Psyllid ID: psy1177

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280---
MQVKYVTQKWRLERTVAEGAPVIPISAQLKYNIEVLCEYITKKIPIPIRDFTSSPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILRGVLKVGMEIEVRPGLVSKDSEGKLTCKPIFSRIVSLFAEQNELQFAVPGGLIGVGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRMEGDKKGAKVQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVCTEVNEKIALSRRVEKHWSWIEGTVSAKVLSTRKRSSLSPNVGIIPHAS
cHHHHHHHHHHHHHcccccccEEEccccccccHHHHHHHHHHHcccccccccccccEEEEEEcccccccccccccccEEEEEEEEEEEEEcccEEEEEccEEEEcccccEEEEEEEEEEEEEEEccccccEEEcccEEEccccccccEEEEEEEEEEEEEEcccccccEEEEEEEEEEEEEEEcccccccccccEEcccccccEEEEEEccccccEEEEEEcccEEEEEEEccEEcccccEEEEEEEccccEEEEEEEEEcEEEEEEEcEEcccccccccccc
cHHHHHHHHHHHHccccccccEEEHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEEcccccccHHHccccEcccEEEEEEEEcccEEEEEccEEEEcccccEEEEEEEEEEEEEEccccccEEEccccEEEEcccccccccHHcHcccHEcccccccccHEEEEEEEHHHHHHHccEEEccccccEEEEEcccccEEEEEEccccccEEEEEEccccEEEEEcccEEcccccEEEEEEcHcccEEEEEcEEEcccEcccccccccccEEEEEccc
MQVKYVTQKWRLertvaegapvipisaQLKYNIEVLCEYItkkipipirdftssprlivirsfdvnkpgcevddlkggvaggSILRGVLKVGMeievrpglvskdsegkltckpIFSRIVSLFAEQNelqfavpggligvgtkieptlcrADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVrmegdkkgakvqkLTRNEVLLVNIgslstggrvlATKADlakisltnpvctevNEKIALSRRVEKHWSWIEGTVSAKVLstrkrsslspnvgiiphas
mqvkyvtqkwrlertvaegapvipisaqLKYNIEVLCEYITkkipipirdftsspRLIVIRSfdvnkpgcevddlkggvagGSILRGVLKVGMEIEVrpglvskdsegkltCKPIFSRIVSLFAEQNELQFAVPGGLIGVGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRMEGDkkgakvqkltrnevllvnigslstggrVLATKADlakisltnpvctevnEKIALsrrvekhwswiegtvsakvlstrkrsslspnvgiiphas
MQVKYVTQKWRLERTVAEGAPVIPISAQLKYNIEVLCEYITKKIPIPIRDFTSSPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILRGVLKVGMEIEVRPGLVSKDSEGKLTCKPIFSRIVSLFAEQNELQFAVPGGLIGVGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRMEGDKKGAKVQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVCTEVNEKIALSRRVEKHWSWIEGTVSAKVLSTRKRSSLSPNVGIIPHAS
****YVTQKWRLERTVAEGAPVIPISAQLKYNIEVLCEYITKKIPIPIRDFTSSPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILRGVLKVGMEIEVRPGLVSKDSEGKLTCKPIFSRIVSLFAEQNELQFAVPGGLIGVGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRMEGDKKGAKVQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVCTEVNEKIALSRRVEKHWSWIEGTVSAKVL*******************
***KYVTQKWRLERTVAEGAPVIPISAQLKYNIEVLCEYITKKIPIPIRDFTSSPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILRGVLKVGMEIEVRPGLVSKDSEGKLTCKPIFSRIVSLFAEQNELQFAVPGGLIGVGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRMEGDKKGAKVQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVCTEVNEKIALSRRVEKHWSWIEGTVSAKVLSTRKRSSL***********
MQVKYVTQKWRLERTVAEGAPVIPISAQLKYNIEVLCEYITKKIPIPIRDFTSSPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILRGVLKVGMEIEVRPGLVSKDSEGKLTCKPIFSRIVSLFAEQNELQFAVPGGLIGVGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRME********QKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVCTEVNEKIALSRRVEKHWSWIEGTVSAKVLSTRKRSSLSPNVGIIPHAS
MQVKYVTQKWRLERTVAEGAPVIPISAQLKYNIEVLCEYITKKIPIPIRDFTSSPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILRGVLKVGMEIEVRPGLVSKDSEGKLTCKPIFSRIVSLFAEQNELQFAVPGGLIGVGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRMEGDKKGAKVQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVCTEVNEKIALSRRVEKHWSWIEGTVSAKVLSTRKRSSLSPNVGIIPH**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQVKYVTQKWRLERTVAEGAPVIPISAQLKYNIEVLCEYITKKIPIPIRDFTSSPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILRGVLKVGMEIEVRPGLVSKDSEGKLTCKPIFSRIVSLFAEQNELQFAVPGGLIGVGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRMEGDKKGAKVQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVCTEVNEKIALSRRVEKHWSWIEGTVSAKVLSTRKRSSLSPNVGIIPHAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query283 2.2.26 [Sep-21-2011]
Q5ZMS3472 Eukaryotic translation in yes N/A 0.862 0.516 0.848 1e-119
P41091472 Eukaryotic translation in yes N/A 0.862 0.516 0.852 1e-119
P81795472 Eukaryotic translation in yes N/A 0.862 0.516 0.852 1e-119
Q2KHU8472 Eukaryotic translation in yes N/A 0.862 0.516 0.852 1e-119
Q9Z0N2472 Eukaryotic translation in yes N/A 0.862 0.516 0.848 1e-118
Q9Z0N1472 Eukaryotic translation in yes N/A 0.862 0.516 0.852 1e-118
Q5R797472 Eukaryotic translation in yes N/A 0.862 0.516 0.848 1e-118
Q2VIR3472 Putative eukaryotic trans yes N/A 0.862 0.516 0.840 1e-117
Q24208475 Eukaryotic translation in yes N/A 0.862 0.513 0.811 1e-113
Q09130446 Eukaryotic translation in yes N/A 0.848 0.538 0.717 1e-101
>sp|Q5ZMS3|IF2G_CHICK Eukaryotic translation initiation factor 2 subunit 3 OS=Gallus gallus GN=EIF2S3 PE=1 SV=1 Back     alignment and function desciption
 Score =  426 bits (1095), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 207/244 (84%), Positives = 226/244 (92%)

Query: 12  LERTVAEGAPVIPISAQLKYNIEVLCEYITKKIPIPIRDFTSSPRLIVIRSFDVNKPGCE 71
           ++ TVAEGAP+IPISAQLKY+IEV+CEYI KKIP+P+RDFTS PRLIVIRSFDVNKPGCE
Sbjct: 211 VQGTVAEGAPIIPISAQLKYSIEVVCEYIVKKIPVPLRDFTSEPRLIVIRSFDVNKPGCE 270

Query: 72  VDDLKGGVAGGSILRGVLKVGMEIEVRPGLVSKDSEGKLTCKPIFSRIVSLFAEQNELQF 131
           VDDLKGGVAGGSIL+GVLKVG EIEVRPG+VSKDSEGKL CKPIFS+IVSLFAE N+LQ+
Sbjct: 271 VDDLKGGVAGGSILKGVLKVGQEIEVRPGIVSKDSEGKLMCKPIFSKIVSLFAEHNDLQY 330

Query: 132 AVPGGLIGVGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRMEGDK 191
           A PGGLIGVGTKI+PTLCRADR+VGQVLGAVGALP+IF ELEISY LL+RLLGVR EGDK
Sbjct: 331 AAPGGLIGVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDK 390

