTSCCCEEEEEEETTEEEEEEEEECCCCCCSCCTTTTS
T ss_pred             ccCceEEecCCcEEEEeCCCccCCCCCcceEEEEEECCCceeEEEEecCCCCCCCChhhhh
Confidence            9999999999999999999999999999999999977778999999999999998886643
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Back     information, alignment and structure
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure