Psyllid ID: psy11691
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 271 | ||||||
| 189240639 | 987 | PREDICTED: similar to MICAL-like CG11259 | 0.357 | 0.098 | 0.436 | 1e-15 | |
| 340718062 | 1099 | PREDICTED: hypothetical protein LOC10064 | 0.369 | 0.090 | 0.378 | 2e-15 | |
| 350420891 | 1096 | PREDICTED: hypothetical protein LOC10074 | 0.321 | 0.079 | 0.413 | 3e-15 | |
| 270013585 | 926 | hypothetical protein TcasGA2_TC012205 [T | 0.276 | 0.080 | 0.493 | 3e-15 | |
| 157114944 | 1079 | hypothetical protein AaeL_AAEL007011 [Ae | 0.254 | 0.063 | 0.514 | 9e-15 | |
| 328700197 | 765 | PREDICTED: hypothetical protein LOC10016 | 0.221 | 0.078 | 0.55 | 1e-14 | |
| 328790600 | 1062 | PREDICTED: LOW QUALITY PROTEIN: hypothet | 0.280 | 0.071 | 0.441 | 1e-14 | |
| 383858085 | 1084 | PREDICTED: uncharacterized protein LOC10 | 0.276 | 0.069 | 0.460 | 1e-14 | |
| 380023178 | 1087 | PREDICTED: uncharacterized protein LOC10 | 0.295 | 0.073 | 0.432 | 2e-14 | |
| 332027292 | 1029 | MICAL-like protein 2 [Acromyrmex echinat | 0.302 | 0.079 | 0.465 | 4e-14 |
| >gi|189240639|ref|XP_001809361.1| PREDICTED: similar to MICAL-like CG11259-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 89.7 bits (221), Expect = 1e-15, Method: Compositional matrix adjust.
Identities = 45/103 (43%), Positives = 59/103 (57%), Gaps = 6/103 (5%)
Query: 69 TSPAHR--EPGAPRAPSQPPSTLPGSLKLNSCSLCGEKVYLAQRFAFNARLFHRTCFKCA 126
TSP H P + P++ G ++ C+ CG V++A+R L+HRTCF+CA
Sbjct: 127 TSPDHGLVSPASTSPPTKVAFAGAGKVRREPCAKCGLPVFIAERLNVGKLLYHRTCFRCA 186
Query: 127 RCQSQLTCINAYETHTGQFCCEVCPDEE----ERSLTDPLRSS 165
RC SQLT N YET FCCE CPDEE RSL+D +S+
Sbjct: 187 RCSSQLTLANYYETENSDFCCETCPDEESQVLSRSLSDEEKSA 229
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|340718062|ref|XP_003397491.1| PREDICTED: hypothetical protein LOC100649179 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350420891|ref|XP_003492663.1| PREDICTED: hypothetical protein LOC100744222 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|270013585|gb|EFA10033.1| hypothetical protein TcasGA2_TC012205 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|157114944|ref|XP_001652498.1| hypothetical protein AaeL_AAEL007011 [Aedes aegypti] gi|108877128|gb|EAT41353.1| AAEL007011-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|328700197|ref|XP_001949567.2| PREDICTED: hypothetical protein LOC100161003 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328790600|ref|XP_396410.4| PREDICTED: LOW QUALITY PROTEIN: hypothetical protein LOC412959 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|383858085|ref|XP_003704533.1| PREDICTED: uncharacterized protein LOC100881207 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|380023178|ref|XP_003695403.1| PREDICTED: uncharacterized protein LOC100866046 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|332027292|gb|EGI67376.1| MICAL-like protein 2 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 271 | ||||||
| FB|FBgn0036333 | 1010 | MICAL-like "MICAL-like" [Droso | 0.608 | 0.163 | 0.295 | 3.9e-15 | |
| UNIPROTKB|F1MH07 | 1070 | MICAL1 "Protein-methionine sul | 0.387 | 0.098 | 0.324 | 5.7e-08 | |
| RGD|1565018 | 206 | Crip3 "cysteine-rich protein 3 | 0.350 | 0.461 | 0.31 | 7.9e-08 | |
| UNIPROTKB|Q8TDZ2 | 1067 | MICAL1 "Protein-methionine sul | 0.313 | 0.079 | 0.351 | 1.6e-07 | |
| UNIPROTKB|F1NWZ2 | 193 | CSRP3 "Uncharacterized protein | 0.276 | 0.388 | 0.302 | 2.9e-07 | |
| UNIPROTKB|F6REL8 | 883 | MICALL2 "Uncharacterized prote | 0.402 | 0.123 | 0.336 | 3.7e-07 | |
| UNIPROTKB|Q8IY33 | 904 | MICALL2 "MICAL-like protein 2" | 0.335 | 0.100 | 0.340 | 5e-07 | |
| UNIPROTKB|Q6Q6R5 | 217 | CRIP3 "Cysteine-rich protein 3 | 0.335 | 0.419 | 0.336 | 5.8e-07 | |
| UNIPROTKB|F1PCD9 | 964 | MICAL1 "Uncharacterized protei | 0.409 | 0.115 | 0.330 | 7e-07 | |
| UNIPROTKB|F1RIV6 | 981 | MICALL2 "Uncharacterized prote | 0.416 | 0.115 | 0.319 | 7.2e-07 |
| FB|FBgn0036333 MICAL-like "MICAL-like" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 204 (76.9 bits), Expect = 3.9e-15, P = 3.9e-15
Identities = 52/176 (29%), Positives = 81/176 (46%)
Query: 71 PAHREP-GAPRAPSQPPSTLPGSLKLNSCSLCGEKVYLAQRFAFNARLFHRTCFKCARCQ 129
P EP G P Q + G + + C C V+LA+R R +HRTC KCARC
Sbjct: 122 PKPEEPLGEESEPPQKVMHIVGMPRRDKCQKCNLPVFLAERVLVGKRAYHRTCLKCARCS 181
Query: 130 SQLTCINAYETHTGQ-FCCEVCPDEEERSLTDPLR----SSDRPDGHHAIGDDRYHAELN 184
S LT + YET +CCE CPDEE +D L+ ++D P+ + ++E
Sbjct: 182 SLLTPGSFYETEVNNIYCCETCPDEESEPESDILKLKTTTTDSPNDKQMVAQSSDYSEAE 241
Query: 185 SDKSTNLLTDSEPSTHCDSNLVTASVESTNMERNMDNDDLNILNKCTTDDDKVNSV 240
DK +L + +T N S N + + +N +N +++ K++ +
Sbjct: 242 -DKQEDLEDNDIRTTDKPENFQPPS----NKDEQNNELTINPVNPILSEERKISFI 292
|
|
| UNIPROTKB|F1MH07 MICAL1 "Protein-methionine sulfoxide oxidase MICAL1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1565018 Crip3 "cysteine-rich protein 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8TDZ2 MICAL1 "Protein-methionine sulfoxide oxidase MICAL1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NWZ2 CSRP3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6REL8 MICALL2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IY33 MICALL2 "MICAL-like protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6Q6R5 CRIP3 "Cysteine-rich protein 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PCD9 MICAL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RIV6 MICALL2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 271 | |||
| cd09400 | 61 | cd09400, LIM_like_1, LIM domain in proteins of unk | 1e-21 | |
| cd09358 | 53 | cd09358, LIM_Mical_like, The LIM domain of Mical ( | 6e-12 | |
| cd09444 | 55 | cd09444, LIM_Mical_like_1, This domain belongs to | 3e-08 | |
| cd09401 | 53 | cd09401, LIM_TLP_like, The LIM domains of thymus L | 2e-07 | |
| smart00132 | 54 | smart00132, LIM, Zinc-binding domain present in Li | 8e-07 | |
| cd09439 | 55 | cd09439, LIM_Mical, The LIM domain of Mical (molec | 2e-06 | |
| cd09482 | 54 | cd09482, LIM2_CRP3, The second LIM domain of Cyste | 2e-06 | |
| cd08368 | 53 | cd08368, LIM, LIM is a small protein-protein inter | 3e-06 | |
| cd09404 | 54 | cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84 | 4e-06 | |
| cd09442 | 53 | cd09442, LIM_Eplin_like, The Lim domain of Epithel | 6e-06 | |
| cd09481 | 54 | cd09481, LIM1_CRP3, The first LIM domain of Cystei | 8e-06 | |
| cd09840 | 54 | cd09840, LIM2_CRP2, The second LIM domain of Cyste | 9e-06 | |
| pfam00412 | 58 | pfam00412, LIM, LIM domain | 1e-05 | |
| cd09445 | 53 | cd09445, LIM_Mical_like_2, This domain belongs to | 1e-05 | |
| cd09402 | 53 | cd09402, LIM1_CRP, The first LIM domain of Cystein | 1e-05 | |
| cd09403 | 54 | cd09403, LIM2_CRP, The second LIM domain of Cystei | 2e-05 | |
| cd09485 | 53 | cd09485, LIM_Eplin_alpha_beta, The Lim domain of E | 2e-05 | |
| cd09479 | 56 | cd09479, LIM1_CRP1, The first LIM domain of Cystei | 9e-05 | |
| cd09477 | 54 | cd09477, LIM2_TLP, The second LIM domain of thymus | 1e-04 | |
| cd09486 | 53 | cd09486, LIM_Eplin_like_1, a LIM domain subfamily | 1e-04 | |
| cd09440 | 63 | cd09440, LIM1_SF3, The first Lim domain of pollen | 1e-04 | |
| cd09326 | 53 | cd09326, LIM_CRP_like, The LIM domains of Cysteine | 1e-04 | |
| cd09349 | 87 | cd09349, LIM1_Zyxin, The first LIM domain of Zyxin | 2e-04 | |
| cd09394 | 55 | cd09394, LIM1_Rga, The first LIM domain of Rga GTP | 3e-04 | |
| cd09478 | 54 | cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich | 4e-04 | |
| cd09443 | 55 | cd09443, LIM_Ltd-1, The LIM domain of LIM and tran | 4e-04 | |
| cd09441 | 61 | cd09441, LIM2_SF3, The second Lim domain of pollen | 5e-04 | |
| cd09480 | 55 | cd09480, LIM1_CRP2, The first LIM domain of Cystei | 0.002 | |
| cd09476 | 54 | cd09476, LIM1_TLP, The first LIM domain of thymus | 0.003 | |
| cd09446 | 53 | cd09446, LIM_N_RAP, The LIM domain of N-RAP | 0.004 |
| >gnl|CDD|188784 cd09400, LIM_like_1, LIM domain in proteins of unknown function | Back alignment and domain information |
|---|
Score = 85.2 bits (211), Expect = 1e-21
Identities = 32/61 (52%), Positives = 41/61 (67%)
Query: 94 KLNSCSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEVCPDE 153
+ C+ CG V+LA+R +++HRTCFKCARC QLT + YET G +CCE CPDE
Sbjct: 1 RREPCASCGLPVFLAERLLIEGKVYHRTCFKCARCGVQLTPGSFYETEYGSYCCETCPDE 60
Query: 154 E 154
E
Sbjct: 61 E 61
|
LIM domain in proteins of unknown function: LIM domains are identified in a diverse group of proteins with wide variety of biological functions, including gene expression regulation, cell fate determination, cytoskeleton organization, tumor formation, and development. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein complexes. They perform their functions through interactions with other protein partners. The LIM domains are 50-60 amino acids in size and share two characteristic highly conserved zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. The consensus sequence of LIM domain has been defined as C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16, 21)-C-x(2,3)-[CHD] (where X denotes any amino acid). Length = 61 |
| >gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule interacting with CasL) like family | Back alignment and domain information |
|---|
| >gnl|CDD|188828 cd09444, LIM_Mical_like_1, This domain belongs to the LIM domain family which are found on Mical (molecule interacting with CasL) like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >gnl|CDD|188823 cd09439, LIM_Mical, The LIM domain of Mical (molecule interacting with CasL) | Back alignment and domain information |
|---|
| >gnl|CDD|188866 cd09482, LIM2_CRP3, The second LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|188788 cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84B and Mlp60A | Back alignment and domain information |
|---|
| >gnl|CDD|188826 cd09442, LIM_Eplin_like, The Lim domain of Epithelial Protein Lost in Neoplasm (Eplin) like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188865 cd09481, LIM1_CRP3, The first LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188871 cd09840, LIM2_CRP2, The second LIM domain of Cysteine Rich Protein 2 (CRP2) | Back alignment and domain information |
|---|
| >gnl|CDD|215907 pfam00412, LIM, LIM domain | Back alignment and domain information |
|---|
| >gnl|CDD|188829 cd09445, LIM_Mical_like_2, This domain belongs to the LIM domain family which are found on Mical (molecule interacting with CasL) like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188786 cd09402, LIM1_CRP, The first LIM domain of Cysteine Rich Protein (CRP) | Back alignment and domain information |
|---|
| >gnl|CDD|188787 cd09403, LIM2_CRP, The second LIM domain of Cysteine Rich Protein (CRP) | Back alignment and domain information |
|---|
| >gnl|CDD|188869 cd09485, LIM_Eplin_alpha_beta, The Lim domain of Epithelial Protein Lost in Neoplasm (Eplin) | Back alignment and domain information |
|---|
| >gnl|CDD|188863 cd09479, LIM1_CRP1, The first LIM domain of Cysteine Rich Protein 1 (CRP1) | Back alignment and domain information |
|---|
| >gnl|CDD|188861 cd09477, LIM2_TLP, The second LIM domain of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188870 cd09486, LIM_Eplin_like_1, a LIM domain subfamily on a group of proteins with unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|188824 cd09440, LIM1_SF3, The first Lim domain of pollen specific protein SF3 | Back alignment and domain information |
|---|
| >gnl|CDD|188712 cd09326, LIM_CRP_like, The LIM domains of Cysteine Rich Protein (CRP) family | Back alignment and domain information |
|---|
| >gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin | Back alignment and domain information |
|---|
| >gnl|CDD|188780 cd09394, LIM1_Rga, The first LIM domain of Rga GTPase-Activating Proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188862 cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich Intestinal Protein (CRIP) | Back alignment and domain information |
|---|
| >gnl|CDD|188827 cd09443, LIM_Ltd-1, The LIM domain of LIM and transglutaminase domains protein (Ltd-1) | Back alignment and domain information |
|---|
| >gnl|CDD|188825 cd09441, LIM2_SF3, The second Lim domain of pollen specific protein SF3 | Back alignment and domain information |
|---|
| >gnl|CDD|188864 cd09480, LIM1_CRP2, The first LIM domain of Cysteine Rich Protein 2 (CRP2) | Back alignment and domain information |
|---|
| >gnl|CDD|188860 cd09476, LIM1_TLP, The first LIM domain of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188830 cd09446, LIM_N_RAP, The LIM domain of N-RAP | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 271 | |||
| KOG2272|consensus | 332 | 99.58 | ||
| KOG1701|consensus | 468 | 99.53 | ||
| KOG1044|consensus | 670 | 99.41 | ||
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 99.37 | |
| KOG1701|consensus | 468 | 99.2 | ||
| KOG1703|consensus | 479 | 98.99 | ||
| KOG4577|consensus | 383 | 98.98 | ||
| KOG2272|consensus | 332 | 98.9 | ||
| KOG1700|consensus | 200 | 98.89 | ||
| COG0722 | 351 | AroG 3-deoxy-D-arabino-heptulosonate 7-phosphate ( | 98.73 | |
| KOG1702|consensus | 264 | 98.64 | ||
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 98.6 | |
| KOG1700|consensus | 200 | 98.59 | ||
| KOG1703|consensus | 479 | 98.54 | ||
| TIGR00034 | 344 | aroFGH phospho-2-dehydro-3-deoxyheptonate aldolase | 98.37 | |
| PRK12756 | 348 | phospho-2-dehydro-3-deoxyheptonate aldolase; Provi | 98.36 | |
| PRK12755 | 353 | phospho-2-dehydro-3-deoxyheptonate aldolase; Provi | 98.33 | |
| PRK12822 | 356 | phospho-2-dehydro-3-deoxyheptonate aldolase; Provi | 98.31 | |
| PRK09261 | 349 | phospho-2-dehydro-3-deoxyheptonate aldolase; Valid | 98.23 | |
| KOG1044|consensus | 670 | 98.18 | ||
| KOG4577|consensus | 383 | 97.76 | ||
| PF00793 | 270 | DAHP_synth_1: DAHP synthetase I family; InterPro: | 96.63 | |
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 89.46 | |
| PRK13398 | 266 | 3-deoxy-7-phosphoheptulonate synthase; Provisional | 88.77 | |
| PRK13396 | 352 | 3-deoxy-7-phosphoheptulonate synthase; Provisional | 87.9 | |
| KOG0490|consensus | 235 | 85.51 | ||
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 85.08 | |
| PF09943 | 101 | DUF2175: Uncharacterized protein conserved in arch | 81.48 |
| >KOG2272|consensus | Back alignment and domain information |
|---|
Probab=99.58 E-value=9.4e-17 Score=146.89 Aligned_cols=109 Identities=21% Similarity=0.413 Sum_probs=97.7
Q ss_pred CCcCCCcccccCceeecceeEEeeCceeccccccccccCCccCCcCeeecCCCeeeccCCCCCcccccCC-----CCCCC
Q psy11691 91 GSLKLNSCSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEVCPDEEERSLTD-----PLRSS 165 (271)
Q Consensus 91 g~~~s~kCa~Cgk~V~~~ErI~a~gk~wH~~CFrC~~C~k~L~s~~f~~~~dG~~yCk~CY~~~~~~I~~-----rc~~~ 165 (271)
-+.+++.|+.|+++| .++.|.+++.+||+.||+|..|++.|.+..|+.. .|+.+|..|.++..+.+.+ +|++.
T Consensus 69 ~~LfaPcC~kC~EFi-iGrVikamnnSwHp~CF~Cd~Cn~~Lad~gf~rn-qgr~LC~~Cn~k~Ka~~~g~YvC~KCh~~ 146 (332)
T KOG2272|consen 69 HVLFAPCCGKCGEFI-IGRVIKAMNNSWHPACFRCDLCNKHLADQGFYRN-QGRALCRECNQKEKAKGRGRYVCQKCHAH 146 (332)
T ss_pred hhhhchhhcccccch-hhHHHHhhccccCcccchhHHHHHHHhhhhhHhh-cchHHhhhhhhhhcccccceeehhhhhhh
Confidence 345789999999999 7999999999999999999999999999999885 7999999999988776654 48887
Q ss_pred CCCCCceeecCccccCCCCCCCCCCcccCCCCCCccccchhcchhhhhh
Q psy11691 166 DRPDGHHAIGDDRYHAELNSDKSTNLLTDSEPSTHCDSNLVTASVESTN 214 (271)
Q Consensus 166 ~~~~~~I~~gg~~YH~ecFs~ks~~ll~d~~p~~~c~~~~~~~~~e~~~ 214 (271)
++. +++++.|++||++||+ ++.|.++|++++||.-.
T Consensus 147 iD~-~~l~fr~d~yH~yHFk------------Ct~C~keL~sdaRevk~ 182 (332)
T KOG2272|consen 147 IDE-QPLTFRGDPYHPYHFK------------CTTCGKELTSDAREVKG 182 (332)
T ss_pred ccc-ccccccCCCCCcccee------------cccccccccchhhhhcc
Confidence 776 7899999999999999 99999999999998654
|
|
| >KOG1701|consensus | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1701|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >COG0722 AroG 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >TIGR00034 aroFGH phospho-2-dehydro-3-deoxyheptonate aldolase | Back alignment and domain information |
|---|
| >PRK12756 phospho-2-dehydro-3-deoxyheptonate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK12755 phospho-2-dehydro-3-deoxyheptonate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK12822 phospho-2-dehydro-3-deoxyheptonate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK09261 phospho-2-dehydro-3-deoxyheptonate aldolase; Validated | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >PF00793 DAHP_synth_1: DAHP synthetase I family; InterPro: IPR006218 Members of the 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthetase family catalyse the first step in aromatic amino acid biosynthesis from chorismate | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF09943 DUF2175: Uncharacterized protein conserved in archaea (DUF2175); InterPro: IPR018686 This family of various hypothetical archaeal proteins has no known function | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 271 | ||||
| 2co8_A | 82 | Solution Structures Of The Lim Domain Of Human Nedd | 2e-06 | ||
| 2o13_A | 58 | Solution Structure Of The C-Terminal Lim Domain Of | 6e-05 | ||
| 1cxx_A | 113 | Mutant R122a Of Quail Cysteine And Glycine-Rich Pro | 2e-04 | ||
| 2o10_A | 60 | Solution Structure Of The N-Terminal Lim Domain Of | 3e-04 | ||
| 1qli_A | 113 | Quail Cysteine And Glycine-Rich Protein, Nmr, 15 Mi | 3e-04 | ||
| 1a7i_A | 81 | Amino-Terminal Lim Domain From Quail Cysteine And G | 3e-04 |
| >pdb|2CO8|A Chain A, Solution Structures Of The Lim Domain Of Human Nedd9 Interacting Protein With Calponin Homology And Lim Domains Length = 82 | Back alignment and structure |
|
| >pdb|2O13|A Chain A, Solution Structure Of The C-Terminal Lim Domain Of MlpCRP3 Length = 58 | Back alignment and structure |
| >pdb|1CXX|A Chain A, Mutant R122a Of Quail Cysteine And Glycine-Rich Protein, Nmr, Minimized Structure Length = 113 | Back alignment and structure |
| >pdb|2O10|A Chain A, Solution Structure Of The N-Terminal Lim Domain Of MlpCRP3 Length = 60 | Back alignment and structure |
| >pdb|1QLI|A Chain A, Quail Cysteine And Glycine-Rich Protein, Nmr, Minimized Average Structure Length = 113 | Back alignment and structure |
| >pdb|1A7I|A Chain A, Amino-Terminal Lim Domain From Quail Cysteine And Glycine- Rich Protein, Nmr, Minimized Average Structure Length = 81 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 271 | |||
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 3e-12 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 8e-12 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 1e-10 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 1e-10 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 2e-10 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 6e-09 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 7e-08 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 1e-07 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 2e-07 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 1e-06 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 1e-06 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 2e-06 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 2e-05 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 2e-05 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 2e-05 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 3e-05 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 4e-05 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 4e-05 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 6e-05 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 8e-05 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 2e-04 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 4e-04 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 4e-04 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 4e-04 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 5e-04 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 5e-04 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 7e-04 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 9e-04 |
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 | Back alignment and structure |
|---|
Score = 60.2 bits (146), Expect = 3e-12
Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
Query: 98 CSLCGEKVYLAQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEVC 150
C C + VY +R N ++FH +CF+C+ C ++L+ Y + G+ C+
Sbjct: 18 CVECQKTVYPMERLLANQQVFHISCFRCSYCNNKLSLGT-YASLHGRIYCKPH 69
|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 271 | |||
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.78 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 99.73 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 99.67 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 99.66 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.65 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.65 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.64 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.63 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 99.62 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 99.56 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 99.52 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.52 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 99.51 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.51 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 99.51 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 99.51 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 99.5 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 99.5 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 99.5 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 99.49 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 99.48 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 99.48 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 99.48 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 99.47 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 99.46 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 99.45 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 99.45 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 99.44 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 99.44 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 99.43 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 99.43 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 99.42 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 99.42 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 99.39 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 99.39 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 99.38 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 99.38 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 99.38 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 99.37 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 99.37 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 99.36 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 99.32 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 99.3 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 99.02 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 98.99 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 98.95 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 98.94 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 98.92 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 98.51 | |
| 3tqk_A | 346 | Phospho-2-dehydro-3-deoxyheptonate aldolase; trans | 98.11 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 98.1 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 97.95 | |
| 1of8_A | 370 | Phospho-2-dehydro-3-deoxyheptonate aldolase, tyros | 97.87 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 97.86 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 97.84 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 97.8 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 97.79 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 97.74 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 97.74 | |
| 1n8f_A | 350 | DAHP synthetase; (beta/alpha)8 barrel, metal bindi | 97.7 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 97.68 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 95.17 | |
| 3fs2_A | 298 | 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, | 95.07 | |
| 3tml_A | 288 | 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, | 94.49 | |
| 3sz8_A | 285 | 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgci | 94.32 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 93.29 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 93.22 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 93.05 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 92.69 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 92.33 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 92.3 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 92.28 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 91.91 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 91.88 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 91.55 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 91.53 | |
| 2qkf_A | 280 | 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; | 91.46 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 91.42 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 91.07 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 90.95 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 90.83 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 90.83 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 90.76 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 90.67 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 90.51 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 90.23 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 90.22 | |
| 1o60_A | 292 | 2-dehydro-3-deoxyphosphooctonate aldolase; structu | 89.79 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 89.55 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 89.38 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 89.12 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 87.47 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 84.25 |
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
Probab=99.78 E-value=1.6e-19 Score=139.95 Aligned_cols=97 Identities=19% Similarity=0.385 Sum_probs=85.3
Q ss_pred CcCCCcccccCceeec-ceeEEeeCceeccccccccccCCccCCcCeeecCCCeeeccCCCCCcccccCCCCCCCCCCC-
Q psy11691 92 SLKLNSCSLCGEKVYL-AQRFAFNARLFHRTCFKCARCQSQLTCINAYETHTGQFCCEVCPDEEERSLTDPLRSSDRPD- 169 (271)
Q Consensus 92 ~~~s~kCa~Cgk~V~~-~ErI~a~gk~wH~~CFrC~~C~k~L~s~~f~~~~dG~~yCk~CY~~~~~~I~~rc~~~~~~~- 169 (271)
+.++++|++|++.|+. ++.+.++++.||.+||+|..|+++|.+..|+.. ++.+||+.||.+.+.+....|...+.++
T Consensus 2 s~~~~~C~~C~~~I~~~~~~~~a~~~~~H~~CF~C~~C~~~L~~~~~~~~-~g~~yC~~cy~~~~~~~C~~C~~~I~~~~ 80 (101)
T 2cup_A 2 SSGSSGCVECRKPIGADSKEVHYKNRFWHDTCFRCAKCLHPLANETFVAK-DNKILCNKCTTREDSPKCKGCFKAIVAGD 80 (101)
T ss_dssp CSCCCBCSSSCCBCCSSSCEEEETTEEEETTTCCCSSSCCCTTSSCCEEE-TTEEECHHHHTTCCCCBCSSSCCBCCSSS
T ss_pred CCCCCcCcccCCcccCCceEEEECccChhhcCCcccccCCCCCcCeeECc-CCEEEChhHhhhhcCCccccCCCccccCC
Confidence 3457899999999975 778999999999999999999999998889886 7999999999999998888888877765
Q ss_pred CceeecCccccCCCCCCCCC
Q psy11691 170 GHHAIGDDRYHAELNSDKST 189 (271)
Q Consensus 170 ~~I~~gg~~YH~ecFs~ks~ 189 (271)
..|.+.|..||++||.|..+
T Consensus 81 ~~~~a~~~~~H~~CF~C~~C 100 (101)
T 2cup_A 81 QNVEYKGTVWHKDCFSGPSS 100 (101)
T ss_dssp CEEESSSCEEETTTCCCTTC
T ss_pred eEEEeCCcchHHhCCCCCCC
Confidence 45778999999999997654
|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
| >3tqk_A Phospho-2-dehydro-3-deoxyheptonate aldolase; transferase; 2.30A {Francisella tularensis} | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1of8_A Phospho-2-dehydro-3-deoxyheptonate aldolase, tyrosine-inhibited; beta-alpha-barrel, lyase, synthase, synthetase; HET: PEP G3P; 1.5A {Saccharomyces cerevisiae} SCOP: c.1.10.4 PDB: 1oab_A* 1of6_A* 1hfb_A* 1ofa_A* 1ofb_A 1ofo_A 1ofp_A 1ofq_A 1ofr_A* 1og0_A* | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1n8f_A DAHP synthetase; (beta/alpha)8 barrel, metal binding protein; HET: PEP; 1.75A {Escherichia coli} SCOP: c.1.10.4 PDB: 1gg1_A 1kfl_A* 1qr7_A* | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3fs2_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, bruciellla melitensis, DAHP synthetase I, cytoplasm, lipopolysaccharide biosynthesis; HET: PG4; 1.85A {Brucella melitensis} | Back alignment and structure |
|---|
| >3tml_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.90A {Burkholderia cenocepacia} PDB: 3t4c_A | Back alignment and structure |
|---|
| >3sz8_A 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Burkholderia pseudomallei} PDB: 3tmq_A* 3und_A* | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2qkf_A 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; manno-octulosonate, synthase, lipopolysaccharide, KDOP, KDO8 KDO8PS; 1.75A {Neisseria meningitidis serogroup B} PDB: 3stf_A 3qpy_A 3ste_A 3qpz_A 3qq0_A 3fyo_A* 3qq1_A 3fyp_A* 3stc_A 3stg_A 1phw_A 1g7v_A* 1gg0_A 1phq_A* 1d9e_A 1pl9_A* 1q3n_A* 1x6u_A* 1x8f_A 1g7u_A* | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1o60_A 2-dehydro-3-deoxyphosphooctonate aldolase; structural genomics, transferase; 1.80A {Haemophilus influenzae} SCOP: c.1.10.4 PDB: 3e9a_A | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 271 | ||||
| d2d8ya1 | 35 | g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapien | 2e-05 | |
| d1b8ta3 | 43 | g.39.1.3 (A:101-143) Cysteine-rich (intestinal) pr | 3e-05 | |
| d2co8a2 | 36 | g.39.1.3 (A:8-43) Nedd9 interacting protein with c | 3e-05 | |
| d1b8ta1 | 35 | g.39.1.3 (A:1-35) Cysteine-rich (intestinal) prote | 0.001 | |
| d1a7ia1 | 28 | g.39.1.3 (A:8-35) Cysteine-rich (intestinal) prote | 0.002 |
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: Eplin, LIMA1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 38.2 bits (89), Expect = 2e-05
Identities = 10/26 (38%), Positives = 15/26 (57%)
Query: 98 CSLCGEKVYLAQRFAFNARLFHRTCF 123
C C + VY +R N ++FH +CF
Sbjct: 10 CVECQKTVYPMERLLANQQVFHISCF 35
|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 43 | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 35 | Back information, alignment and structure |
|---|
| >d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Length = 28 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 271 | |||
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 99.06 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.86 | |
| d1of8a_ | 346 | 3-deoxy-D-arabino-heptulosonate-7-phosphate syntha | 98.68 | |
| d1n8fa_ | 343 | 3-deoxy-D-arabino-heptulosonate-7-phosphate syntha | 98.61 | |
| d2d8ya1 | 35 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 98.59 | |
| d2co8a2 | 36 | Nedd9 interacting protein with calponin homology, | 98.53 | |
| d2cu8a1 | 30 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 98.48 | |
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.37 | |
| d1zfoa_ | 30 | LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | 98.36 | |
| d1ibia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 98.26 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.16 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 98.08 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 98.0 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.99 | |
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 97.99 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.89 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.86 | |
| d1a7ia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.81 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 97.81 | |
| d1x4ka2 | 27 | Four and a half LIM domains protein 2, FHL2 {Human | 97.75 | |
| d1b8ta1 | 35 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.74 | |
| d1wyha2 | 27 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.66 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 97.62 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.55 | |
| d2cu8a2 | 33 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 97.48 | |
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.44 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.39 | |
| d2d8ya2 | 42 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 97.33 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 97.27 | |
| d1a7ia2 | 32 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.27 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 97.19 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.09 | |
| d1rutx1 | 30 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.03 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 96.89 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 96.87 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 96.78 | |
| d1x4la1 | 29 | Four and a half LIM domains protein 2, FHL2 {Human | 96.71 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 96.68 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 96.6 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 96.58 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 96.58 | |
| d2d8za2 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 96.5 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 96.5 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 96.45 | |
| d1x68a1 | 29 | Four and a half LIM domains protein 5, FHL-5 {Huma | 96.36 | |
| d2cuqa1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 96.3 | |
| d2cupa3 | 27 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.17 | |
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 96.11 | |
| d1u5sb2 | 35 | Pinch (particularly interesting new Cys-His) prote | 96.03 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 95.94 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 95.93 | |
| d2cura1 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 95.91 | |
| d2cora2 | 35 | Pinch (particularly interesting new Cys-His) prote | 95.9 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 95.68 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 95.37 | |
| d1x61a2 | 32 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 95.13 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 95.1 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 94.81 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 94.27 | |
| d1x63a2 | 32 | Four and a half LIM domains protein 1, FHL-1 {Huma | 94.1 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 93.6 | |
| d1x61a1 | 27 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 92.46 | |
| d2co8a1 | 33 | Nedd9 interacting protein with calponin homology, | 92.15 | |
| d2d8xa1 | 32 | Pinch (particularly interesting new Cys-His) prote | 92.07 | |
| d2cupa2 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 91.74 | |
| d1g47a1 | 35 | Pinch (particularly interesting new Cys-His) prote | 91.58 | |
| d1wiga2 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 90.53 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 88.74 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 88.45 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 87.79 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 87.5 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 87.12 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 86.89 | |
| d2cora1 | 31 | Pinch (particularly interesting new Cys-His) prote | 85.15 | |
| d1x64a2 | 31 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 84.81 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 84.69 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 83.34 | |
| d1x68a2 | 34 | Four and a half LIM domains protein 5, FHL-5 {Huma | 81.96 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 81.62 |
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: Cysteine-rich (intestinal) protein, CRP, CRIP species: Chicken (Gallus gallus) [TaxId: 9031]
Probab=99.06 E-value=1.6e-11 Score=88.58 Aligned_cols=38 Identities=24% Similarity=0.269 Sum_probs=36.1
Q ss_pred chhhhhccCCcc-ccccccCCccccccccccCCCccCccccCCC
Q psy11691 11 KHYQRSYLGGAV-VNALDFGSGVAAARYLFHSIDLGDQLTNSNT 53 (271)
Q Consensus 11 ~~~~~~~~~~~~-~~~~g~g~~~g~~~~~~~s~d~g~~~~~~~~ 53 (271)
++||++||++.| |||||||+|||+ ||||+|+++++.++
T Consensus 20 e~YCk~CY~k~fGPkG~G~G~gag~-----l~~d~g~~~g~~~~ 58 (65)
T d1b8ta2 20 EIYCKSCYGKKYGPKGKGKGMGAGT-----LSTDKGESLGIKYE 58 (65)
T ss_dssp EEEEHHHHHHHHSCCCCCCCCCCCC-----CCCCCCCCCCCCCC
T ss_pred cccchhhhccccCCCccccccccce-----eeecccccCCcCCC
Confidence 799999999999 999999999999 99999999998763
|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1of8a_ c.1.10.4 (A:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Baker's yeast (Saccharomyces cerevisiae), tyrosine-regulated isozyme [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1n8fa_ c.1.10.4 (A:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Escherichia coli, phenylalanine-regulated isozyme [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a1 g.39.1.3 (A:44-76) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|