Query: 192 KGAKVQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVCTEVNEKIALSRRVEKH 251
           K AKVQKL++NEVL+VNIGSLSTGGRV A KADL KI LTNPVCTEV EKIALSRRVEKH
Sbjct: 391 KAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKH 450

Query: 252 WSWI 255
           W  I
Sbjct: 451 WRLI 454
eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.
Gallus gallus (taxid: 9031)
>sp|P41091|IF2G_HUMAN Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens GN=EIF2S3 PE=1 SV=3 Back     alignment and function description
>sp|P81795|IF2G_RAT Eukaryotic translation initiation factor 2 subunit 3 OS=Rattus norvegicus GN=Eif2s3 PE=1 SV=2 Back     alignment and function description
>sp|Q2KHU8|IF2G_BOVIN Eukaryotic translation initiation factor 2 subunit 3 OS=Bos taurus GN=EIF2S3 PE=2 SV=1 Back     alignment and function description
>sp|Q9Z0N2|IF2H_MOUSE Eukaryotic translation initiation factor 2 subunit 3, Y-linked OS=Mus musculus GN=Eif2s3y PE=2 SV=2 Back     alignment and function description
>sp|Q9Z0N1|IF2G_MOUSE Eukaryotic translation initiation factor 2 subunit 3, X-linked OS=Mus musculus GN=Eif2s3x PE=1 SV=2 Back     alignment and function description
>sp|Q5R797|IF2G_PONAB Eukaryotic translation initiation factor 2 subunit 3 OS=Pongo abelii GN=EIF2S3 PE=2 SV=1 Back     alignment and function description
>sp|Q2VIR3|IF2GL_HUMAN Putative eukaryotic translation initiation factor 2 subunit 3-like protein OS=Homo sapiens GN=EIF2S3L PE=5 SV=2 Back     alignment and function description
>sp|Q24208|IF2G_DROME Eukaryotic translation initiation factor 2 subunit 3 OS=Drosophila melanogaster GN=Su(var)3-9 PE=2 SV=1 Back     alignment and function description
>sp|Q09130|IF2G_SCHPO Eukaryotic translation initiation factor 2 subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif213 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query283
340727719 1082 PREDICTED: hypothetical protein LOC10065 0.851 0.222 0.937 1e-127
156537626 473 PREDICTED: eukaryotic translation initia 0.862 0.515 0.930 1e-127
383859816 1055 PREDICTED: uncharacterized protein LOC10 0.851 0.228 0.937 1e-127
283837917 473 suppressor of variegation 3-9 isoform 2 0.862 0.515 0.926 1e-127
307168244 629 Eukaryotic translation initiation factor 0.862 0.387 0.909 1e-125
322801503 979 hypothetical protein SINV_12284 [Solenop 0.862 0.249 0.909 1e-125
51965696 473 translation initiation factor 2 gamma su 0.851 0.509 0.925 1e-124
51965692 473 translation initiation factor 2 gamma su 0.862 0.515 0.909 1e-124
9409732 473 eukaryotic translation initiation factor 0.862 0.515 0.893 1e-123
9409731 947 heterochromatin protein [Clytus arietis] 0.851 0.254 0.904 1e-123
>gi|340727719|ref|XP_003402185.1| PREDICTED: hypothetical protein LOC100651661 [Bombus terrestris] Back     alignment and taxonomy information
 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 226/241 (93%), Positives = 236/241 (97%)

Query: 15   TVAEGAPVIPISAQLKYNIEVLCEYITKKIPIPIRDFTSSPRLIVIRSFDVNKPGCEVDD 74
            TVAEGAPVIPISAQLKYNIEVLCEYITKKIP+P+RDFTS PRLIVIRSFDVNKPGCEVDD
Sbjct: 824  TVAEGAPVIPISAQLKYNIEVLCEYITKKIPVPLRDFTSEPRLIVIRSFDVNKPGCEVDD 883

Query: 75   LKGGVAGGSILRGVLKVGMEIEVRPGLVSKDSEGKLTCKPIFSRIVSLFAEQNELQFAVP 134
            LKGGVAGGSILRGVLKVGMEIEVRPGLVSKDSEGKLTC+PIFSRIVSLFAEQNELQFAVP
Sbjct: 884  LKGGVAGGSILRGVLKVGMEIEVRPGLVSKDSEGKLTCRPIFSRIVSLFAEQNELQFAVP 943

Query: 135  GGLIGVGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRMEGDKKGA 194
            GGLIGVGTKIEPTLCRADRLVGQ+LGAVGALPKIFIELEISY+LLKRLLGVR EGDKKGA
Sbjct: 944  GGLIGVGTKIEPTLCRADRLVGQILGAVGALPKIFIELEISYYLLKRLLGVRTEGDKKGA 1003

Query: 195  KVQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVCTEVNEKIALSRRVEKHWSW 254
            +V KL+RNEVLLVNIGSLSTGGRVLAT+ADLAKISLTNPVCTE++EKIALSRRVEKHW  
Sbjct: 1004 RVPKLSRNEVLLVNIGSLSTGGRVLATRADLAKISLTNPVCTEIDEKIALSRRVEKHWRL 1063

Query: 255  I 255
            I
Sbjct: 1064 I 1064

Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|156537626|ref|XP_001607783.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 3, Y-linked-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383859816|ref|XP_003705388.1| PREDICTED: uncharacterized protein LOC100876321 [Megachile rotundata] Back     alignment and taxonomy information
>gi|283837917|ref|NP_001164640.1| suppressor of variegation 3-9 isoform 2 [Apis mellifera] gi|350412047|ref|XP_003489527.1| PREDICTED: eukaryotic translation initiation factor 2 subunit 3, Y-linked-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307168244|gb|EFN61470.1| Eukaryotic translation initiation factor 2 subunit 3 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322801503|gb|EFZ22164.1| hypothetical protein SINV_12284 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|51965696|emb|CAG29670.1| translation initiation factor 2 gamma subunit [Forficula auricularia] Back     alignment and taxonomy information
>gi|51965692|emb|CAG29668.1| translation initiation factor 2 gamma subunit [Lepismachilis sp. VK-2004] Back     alignment and taxonomy information
>gi|9409732|emb|CAB98197.1| eukaryotic translation initiation factor 2 gamma [Clytus arietis] Back     alignment and taxonomy information
>gi|9409731|emb|CAB98196.1| heterochromatin protein [Clytus arietis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query283
UNIPROTKB|F1NPF0472 EIF2S3 "Eukaryotic translation 0.862 0.516 0.852 1.9e-108
MGI|MGI:1349430472 Eif2s3y "eukaryotic translatio 0.862 0.516 0.848 4.9e-108
UNIPROTKB|Q5ZMS3472 EIF2S3 "Eukaryotic translation 0.862 0.516 0.848 6.3e-108
UNIPROTKB|Q2KHU8472 EIF2S3 "Eukaryotic translation 0.862 0.516 0.852 6.3e-108
UNIPROTKB|E2RMK6472 EIF2S3 "Uncharacterized protei 0.862 0.516 0.852 6.3e-108
UNIPROTKB|P41091472 EIF2S3 "Eukaryotic translation 0.862 0.516 0.852 6.3e-108
UNIPROTKB|F1SPY4472 EIF2S3 "Eukaryotic translation 0.862 0.516 0.848 6.3e-108
UNIPROTKB|I3LUM9472 LOC100525970 "Uncharacterized 0.862 0.516 0.852 6.3e-108
MGI|MGI:1349431472 Eif2s3x "eukaryotic translatio 0.862 0.516 0.852 6.3e-108
RGD|1561279472 Eif2s3 "eukaryotic translation 0.862 0.516 0.852 6.3e-108
UNIPROTKB|F1NPF0 EIF2S3 "Eukaryotic translation initiation factor 2 subunit 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 1072 (382.4 bits), Expect = 1.9e-108, P = 1.9e-108
 Identities = 208/244 (85%), Positives = 226/244 (92%)

Query:    12 LERTVAEGAPVIPISAQLKYNIEVLCEYITKKIPIPIRDFTSSPRLIVIRSFDVNKPGCE 71
             ++ TVAEGAP+IPISAQLKYNIEV+CEYI KKIP+P+RDFTS PRLIVIRSFDVNKPGCE
Sbjct:   211 VQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPLRDFTSEPRLIVIRSFDVNKPGCE 270

Query:    72 VDDLKGGVAGGSILRGVLKVGMEIEVRPGLVSKDSEGKLTCKPIFSRIVSLFAEQNELQF 131
             VDDLKGGVAGGSIL+GVLKVG EIEVRPG+VSKDSEGKL CKPIFS+IVSLFAE N+LQ+
Sbjct:   271 VDDLKGGVAGGSILKGVLKVGQEIEVRPGIVSKDSEGKLMCKPIFSKIVSLFAEHNDLQY 330

Query:   132 AVPGGLIGVGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRMEGDK 191
             A PGGLIGVGTKI+PTLCRADR+VGQVLGAVGALP+IF ELEISY LL+RLLGVR EGDK
Sbjct:   331 AAPGGLIGVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDK 390

Query:   192 KGAKVQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVCTEVNEKIALSRRVEKH 251
             K AKVQKL++NEVL+VNIGSLSTGGRV A KADL KI LTNPVCTEV EKIALSRRVEKH
Sbjct:   391 KAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKH 450

Query:   252 WSWI 255
             W  I
Sbjct:   451 WRLI 454
GO:0003924 "GTPase activity" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
MGI|MGI:1349430 Eif2s3y "eukaryotic translation initiation factor 2, subunit 3, structural gene Y-linked" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMS3 EIF2S3 "Eukaryotic translation initiation factor 2 subunit 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KHU8 EIF2S3 "Eukaryotic translation initiation factor 2 subunit 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RMK6 EIF2S3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P41091 EIF2S3 "Eukaryotic translation initiation factor 2 subunit 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SPY4 EIF2S3 "Eukaryotic translation initiation factor 2 subunit 3" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LUM9 LOC100525970 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1349431 Eif2s3x "eukaryotic translation initiation factor 2, subunit 3, structural gene X-linked" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1561279 Eif2s3 "eukaryotic translation initiation factor 2, subunit 3 gamma" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q54XD8IF2G_DICDINo assigned EC number0.70080.85860.5282yesN/A
Q2KHU8IF2G_BOVINNo assigned EC number0.85240.86210.5169yesN/A
Q9Z0N1IF2G_MOUSENo assigned EC number0.85240.86210.5169yesN/A
Q9Z0N2IF2H_MOUSENo assigned EC number0.84830.86210.5169yesN/A
Q5ZMS3IF2G_CHICKNo assigned EC number0.84830.86210.5169yesN/A
Q09130IF2G_SCHPONo assigned EC number0.71780.84800.5381yesN/A
P32481IF2G_YEASTNo assigned EC number0.70950.84800.4554yesN/A
Q2VIR3IF2GL_HUMANNo assigned EC number0.84010.86210.5169yesN/A
Q24208IF2G_DROMENo assigned EC number0.81140.86210.5136yesN/A
P81795IF2G_RATNo assigned EC number0.85240.86210.5169yesN/A
Q5R797IF2G_PONABNo assigned EC number0.84830.86210.5169yesN/A
P41091IF2G_HUMANNo assigned EC number0.85240.86210.5169yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query283
PTZ00327460 PTZ00327, PTZ00327, eukaryotic translation initiat 1e-149
COG5257415 COG5257, GCD11, Translation initiation factor 2, g 1e-112
PRK04000411 PRK04000, PRK04000, translation initiation factor 3e-88
TIGR03680406 TIGR03680, eif2g_arch, translation initiation fact 2e-81
cd03688113 cd03688, eIF2_gamma_II, eIF2_gamma_II: this subfam 2e-69
pfam0917388 pfam09173, eIF2_C, Initiation factor eIF2 gamma, C 1e-34
cd01888197 cd01888, eIF2_gamma, Gamma subunit of initiation f 2e-14
cd0134283 cd01342, Translation_Factor_II_like, Translation_F 3e-06
pfam0314470 pfam03144, GTP_EFTU_D2, Elongation factor Tu domai 5e-06
>gnl|CDD|240362 PTZ00327, PTZ00327, eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information 
 Score =  425 bits (1094), Expect = e-149
 Identities = 166/242 (68%), Positives = 202/242 (83%), Gaps = 1/242 (0%)

Query: 15  TVAEGAPVIPISAQLKYNIEVLCEYITKKIPIPIRDFTSSPRLIVIRSFDVNKPGCEVDD 74
           T+A+ AP+IPISAQLKYNI+V+ EYI  +IPIP RD TS PR+IVIRSFDVNKPG ++++
Sbjct: 203 TIADNAPIIPISAQLKYNIDVVLEYICTQIPIPKRDLTSPPRMIVIRSFDVNKPGEDIEN 262

Query: 75  LKGGVAGGSILRGVLKVGMEIEVRPGLVSKDSEGKLTCKPIFSRIVSLFAEQNELQFAVP 134
           LKGGVAGGSIL+GVLKVG EIE+RPG++SKDS G+ TC+PI +RIVSLFAE NELQ+AVP
Sbjct: 263 LKGGVAGGSILQGVLKVGDEIEIRPGIISKDSGGEFTCRPIRTRIVSLFAENNELQYAVP 322

Query: 135 GGLIGVGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRMEGDKKGA 194
           GGLIGVGT I+PTL RADRLVGQVLG  G LP+++ E+EI Y+LL+RLLGV+ +  KK  
Sbjct: 323 GGLIGVGTTIDPTLTRADRLVGQVLGYPGKLPEVYAEIEIQYYLLRRLLGVKSQDGKKAT 382

Query: 195 KVQKLTRNEVLLVNIGSLSTGGRVLATKAD-LAKISLTNPVCTEVNEKIALSRRVEKHWS 253
           KV KL + E L++NIGS +TGGRV+  K D +AK+ LT PVCT V EKIALSRRV+KHW 
Sbjct: 383 KVAKLKKGESLMINIGSTTTGGRVVGIKDDGIAKLELTTPVCTSVGEKIALSRRVDKHWR 442

Query: 254 WI 255
            I
Sbjct: 443 LI 444

Length = 460
>gnl|CDD|227582 COG5257, GCD11, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|235194 PRK04000, PRK04000, translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>gnl|CDD|211860 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma Back     alignment and domain information
>gnl|CDD|239659 cd03688, eIF2_gamma_II, eIF2_gamma_II: this subfamily represents the domain II of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea Back     alignment and domain information
>gnl|CDD|150009 pfam09173, eIF2_C, Initiation factor eIF2 gamma, C terminal Back     alignment and domain information
>gnl|CDD|206675 cd01888, eIF2_gamma, Gamma subunit of initiation factor 2 (eIF2 gamma) Back     alignment and domain information
>gnl|CDD|238652 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>gnl|CDD|217388 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 283
COG5257415 GCD11 Translation initiation factor 2, gamma subun 100.0
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 100.0
KOG0466|consensus466 100.0
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 100.0
PRK04000411 translation initiation factor IF-2 subunit gamma; 100.0
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 100.0
KOG0460|consensus449 100.0
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 100.0
PRK12736394 elongation factor Tu; Reviewed 100.0
COG3276447 SelB Selenocysteine-specific translation elongatio 100.0
COG0050394 TufB GTPases - translation elongation factors [Tra 100.0
PRK12735396 elongation factor Tu; Reviewed 100.0
PRK00049396 elongation factor Tu; Reviewed 100.0
TIGR00485394 EF-Tu translation elongation factor TU. This align 100.0
PLN03126478 Elongation factor Tu; Provisional 100.0
PLN03127447 Elongation factor Tu; Provisional 100.0
PRK12317425 elongation factor 1-alpha; Reviewed 100.0
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 100.0
PTZ00141446 elongation factor 1- alpha; Provisional 100.0
CHL00071409 tufA elongation factor Tu 100.0
PLN00043447 elongation factor 1-alpha; Provisional 100.0
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 100.0
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 100.0
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 100.0
COG2895431 CysN GTPases - Sulfate adenylate transferase subun 100.0
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 100.0
cd03688113 eIF2_gamma_II eIF2_gamma_II: this subfamily repres 99.98
KOG0461|consensus522 99.96
COG5258527 GTPBP1 GTPase [General function prediction only] 99.92
KOG0459|consensus501 99.9
KOG0458|consensus603 99.9
cd0369391 EF1_alpha_II EF1_alpha_II: this family represents 99.86
cd0369883 eRF3_II_like eRF3_II_like: domain similar to domai 99.84
cd0369487 GTPBP_II Domain II of the GP-1 family of GTPase. T 99.83
cd0369787 EFTU_II EFTU_II: Elongation factor Tu domain II. E 99.82
cd0408982 eRF3_II eRF3_II: domain II of the eukaryotic class 99.82
cd0369683 selB_II selB_II: this subfamily represents the dom 99.78
cd0369581 CysN_NodQ_II CysN_NodQ_II: This subfamily represen 99.75
cd0409497 selB_III This family represents the domain of elon 99.71
PF0917388 eIF2_C: Initiation factor eIF2 gamma, C terminal; 99.7
KOG0463|consensus641 99.69
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.59
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.57
PRK05433 600 GTP-binding protein LepA; Provisional 99.51
PRK10218 607 GTP-binding protein; Provisional 99.48
cd0370693 mtEFTU_III Domain III of mitochondrial EF-TU (mtEF 99.38
cd0370790 EFTU_III Domain III of elongation factor (EF) Tu. 99.36
KOG1143|consensus591 99.35
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.34
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.34
PRK14845 1049 translation initiation factor IF-2; Provisional 99.28
cd0369284 mtIF2_IVc mtIF2_IVc: this family represents the C2 99.22
PRK04004 586 translation initiation factor IF-2; Validated 99.2
PRK05306 787 infB translation initiation factor IF-2; Validated 99.14
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.07
KOG0462|consensus 650 99.03
PF0314474 GTP_EFTU_D2: Elongation factor Tu domain 2; InterP 99.01
cd01513102 Translation_factor_III Domain III of Elongation fa 99.0
cd0134283 Translation_Factor_II_like Translation_Factor_II_l 98.99
PF0314399 GTP_EFTU_D3: Elongation factor Tu C-terminal domai 98.9
CHL00189 742 infB translation initiation factor 2; Provisional 98.88
cd0370887 GTPBP_III Domain III of the GP-1 family of GTPase. 98.86
COG1217 603 TypA Predicted membrane GTPase involved in stress 98.86
PF1457881 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1 98.85
PRK12740 668 elongation factor G; Reviewed 98.79
PRK13351 687 elongation factor G; Reviewed 98.74
PRK07560 731 elongation factor EF-2; Reviewed 98.74
cd04093107 HBS1_C HBS1_C: this family represents the C-termin 98.72
cd03705104 EF1_alpha_III Domain III of EF-1. Eukaryotic elong 98.7
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 98.56
cd04095103 CysN_NoDQ_III TCysN_NoDQ_II: This subfamily repres 98.52
cd03704108 eRF3c_III This family represents eEF1alpha-like C- 98.49
TIGR00503527 prfC peptide chain release factor 3. This translat 98.35
PRK00741526 prfC peptide chain release factor 3; Provisional 98.29
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 98.28
PRK12739 691 elongation factor G; Reviewed 98.28
PRK00007 693 elongation factor G; Reviewed 98.26
KOG1145|consensus 683 98.08
cd0408883 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represen 97.83
cd0409283 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondri 97.77
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 97.73
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 97.57
cd0409181 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondri 97.54
cd0369986 lepA_II lepA_II: This subfamily represents the dom 97.48
cd0369186 BipA_TypA_II BipA_TypA_II: domain II of BipA (also 97.45
KOG0052|consensus391 97.4
cd0368985 RF3_II RF3_II: this subfamily represents the domai 97.32
cd0369085 Tet_II Tet_II: This subfamily represents domain II 97.32
COG4108528 PrfC Peptide chain release factor RF-3 [Translatio 97.19
KOG0465|consensus 721 96.94
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 96.76
PRK05306787 infB translation initiation factor IF-2; Validated 96.61
cd0370093 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfami 96.3
CHL00189742 infB translation initiation factor 2; Provisional 96.27
cd03703110 aeIF5B_II aeIF5B_II: This family represents the do 96.11
cd0370295 IF2_mtIF2_II This family represents the domain II 95.86
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 95.78
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 95.37
cd0370195 IF2_IF5B_II IF2_IF5B_II: This family represents th 95.36
cd0409094 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C termina 95.31
PRK15467158 ethanolamine utilization protein EutP; Provisional 95.01
KOG1144|consensus 1064 95.01
PLN00116 843 translation elongation factor EF-2 subunit; Provis 94.24
TIGR00436270 era GTP-binding protein Era. Era is an essential G 94.23
PRK04004586 translation initiation factor IF-2; Validated 94.06
PTZ00416 836 elongation factor 2; Provisional 93.95
COG1159298 Era GTPase [General function prediction only] 93.66
PRK148451049 translation initiation factor IF-2; Provisional 93.46
PRK14664362 tRNA-specific 2-thiouridylase MnmA; Provisional 91.64
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 90.23
PRK15494339 era GTPase Era; Provisional 90.07
PRK09435332 membrane ATPase/protein kinase; Provisional 89.91
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 89.83
KOG0092|consensus200 87.99
PRK14665360 mnmA tRNA-specific 2-thiouridylase MnmA; Provision 87.92
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 87.53
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 86.33
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 85.95
PRK00143346 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed 85.9
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 85.67
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 85.45
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 85.36
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 85.19
KOG1144|consensus1064 85.09
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 85.02
PTZ00099176 rab6; Provisional 85.0
PRK09866 741 hypothetical protein; Provisional 83.84
PRK00089292 era GTPase Era; Reviewed 83.76
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 83.74
COG1160444 Predicted GTPases [General function prediction onl 83.45
PRK12298390 obgE GTPase CgtA; Reviewed 83.23
TIGR00420352 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-me 83.18
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 83.02
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 82.96
PRK12296500 obgE GTPase CgtA; Reviewed 82.51
PRK00093435 GTP-binding protein Der; Reviewed 82.14
PF03054356 tRNA_Me_trans: tRNA methyl transferase; InterPro: 81.4
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 81.2
KOG0469|consensus 842 81.06
PTZ00369189 Ras-like protein; Provisional 80.64
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 80.5
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 80.42
PRK12297424 obgE GTPase CgtA; Reviewed 80.4
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 80.36
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=3.6e-57  Score=416.15  Aligned_cols=253  Identities=50%  Similarity=0.833  Sum_probs=242.8

Q ss_pred             hhHHHHHHHHHhcCCCCCCcEEEeecCCCCCHHHHHHHHHhhCCCCCCCCCCCceEEEEEEeecCCCCCcccCCcceEEE
Q psy1177           2 QVKYVTQKWRLERTVAEGAPVIPISAQLKYNIEVLCEYITKKIPIPIRDFTSSPRLIVIRSFDVNKPGCEVDDLKGGVAG   81 (283)
Q Consensus         2 ~~~~~eIr~~l~~t~~~~~piIpvSA~~g~nI~~Ll~~L~~~i~~p~r~~~~~~r~~IdR~F~V~g~G~~~~~~rGtVvt   81 (283)
                      .+.|++|++|+++|..+|+||||+||+.+.|||.|+++|++++|+|.||.+.|++|+|.|||+||+|||.+++++|+|++
T Consensus       159 lE~y~qIk~FvkGt~Ae~aPIIPiSA~~~~NIDal~e~i~~~IptP~rd~~~~p~m~v~RSFDVNkPGt~~~~L~GGViG  238 (415)
T COG5257         159 LENYEQIKEFVKGTVAENAPIIPISAQHKANIDALIEAIEKYIPTPERDLDKPPRMYVARSFDVNKPGTPPEELKGGVIG  238 (415)
T ss_pred             HHHHHHHHHHhcccccCCCceeeehhhhccCHHHHHHHHHHhCCCCccCCCCCceEEEEeecccCCCCCCHHHccCceec
Confidence            36799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEeeEeeCCCEEEEecCceeecCCCccccccceEEEEEEEeCCceecEEecCceEEEecccCCCccccccccceeecc
Q psy1177          82 GSILRGVLKVGMEIEVRPGLVSKDSEGKLTCKPIFSRIVSLFAEQNELQFAVPGGLIGVGTKIEPTLCRADRLVGQVLGA  161 (283)
Q Consensus        82 Gtv~sG~l~vGD~v~i~P~~~~~~~~~~~~~~p~~~kV~sIq~~~~~v~~A~aG~rvai~l~ld~~i~r~di~rG~vl~~  161 (283)
                      |++.+|.+++|||+||+|+... .++|+..|+|+.++|.||+..++++++|.||+.+|+.+++||.++|+|.+.|+|+++
T Consensus       239 Gsl~~G~l~vGDEIEIrPGi~v-~k~~k~~~~pi~T~i~Sl~ag~~~~~ea~PGGLvgvGT~lDP~ltKaD~L~G~V~G~  317 (415)
T COG5257         239 GSLVQGVLRVGDEIEIRPGIVV-EKGGKTVWEPITTEIVSLQAGGEDVEEARPGGLVGVGTKLDPTLTKADALVGQVVGK  317 (415)
T ss_pred             ceeeeeeEecCCeEEecCCeEe-ecCCceEEEEeeEEEEEEEeCCeeeeeccCCceEEEecccCcchhhhhhhccccccC
Confidence            9999999999999999998766 567789999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCceeeEEEEEEEEeeeeccccccCCCccccccCCCCCcEEEEEEecceeeEEEEEecCCeEEEEeCCeEecccCCE
Q psy1177         162 VGALPKIFIELEISYHLLKRLLGVRMEGDKKGAKVQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVCTEVNEK  241 (283)
Q Consensus       162 ~g~l~~~~~~~~a~~~~l~~~~g~~~~~~~~~~~~~pl~~~~~~~l~~gt~~v~~~v~~~~~~~~~l~L~~Pv~~~~gdr  241 (283)
                      ||++|+++..|++++++|++..|...+     .+..||+.++.++|++||+++.|.|...+++.+++.|..|+|++.|+|
T Consensus       318 pG~lPpv~~~~~ie~~LL~RvvG~~~e-----~kvepik~~E~Lml~VGtatT~GvV~~~k~d~~ev~Lk~Pvcae~g~r  392 (415)
T COG5257         318 PGTLPPVWTSIRIEYHLLERVVGTKEE-----LKVEPIKTNEVLMLNVGTATTVGVVTSAKKDEIEVKLKRPVCAEIGER  392 (415)
T ss_pred             CCCCCCceEEEEEEeeehhhhhCcccc-----cccccccCCCeEEEEeecceeEEEEEEecCceEEEEeccceecCCCCE
Confidence            999999999999999999999886543     347899999999999999999999999999999999999999999999


Q ss_pred             EEEEeecCCCcEEEE-EEEe
Q psy1177         242 IALSRRVEKHWSWIE-GTVS  260 (283)
Q Consensus       242 ~ii~R~~~~~~~tiG-G~v~  260 (283)
                      ++|+|+..+.||+|| |.|-
T Consensus       393 vaisRri~~rWRLIG~G~ik  412 (415)
T COG5257         393 VAISRRIGNRWRLIGYGTIK  412 (415)
T ss_pred             EEEEeeecceEEEEeEEEEe
Confidence            999999999999999 9873

>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>KOG0466|consensus Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>KOG0460|consensus Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>cd03688 eIF2_gamma_II eIF2_gamma_II: this subfamily represents the domain II of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea Back     alignment and domain information
>KOG0461|consensus Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>KOG0459|consensus Back     alignment and domain information
>KOG0458|consensus Back     alignment and domain information
>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages Back     alignment and domain information
>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>cd03694 GTPBP_II Domain II of the GP-1 family of GTPase Back     alignment and domain information
>cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II Back     alignment and domain information
>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu Back     alignment and domain information
>cd03695 CysN_NodQ_II CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>cd04094 selB_III This family represents the domain of elongation factor SelB, homologous to domain III of EF-Tu Back     alignment and domain information
>PF09173 eIF2_C: Initiation factor eIF2 gamma, C terminal; InterPro: IPR015256 This entry represents a domain which is found in the initiation factors eIF2 and EF-Tu, adopting a beta barrel structure with Greek key topology Back     alignment and domain information
>KOG0463|consensus Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>cd03706 mtEFTU_III Domain III of mitochondrial EF-TU (mtEF-TU) Back     alignment and domain information
>cd03707 EFTU_III Domain III of elongation factor (EF) Tu Back     alignment and domain information
>KOG1143|consensus Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>PF03144 GTP_EFTU_D2: Elongation factor Tu domain 2; InterPro: IPR004161 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>cd01513 Translation_factor_III Domain III of Elongation factor (EF) Tu (EF-TU) and EF-G Back     alignment and domain information
>cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>PF03143 GTP_EFTU_D3: Elongation factor Tu C-terminal domain; InterPro: IPR004160 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd03708 GTPBP_III Domain III of the GP-1 family of GTPase Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>PF14578 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1G7R_A 1G7S_A 1G7T_A 1XE1_A Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>cd04093 HBS1_C HBS1_C: this family represents the C-terminal domain of Hsp70 subfamily B suppressor 1 (HBS1) which is homologous to the domain III of EF-1alpha Back     alignment and domain information
>cd03705 EF1_alpha_III Domain III of EF-1 Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>cd04095 CysN_NoDQ_III TCysN_NoDQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>cd03704 eRF3c_III This family represents eEF1alpha-like C-terminal region of eRF3 homologous to the domain III of EF-Tu Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes Back     alignment and domain information
>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane Back     alignment and domain information
>cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu Back     alignment and domain information
>KOG0052|consensus Back     alignment and domain information
>cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3) Back     alignment and domain information
>cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O) Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0465|consensus Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd03700 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd03703 aeIF5B_II aeIF5B_II: This family represents the domain II of archeal and eukaryotic aeIF5B Back     alignment and domain information
>cd03702 IF2_mtIF2_II This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2 Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd03701 IF2_IF5B_II IF2_IF5B_II: This family represents the domain II of prokaryotic Initiation Factor 2 (IF2) and its archeal and eukaryotic homologue aeIF5B Back     alignment and domain information
>cd04090 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>PRK14664 tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>PRK14665 mnmA tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>PRK00143 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR00420 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PF03054 tRNA_Me_trans: tRNA methyl transferase; InterPro: IPR004506 tRNA-specific 2-thiouridylase catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34 Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>KOG0469|consensus Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query283
1s0u_A408 Eif2gamma Apo Length = 408 6e-56
1kk3_A410 Structure Of The Wild-Type Large Gamma Subunit Of I 7e-52
2d74_A419 Crystal Structure Of Translation Initiation Factor 2e-51
1kk0_A410 Structure Of The Large Gamma Subunit Of Initiation 3e-51
1kjz_A410 Structure Of The Large Gamma Subunit Of Initiation 4e-51
2pmd_A415 The Structures Of Aif2gamma Subunit From The Archae 1e-43
3sjz_A409 The Structure Of Aif2gamma Subunit Delta 41-45 From 2e-43
3pen_A403 Structure Of Archaeal Initiation Factor Aif2gamma S 2e-43
2aho_A414 Structure Of The Archaeal Initiation Factor Eif2 Al 2e-43
>pdb|1S0U|A Chain A, Eif2gamma Apo Length = 408 Back     alignment and structure 
Iteration: 1

 Score =  214 bits (544), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 117/253 (46%), Positives = 166/253 (65%), Gaps = 8/253 (3%)
Query: 4   KYVTQKWRLERTVAEGAPVIPISAQLKYNIEVLCEYITKKIPIPIRDFTSSPRLIVIRSF 63
            Y   K  ++ T+AE AP+IPISA  + NI+VL + I   IP P RD  ++PR+ V RSF
Sbjct: 156 NYEQIKEFVKGTIAENAPIIPISAHHEANIDVLLKAIQDFIPTPKRDPDATPRMYVARSF 215
Query: 64  DVNKPGCEVDDLKGGVAGGSILRGVLKVGMEIEVRPGLVSKDSEGKLTC-KPIFSRIVSL 122
           D+NKPG E+ DLKGGV GG+I++GV KVG EIE+RPG+  K +EG  T  KP+ ++IVSL
Sbjct: 216 DINKPGTEIKDLKGGVLGGAIIQGVFKVGDEIEIRPGI--KVTEGNKTFWKPLTTKIVSL 273
Query: 123 FAEQNELQFAVPGGLIGVGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRL 182
            A    L+ A PGGLIGVGT ++P L ++D L G V+G  G LP I  ++ I  +LL R+
Sbjct: 274 AAGNTILRKAHPGGLIGVGTTLDPYLTKSDALTGSVVGLPGTLPPIREKITIRANLLDRV 333
Query: 183 LGVRMEGDKKGAKVQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVCTEVNEKI 242
           +G + E      K++ L   EVL++NIG+ +T G + + + D+A I L  P+C E+ +++
Sbjct: 334 VGTKEE-----LKIEPLRTGEVLMLNIGTATTAGVITSARGDIADIKLKLPICAEIGDRV 388
Query: 243 ALSRRVEKHWSWI 255
           A+SRRV   W  I
Sbjct: 389 AISRRVGSRWRLI 401
>pdb|1KK3|A Chain A, Structure Of The Wild-Type Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi Complexed With Gdp-Mg2+ Length = 410 Back     alignment and structure
>pdb|2D74|A Chain A, Crystal Structure Of Translation Initiation Factor Aif2betagamma Heterodimer Length = 419 Back     alignment and structure
>pdb|1KK0|A Chain A, Structure Of The Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi Length = 410 Back     alignment and structure
>pdb|1KJZ|A Chain A, Structure Of The Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi-G235d Mutant Length = 410 Back     alignment and structure
>pdb|2PMD|A Chain A, The Structures Of Aif2gamma Subunit From The Archaeon Sulfolobus Solfataricus In The Gdp-Bound Form. Length = 415 Back     alignment and structure
>pdb|3SJZ|A Chain A, The Structure Of Aif2gamma Subunit Delta 41-45 From Archaeon Sulfolobus Solfataricus Complexed With Gdp And Gdpnp Length = 409 Back     alignment and structure
>pdb|3PEN|A Chain A, Structure Of Archaeal Initiation Factor Aif2gamma Subunit Delta 37-47 From Sulfolobus Solfataricus In The Gdp-Bound Form. Length = 403 Back     alignment and structure
>pdb|2AHO|A Chain A, Structure Of The Archaeal Initiation Factor Eif2 Alpha- Gamma Heterodimer From Sulfolobus Solfataricus Complexed With Gdpnp Length = 414 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query283
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 1e-119
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 1e-117
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 1e-116
1wb1_A482 Translation elongation factor SELB; selenocysteine 3e-06
2elf_A370 Protein translation elongation factor 1A; tRNA, py 7e-06
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Length = 410 Back     alignment and structure
 Score =  348 bits (894), Expect = e-119
 Identities = 107/241 (44%), Positives = 152/241 (63%), Gaps = 6/241 (2%)

Query: 12  LERTVAEGAPVIPISAQLKYNIEVLCEYITKKIPIPIRDFTSSPRLIVIRSFDVNKPGCE 71
           +E TVAE AP+IPISA    NI+VL + I   IP P RD    P+++V+RSFDVNKPG  
Sbjct: 166 IEGTVAENAPIIPISALHGANIDVLVKAIEDFIPTPKRDPNKPPKMLVLRSFDVNKPGTP 225

Query: 72  VDDLKGGVAGGSILRGVLKVGMEIEVRPGLVSKDSEGKLTCKPIFSRIVSLFAEQNELQF 131
            + L GGV  GSI++G LKVG EIE+RPG V  +  G++  +PI + IVSL A    ++ 
Sbjct: 226 PEKLVGGVLDGSIVQGKLKVGDEIEIRPG-VPYEEHGRIKYEPITTEIVSLQAGGQFVEE 284

Query: 132 AVPGGLIGVGTKIEPTLCRADRLVGQVLGAVGALPKIFIELEISYHLLKRLLGVRMEGDK 191
           A PGGL+GVGTK++P L + D + G V+G  G LP ++  L +  HLL+R++G       
Sbjct: 285 AYPGGLVGVGTKLDPYLTKGDLMAGNVVGKPGKLPPVWDSLRLEVHLLERVVGTE----- 339

Query: 192 KGAKVQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVCTEVNEKIALSRRVEKH 251
           +  KV+ + R EVLL+N+G+  T G V     D  ++ L  PVC E  +++A+SR++   
Sbjct: 340 QELKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIEVKLQIPVCAEPGDRVAISRQIGSR 399

Query: 252 W 252
           W
Sbjct: 400 W 400
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Length = 403 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 408 Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Length = 482 Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Length = 370 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query283
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 100.0
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 100.0
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 100.0
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 100.0
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 100.0
2elf_A370 Protein translation elongation factor 1A; tRNA, py 100.0
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 100.0
1wb1_A482 Translation elongation factor SELB; selenocysteine 100.0
1f60_A458 Elongation factor EEF1A; protein-protein complex, 100.0
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 100.0
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 100.0
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 100.0
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 100.0
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 100.0
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 100.0
3e1y_E204 Eukaryotic peptide chain release factor GTP-bindi 100.0
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 100.0
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.46
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.43
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.33
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 99.25
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 99.25
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 99.25
1xe1_A116 Hypothetical protein PF0907; structural genomics, 99.17
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.16
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 99.09
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 99.05
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 99.02
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 98.91
3vqt_A548 RF-3, peptide chain release factor 3; translation, 98.53
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 98.31
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 98.08
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 97.04
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 96.62
1d1n_A99 Initiation factor 2; beta-barrel, gene regulation; 96.57
2crv_A120 IF-2MT, translation initiation factor IF-2; riboso 96.4
3izy_P537 Translation initiation factor IF-2, mitochondrial; 95.89
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 95.52
4he6_A89 Peptidase family U32; ultra-tight crystal packing, 94.36
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 92.85
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 91.6
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 90.31
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 89.89
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 89.77
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 89.72
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 89.5
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 89.46
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 89.34
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 89.31
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 89.26
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 89.05
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 88.85
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 88.19
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 88.18
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 87.97
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 87.76
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 87.39
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 87.32
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 85.4
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 84.71
3iby_A256 Ferrous iron transport protein B; G protein, G dom 84.09
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 83.77
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 83.53
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 83.5
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 83.44
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 82.22
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 82.22
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 81.97
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 81.89
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 81.09
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 80.12
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
Probab=100.00  E-value=1.5e-50  Score=387.59  Aligned_cols=252  Identities=39%  Similarity=0.662  Sum_probs=235.2

Q ss_pred             hhHHHHHHHHHhcCCCCCCcEEEeecCCCCCHHHHHHHHHhhCCCCCCCCCCCceEEEEEEeecCCCCCcccCCcceEEE
Q psy1177           2 QVKYVTQKWRLERTVAEGAPVIPISAQLKYNIEVLCEYITKKIPIPIRDFTSSPRLIVIRSFDVNKPGCEVDDLKGGVAG   81 (283)
Q Consensus         2 ~~~~~eIr~~l~~t~~~~~piIpvSA~~g~nI~~Ll~~L~~~i~~p~r~~~~~~r~~IdR~F~V~g~G~~~~~~rGtVvt   81 (283)
                      ++.++++++++++++.+++|++|+||++|+||++|+++|.+.++.|.++.+.||+|+|+|+|+|+|||+++++++|+|++
T Consensus       148 ~~~~~~i~~~l~~~~~~~~~ii~vSA~~g~gi~~L~~~l~~~l~~~~~~~~~~~~~~v~~~~~v~~~~~~~~~~~G~v~~  227 (403)
T 3sjy_A          148 LSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIG  227 (403)
T ss_dssp             HHHHHHHHHHHTTSTTTTCCEEECBTTTTBSHHHHHHHHHHHSCCCCCCTTSCCEEEEEEEECCCCTTCCSSSCCCCEEE
T ss_pred             HHHHHHHHHHHHhhCCCCCEEEEEECCCCcChHHHHHHHHHhCCCCCCCCCCCcEEEEEEEEeecCCCcccccCcCcEEE
Confidence            35678899999999999999999999999999999999998899898888999999999999999999999999999999


Q ss_pred             EEEEeeEeeCCCEEEEecCceeecCCCccccccceEEEEEEEeCCceecEEecCceEEEecccCCCccccccccceeecc
Q psy1177          82 GSILRGVLKVGMEIEVRPGLVSKDSEGKLTCKPIFSRIVSLFAEQNELQFAVPGGLIGVGTKIEPTLCRADRLVGQVLGA  161 (283)
Q Consensus        82 Gtv~sG~l~vGD~v~i~P~~~~~~~~~~~~~~p~~~kV~sIq~~~~~v~~A~aG~rvai~l~ld~~i~r~di~rG~vl~~  161 (283)
                      |+|.+|.+++||+|+++|++... .+|++.|.|+.++|++|+++++++++|.|||+|+++|++|++++++|+.+||||++
T Consensus       228 g~v~~G~~~~gd~v~~~p~~~~~-~~~~~~~~~~~~~v~~i~~~~~~~~~a~~G~~v~~~l~~~~~~~~~d~~~G~vl~~  306 (403)
T 3sjy_A          228 GSIIQGLFKVDQEIKVLPGLRVE-KQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITL  306 (403)
T ss_dssp             EEEEESCEETTCEEEEEEEEEEE-ETTEEEEEEEEEEEEEEEETTEEESEECSSSCEEEEESSCHHHHGGGTTTTCEEEE
T ss_pred             EEEEeCEEecCCEEEEeCCcccc-cccccccccccEEEEEEEECCEEcCEEeCCCEEEEEeccccccchhhhccccEEeC
Confidence            99999999999999999987642 57778899999999999999999999999999999999888999999999999999


Q ss_pred             CCCCCceeeEEEEEEEEeeeeccccccCCCccccccCCCCCcEEEEEEecceeeEEEEEecCCeEEEEeCCeEecccCC-
Q psy1177         162 VGALPKIFIELEISYHLLKRLLGVRMEGDKKGAKVQKLTRNEVLLVNIGSLSTGGRVLATKADLAKISLTNPVCTEVNE-  240 (283)
Q Consensus       162 ~g~l~~~~~~~~a~~~~l~~~~g~~~~~~~~~~~~~pl~~~~~~~l~~gt~~v~~~v~~~~~~~~~l~L~~Pv~~~~gd-  240 (283)
                      |+++|++++.|+|+++||++.+|+++     ..+..||++|++++||+||+++.|+|..++++.++|+|++|+|+..|| 
T Consensus       307 ~~~~~~~~~~~~a~~~~l~~~~~~~~-----~~~~~~l~~~~~~~~~~gt~~~~~~v~~~~~~~~~~~l~~p~~~~~g~~  381 (403)
T 3sjy_A          307 ADAEVPVLWNIRIKYNLLERVVGAKE-----MLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNI  381 (403)
T ss_dssp             TTCCCCEEEEEEEEEEECSBCTTCSS-----CCBCCCCCTTCEEEEEETTEEEEEEEEEECSSEEEEEEEEEEECCSSSC
T ss_pred             CCCCCcceeEEEEEEEEEeccccccc-----cccCCCCCCCCEEEEEECccEEEEEEEEecCceEEEEeCCcEeeccCCE
Confidence            99999988899999999998776652     233689999999999999999999999999999999999999999999 


Q ss_pred             EEEEEeecCCCcEEEE-EEE
Q psy1177         241 KIALSRRVEKHWSWIE-GTV  259 (283)
Q Consensus       241 r~ii~R~~~~~~~tiG-G~v  259 (283)
                      ||+|+|+.++.||+|| |.|
T Consensus       382 r~~i~r~~~~~~r~~g~g~i  401 (403)
T 3sjy_A          382 RTVISRQIAGRWRMIGWGLV  401 (403)
T ss_dssp             EEEEEEEETTEEEEEEEEEE
T ss_pred             EEEEEEEeCCcEEEEEEEEE
Confidence            9999998999999999 987
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>3e1y_E Eukaryotic peptide chain release factor GTP-bindi ERF3A; translation termination, peptide release, PTC, P biosynthesis, GTP-binding; HET: ATP; 3.80A {Homo sapiens} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1xe1_A Hypothetical protein PF0907; structural genomics, unknown function, protein structure INI secsg, conserved hypothetical protein; HET: MSE; 2.00A {Pyrococcus furiosus} SCOP: b.43.3.1 Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>1d1n_A Initiation factor 2; beta-barrel, gene regulation; NMR {Geobacillus stearothermophilus} SCOP: b.43.3.1 Back     alignment and structure
>2crv_A IF-2MT, translation initiation factor IF-2; ribosome, beta barrel, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>4he6_A Peptidase family U32; ultra-tight crystal packing, unknown function; 1.10A {Geobacillus thermoleovorans} PDB: 4he5_A Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 283
d1s0ua1118 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma 6e-37
d1kk1a1121 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma 2e-36
d2qn6a1114 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma 3e-35
d1s0ua290 b.44.1.1 (A:348-437) Initiation factor eIF2 gamma 2e-31
d1kk1a289 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma 6e-31
d2qn6a295 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma 1e-30
d1kk1a3195 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma su 4e-04
d2qn6a3205 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma su 4e-04
>d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 118 Back     information, alignment and structure

class: All beta proteins
fold: Reductase/isomerase/elongation factor common domain
superfamily: Translation proteins
family: Elongation factors
domain: Initiation factor eIF2 gamma subunit, domain II
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

 Score =  125 bits (315), Expect = 6e-37
 Identities = 63/118 (53%), Positives = 83/118 (70%), Gaps = 1/118 (0%)

Query: 49  RDFTSSPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILRGVLKVGMEIEVRPGLVSKDSEG 108
           RD  ++PR+ V RSFD+NKPG E+ DLKGGV GG+I++GV KVG EIE+RPG+   +   
Sbjct: 1   RDPDATPRMYVARSFDINKPGTEIKDLKGGVLGGAIIQGVFKVGDEIEIRPGIKVTE-GN 59

Query: 109 KLTCKPIFSRIVSLFAEQNELQFAVPGGLIGVGTKIEPTLCRADRLVGQVLGAVGALP 166
           K   KP+ ++IVSL A    L+ A PGGLIGVGT ++P L ++D L G V+G  G LP
Sbjct: 60  KTFWKPLTTKIVSLAAGNTILRKAHPGGLIGVGTTLDPYLTKSDALTGSVVGLPGTLP 117
>d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 121 Back     information, alignment and structure
>d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} Length = 114 Back     information, alignment and structure
>d1s0ua2 b.44.1.1 (A:348-437) Initiation factor eIF2 gamma subunit {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 90 Back     information, alignment and structure
>d1kk1a2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 89 Back     information, alignment and structure
>d2qn6a2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]} Length = 95 Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 195 Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 205 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query283
d1kk1a1121 Initiation factor eIF2 gamma subunit, domain II {A 100.0
d1s0ua1118 Initiation factor eIF2 gamma subunit, domain II {A 100.0
d2qn6a1114 Initiation factor eIF2 gamma subunit, domain II {S 100.0
d1f60a194 Elongation factor eEF-1alpha, domain 2 {Baker's ye 99.94
d2c78a1100 Elongation factor Tu (EF-Tu), domain 2 {Thermus th 99.94
d1d2ea198 Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos t 99.94
d1efca192 Elongation factor Tu (EF-Tu), domain 2 {Escherichi 99.93
d1jnya195 Elongation factor eEF-1alpha, domain 2 {Archaeon S 99.92
d1wb1a192 Elongation factor SelB, domains 2 and 4 {Methanoco 99.91
d1xe1a_91 Hypothetical protein PF0907 {Pyrococcus furiosus [ 99.89
d1zunb192 Sulfate adenylate transferase subunit cysN/C, EF-T 99.85
d1r5ba195 Eukaryotic peptide chain release factor ERF2, post 99.85
d2qn6a295 Initiation factor eIF2 gamma subunit {Sulfolobus s 99.71
d1s0ua290 Initiation factor eIF2 gamma subunit {Archaeon Met 99.71
d1kk1a289 Initiation factor eIF2 gamma subunit {Archaeon Pyr 99.7
d1g7sa2128 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 99.48
d1d2ea2103 Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mi 99.28
d2c78a293 Elongation factor Tu (EF-Tu) {Thermus thermophilus 99.25
d1zunb2105 Sulfate adenylate transferase subunit cysN/C, EF-T 98.96
d1jnya2107 Elongation factor eEF-1alpha, C-terminal domain {A 98.64
d2bv3a1121 Elongation factor G (EF-G), domain II {Thermus the 98.32
d2dy1a1103 Elongation factor G (EF-G), domain II {Thermus the 98.3
d1wb1a3116 Elongation factor SelB, domain 3 {Methanococcus ma 98.04
d1f60a2107 Elongation factor eEF-1alpha, C-terminal domain {B 98.02
d1n0ua1138 Elongation factor 2 (eEF-2), domain II {Baker's ye 97.65
d1d1na_99 Initiation factor IF2/eIF5b, domains 2 and 4 {Baci 97.12
d1r5ba268 Eukaryotic peptide chain release factor ERF2, C-te 94.78
d1g7sa1101 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 93.68
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 86.98
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 82.28
>d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
class: All beta proteins
fold: Reductase/isomerase/elongation factor common domain
superfamily: Translation proteins
family: Elongation factors
domain: Initiation factor eIF2 gamma subunit, domain II
species: Archaeon Pyrococcus abyssi [TaxId: 29292]

Probab=100.00  E-value=1e-36  Score=245.99  Aligned_cols=121  Identities=49%  Similarity=0.853  Sum_probs=110.8

Q ss_pred             CCCCCCCCceEEEEEEeecCCCCCcccCCcceEEEEEEEeeEeeCCCEEEEecCceeecCCCccccccceEEEEEEEeCC
Q psy1177          47 PIRDFTSSPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILRGVLKVGMEIEVRPGLVSKDSEGKLTCKPIFSRIVSLFAEQ  126 (283)
Q Consensus        47 p~r~~~~~~r~~IdR~F~V~g~G~~~~~~rGtVvtGtv~sG~l~vGD~v~i~P~~~~~~~~~~~~~~p~~~kV~sIq~~~  126 (283)
                      |.|+.++||||||||+|+|+||||++++++|+|+||||++|+|++||+|+|+|++.. .+.+++.|+|+.++|++||+|+
T Consensus         1 P~R~~~~p~r~~Idr~F~v~g~Gt~~~~~~G~VvtGtv~sG~ik~GD~v~i~P~~~~-~~~~~~~~~~~~~~V~sI~~~~   79 (121)
T d1kk1a1           1 PKRDPNKPPKMLVLRSFDVNKPGTPPEKLVGGVLDGSIVQGKLKVGDEIEIRPGVPY-EEHGRIKYEPITTEIVSLQAGG   79 (121)
T ss_dssp             CCCCTTSCCEEEEEEEECCSCCC----CCCCCEEEEEEEESCEETTCEEEEEEEEEE-EETTEEEEEEEEEEEEEEEETT
T ss_pred             CCCCCCCCcEEEEEEEEEecCCCCccccCcceEEEeeecCCEEecCCEEEECCCCcc-ccccceeceeeeeEEEEEEECC
Confidence            788999999999999999999999999999999999999999999999999999764 4556678999999999999999


Q ss_pred             ceecEEecCceEEEecccCCCccccccccceeeccCCCCCce
Q psy1177         127 NELQFAVPGGLIGVGTKIEPTLCRADRLVGQVLGAVGALPKI  168 (283)
Q Consensus       127 ~~v~~A~aG~rvai~l~ld~~i~r~di~rG~vl~~~g~l~~~  168 (283)
                      +++++|.|||||||+|++|++++|+|+.|||||++|+++|++
T Consensus        80 ~~v~~A~~G~~Vgv~l~~d~~i~r~Dv~rG~Vl~~pg~lppv  121 (121)
T d1kk1a1          80 QFVEEAYPGGLVGVGTKLDPYLTKGDLMAGNVVGKPGKLPPV  121 (121)
T ss_dssp             EEESEECSSSCEEEEESSCGGGTGGGTTTTCEEECTTCSCCE
T ss_pred             CCcCEEeCCCeEEEEecccCCcchhHhcceeEEECCCCCCCC
Confidence            999999999999999999999999999999999999999974
>d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2ea1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wb1a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2qn6a2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1s0ua2 b.44.1.1 (A:348-437) Initiation factor eIF2 gamma subunit {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kk1a2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1d2ea2 b.44.1.1 (A:349-451) Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2c78a2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zunb2 b.44.1.1 (B:330-434) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 3-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1jnya2 b.44.1.1 (A:323-429) Elongation factor eEF-1alpha, C-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1wb1a3 b.44.1.1 (A:272-387) Elongation factor SelB, domain 3 {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1f60a2 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0ua1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d1na_ b.43.3.1 (A:) Initiation factor IF2/eIF5b, domains 2 and 4 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r5ba2 b.44.1.1 (A:555-622) Eukaryotic peptide chain release factor ERF2, C-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1g7sa1 b.43.3.1 (A:228-328) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure