Psyllid ID: psy11810

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MDHPFNFVTLTFGHPVDSYEMNVRVTTMDAELEFAIQHTTTGKQLFDQTVKTIGLREVWFFGLQYADSRGDLTWIKLYKKIHKSTTLATTEVD
ccccccEEEEEccccccccEEEEEEEEcccEEEEEEcccccHHHHHHHHHHHcccccEEEEEEEEEcccccEEcccccccccccccccccccc
cccccEEEEEEEcccccccEEEEEEEcccccEEEEEccccEHHHHHHHHHHHHccccHHHEEEEEEcccccEEEcccccEccccccccccccc
mdhpfnfvtltfghpvdsyemnVRVTTMDAELEFAIQHTTTGKQLFDQTVKTIGLREVWFFGLqyadsrgdLTWIKLYKKIHKSttlattevd
mdhpfnfvtltfghpvdsyEMNVRVTTMDAELEFAIQHTTTGKQLFDQTVKTIGLREVWFFGLQYADSRGDLTWIKLYKKIhksttlattevd
MDHPFNFVTLTFGHPVDSYEMNVRVTTMDAELEFAIQHTTTGKQLFDQTVKTIGLREVWFFGLQYADSRGDLTWIKLYKKIHKSTTLATTEVD
****FNFVTLTFGHPVDSYEMNVRVTTMDAELEFAIQHTTTGKQLFDQTVKTIGLREVWFFGLQYADSRGDLTWIKLYKKI************
***********************RVTTMDAELEFAIQHTTTGKQLFDQTVKTIGLREVWFFGLQYADSRGDLTWIKLYKKIH***********
MDHPFNFVTLTFGHPVDSYEMNVRVTTMDAELEFAIQHTTTGKQLFDQTVKTIGLREVWFFGLQYADSRGDLTWIKLYKKIHKS*********
**HPFNFVTLTFGHPVDSYEMNVRVTTMDAELEFAIQHTTTGKQLFDQTVKTIGLREVWFFGLQYADSRGDLTWIKLYKKIHK**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDHPFNFVTLTFGHPVDSYEMNVRVTTMDAELEFAIQHTTTGKQLFDQTVKTIGLREVWFFGLQYADSRGDLTWIKLYKKIHKSTTLATTEVD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query93 2.2.26 [Sep-21-2011]
Q170J7 583 Moesin/ezrin/radixin homo N/A N/A 0.655 0.104 0.901 1e-27
B0WYY2 572 Moesin/ezrin/radixin homo N/A N/A 0.655 0.106 0.901 1e-27
Q29GR8 593 Moesin/ezrin/radixin homo yes N/A 0.741 0.116 0.811 9e-27
P46150 578 Moesin/ezrin/radixin homo yes N/A 0.655 0.105 0.885 1e-26
Q7PS12 581 Moesin/ezrin/radixin homo yes N/A 0.655 0.104 0.885 2e-26
Q2HJ49 577 Moesin OS=Bos taurus GN=M yes N/A 0.655 0.105 0.786 1e-22
P26044 583 Radixin OS=Sus scrofa GN= yes N/A 0.655 0.104 0.803 1e-22
P26043 583 Radixin OS=Mus musculus G no N/A 0.655 0.104 0.803 1e-22
P35241 583 Radixin OS=Homo sapiens G yes N/A 0.655 0.104 0.803 1e-22
Q9PU45 583 Radixin OS=Gallus gallus yes N/A 0.655 0.104 0.803 1e-22
>sp|Q170J7|MOEH_AEDAE Moesin/ezrin/radixin homolog 1 OS=Aedes aegypti GN=Moe PE=3 SV=1 Back     alignment and function desciption
 Score =  121 bits (304), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 58/61 (95%)

Query: 21 MNVRVTTMDAELEFAIQHTTTGKQLFDQTVKTIGLREVWFFGLQYADSRGDLTWIKLYKK 80
          MNVRVTTMDAELEFAIQ +TTGKQLFDQ VKTIGLREVWFFGLQY DS+GDLTWIKLYKK
Sbjct: 11 MNVRVTTMDAELEFAIQQSTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDLTWIKLYKK 70

Query: 81 I 81
          +
Sbjct: 71 V 71
Involved in connections of major cytoskeletal structures to the plasma membrane.
Aedes aegypti (taxid: 7159)
>sp|B0WYY2|MOEH_CULQU Moesin/ezrin/radixin homolog 1 OS=Culex quinquefasciatus GN=Moe PE=3 SV=1 Back     alignment and function description
>sp|Q29GR8|MOEH_DROPS Moesin/ezrin/radixin homolog 1 OS=Drosophila pseudoobscura pseudoobscura GN=Moe PE=3 SV=3 Back     alignment and function description
>sp|P46150|MOEH_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster GN=Moe PE=1 SV=2 Back     alignment and function description
>sp|Q7PS12|MOEH_ANOGA Moesin/ezrin/radixin homolog 1 OS=Anopheles gambiae GN=Moe PE=3 SV=5 Back     alignment and function description
>sp|Q2HJ49|MOES_BOVIN Moesin OS=Bos taurus GN=MSN PE=2 SV=3 Back     alignment and function description
>sp|P26044|RADI_PIG Radixin OS=Sus scrofa GN=RDX PE=2 SV=1 Back     alignment and function description
>sp|P26043|RADI_MOUSE Radixin OS=Mus musculus GN=Rdx PE=1 SV=3 Back     alignment and function description
>sp|P35241|RADI_HUMAN Radixin OS=Homo sapiens GN=RDX PE=1 SV=1 Back     alignment and function description
>sp|Q9PU45|RADI_CHICK Radixin OS=Gallus gallus GN=RDX PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
357613203 1068 Moesin [Danaus plexippus] 0.913 0.079 0.670 4e-27
340729929 572 PREDICTED: moesin/ezrin/radixin homolog 0.655 0.106 0.901 4e-26
122920502 575 Chain A, Moesin From Spodoptera Frugiper 0.655 0.106 0.918 5e-26
383852553 572 PREDICTED: moesin/ezrin/radixin homolog 0.655 0.106 0.901 5e-26
157117183 583 moesin/ezrin/radixin [Aedes aegypti] gi| 0.655 0.104 0.901 5e-26
170053294 572 moesin/ezrin/radixin [Culex quinquefasci 0.655 0.106 0.901 5e-26
383852555 617 PREDICTED: moesin/ezrin/radixin homolog 0.709 0.106 0.848 6e-26
328697842 572 PREDICTED: moesin/ezrin/radixin homolog 0.655 0.106 0.885 8e-26
342905747112 radixin [Rhodnius prolixus] 0.655 0.544 0.918 8e-26
328784401 618 PREDICTED: moesin/ezrin/radixin homolog 0.645 0.097 0.916 1e-25
>gi|357613203|gb|EHJ68371.1| Moesin [Danaus plexippus] Back     alignment and taxonomy information
 Score =  125 bits (314), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 65/97 (67%), Positives = 70/97 (72%), Gaps = 12/97 (12%)

Query: 8   VTLTFGHP--------VDSYEMNVRVTTMDAELEFAIQHTTTGKQLFDQTVKTIGLREVW 59
           VT+T G P            +MNVRVTTMDAELEFAIQ TTTGKQLFDQ VKTIGLREVW
Sbjct: 438 VTVTLGPPRRTDIKMVAGGKQMNVRVTTMDAELEFAIQQTTTGKQLFDQVVKTIGLREVW 497

Query: 60  FFGLQYADSRGDLTWIKLYKK----IHKSTTLATTEV 92
           FFGLQY DS+GDLTWIKLYKK    + K+    TT V
Sbjct: 498 FFGLQYTDSKGDLTWIKLYKKPETVVGKTARCVTTAV 534

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340729929|ref|XP_003403246.1| PREDICTED: moesin/ezrin/radixin homolog 1-like isoform 1 [Bombus terrestris] gi|350396339|ref|XP_003484521.1| PREDICTED: moesin/ezrin/radixin homolog 1-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|122920502|pdb|2I1J|A Chain A, Moesin From Spodoptera Frugiperda At 2.1 Angstroms Resolution gi|122920505|pdb|2I1K|A Chain A, Moesin From Spodoptera Frugiperda Reveals The Coiled-Coil Domain At 3.0 Angstrom Resolution gi|118133213|gb|ABK60307.1| moesin [Spodoptera frugiperda] Back     alignment and taxonomy information
>gi|383852553|ref|XP_003701791.1| PREDICTED: moesin/ezrin/radixin homolog 1-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|157117183|ref|XP_001652975.1| moesin/ezrin/radixin [Aedes aegypti] gi|122068139|sp|Q170J7.1|MOEH_AEDAE RecName: Full=Moesin/ezrin/radixin homolog 1 gi|108876119|gb|EAT40344.1| AAEL007915-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170053294|ref|XP_001862607.1| moesin/ezrin/radixin [Culex quinquefasciatus] gi|215275737|sp|B0WYY2.1|MOEH_CULQU RecName: Full=Moesin/ezrin/radixin homolog 1 gi|167873862|gb|EDS37245.1| moesin/ezrin/radixin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|383852555|ref|XP_003701792.1| PREDICTED: moesin/ezrin/radixin homolog 1-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|328697842|ref|XP_001942978.2| PREDICTED: moesin/ezrin/radixin homolog 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|342905747|gb|AEL79157.1| radixin [Rhodnius prolixus] Back     alignment and taxonomy information
>gi|328784401|ref|XP_396252.3| PREDICTED: moesin/ezrin/radixin homolog 1 [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query93
UNIPROTKB|B0WYY2 572 Moe "Moesin/ezrin/radixin homo 0.655 0.106 0.901 2.7e-25
UNIPROTKB|Q170J7 583 Moe "Moesin/ezrin/radixin homo 0.655 0.104 0.901 2.9e-25
UNIPROTKB|Q29GR8 593 Moe "Moesin/ezrin/radixin homo 0.741 0.116 0.811 1.1e-24
FB|FBgn0011661 578 Moe "Moesin" [Drosophila melan 0.655 0.105 0.885 1.3e-24
UNIPROTKB|Q7PS12 581 Moe "Moesin/ezrin/radixin homo 0.655 0.104 0.885 3.5e-24
UNIPROTKB|D4A5L5 374 Rdx "Protein Rdx" [Rattus norv 0.655 0.163 0.803 2.1e-22
ZFIN|ZDB-GENE-050803-1 585 ezrb "ezrin b" [Danio rerio (t 0.666 0.105 0.774 6.8e-22
UNIPROTKB|F1MJJ8 583 RDX "Radixin" [Bos taurus (tax 0.666 0.106 0.790 8.7e-22
UNIPROTKB|F1P0I4 582 RDX "Radixin" [Gallus gallus ( 0.655 0.104 0.803 1.4e-21
UNIPROTKB|E9PT65 582 Rdx "Protein Rdx" [Rattus norv 0.655 0.104 0.803 1.4e-21
UNIPROTKB|B0WYY2 Moe "Moesin/ezrin/radixin homolog 1" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms
 Score = 294 (108.6 bits), Expect = 2.7e-25, P = 2.7e-25
 Identities = 55/61 (90%), Positives = 58/61 (95%)

Query:    21 MNVRVTTMDAELEFAIQHTTTGKQLFDQTVKTIGLREVWFFGLQYADSRGDLTWIKLYKK 80
             MNVRVTTMDAELEFAIQ +TTGKQLFDQ VKTIGLREVWFFGLQY DS+GDLTWIKLYKK
Sbjct:     1 MNVRVTTMDAELEFAIQQSTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDLTWIKLYKK 60

Query:    81 I 81
             +
Sbjct:    61 V 61
GO:0003779 "actin binding" evidence=ISS
GO:0005912 "adherens junction" evidence=ISS
GO:0045197 "establishment or maintenance of epithelial cell apical/basal polarity" evidence=ISS
UNIPROTKB|Q170J7 Moe "Moesin/ezrin/radixin homolog 1" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
UNIPROTKB|Q29GR8 Moe "Moesin/ezrin/radixin homolog 1" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
FB|FBgn0011661 Moe "Moesin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q7PS12 Moe "Moesin/ezrin/radixin homolog 1" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
UNIPROTKB|D4A5L5 Rdx "Protein Rdx" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050803-1 ezrb "ezrin b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MJJ8 RDX "Radixin" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0I4 RDX "Radixin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E9PT65 Rdx "Protein Rdx" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P46150MOEH_DROMENo assigned EC number0.88520.65590.1055yesN/A
B0WYY2MOEH_CULQUNo assigned EC number0.90160.65590.1066N/AN/A
Q170J7MOEH_AEDAENo assigned EC number0.90160.65590.1046N/AN/A
P35241RADI_HUMANNo assigned EC number0.80320.65590.1046yesN/A
Q2HJ49MOES_BOVINNo assigned EC number0.78680.65590.1057yesN/A
Q9PU45RADI_CHICKNo assigned EC number0.80320.65590.1046yesN/A
Q29GR8MOEH_DROPSNo assigned EC number0.81150.74190.1163yesN/A
P26044RADI_PIGNo assigned EC number0.80320.65590.1046yesN/A
Q7PS12MOEH_ANOGANo assigned EC number0.88520.65590.1049yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
pfam0937979 pfam09379, FERM_N, FERM N-terminal domain 6e-13
smart00295 201 smart00295, B41, Band 4 1e-11
>gnl|CDD|220215 pfam09379, FERM_N, FERM N-terminal domain Back     alignment and domain information 
 Score = 58.0 bits (141), Expect = 6e-13
 Identities = 24/60 (40%), Positives = 38/60 (63%), Gaps = 1/60 (1%)

Query: 25 VTTMDA-ELEFAIQHTTTGKQLFDQTVKTIGLREVWFFGLQYADSRGDLTWIKLYKKIHK 83
          V  +D  +LEF +  + TG++L DQ  + +GLRE  +FGLQ+ D + +  W+ L KK+ K
Sbjct: 1  VRLLDGTQLEFTVDKSATGQELLDQVCQRLGLREKDYFGLQFNDKKNERIWLDLDKKLRK 60

This domain is the N-terminal ubiquitin-like structural domain of the FERM domain. Length = 79
>gnl|CDD|214604 smart00295, B41, Band 4 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 93
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 99.84
KOG3530|consensus 616 99.83
KOG3531|consensus 1036 99.73
KOG3527|consensus 975 99.71
KOG3529|consensus 596 99.6
KOG0792|consensus 1144 99.44
smart00295 207 B41 Band 4.1 homologues. Also known as ezrin/radix 99.19
cd0177787 SNX27_RA Ubiquitin domain of SNX27 (sorting nexin 96.36
cd0640782 PB1_NLP A PB1 domain is present in NIN like protei 95.77
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 92.76
cd0639681 PB1_NBR1 The PB1 domain is an essential part of NB 92.39
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 92.04
cd0640886 PB1_NoxR The PB1 domain is present in the Epichloe 91.96
cd0599281 PB1 The PB1 domain is a modular domain mediating s 89.99
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 89.86
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 89.26
cd0639782 PB1_UP1 Uncharacterized protein 1. The PB1 domain 88.22
PF0056484 PB1: PB1 domain; InterPro: IPR000270 The Phox and 87.66
PF0078893 RA: Ras association (RalGDS/AF-6) domain; InterPro 87.57
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 87.23
cd0639891 PB1_Joka2 The PB1 domain is present in the Nicotia 87.17
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 86.12
PF0219671 RBD: Raf-like Ras-binding domain; InterPro: IPR003 85.2
cd0640986 PB1_MUG70 The MUG70 protein is a product of the me 84.59
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 83.81
cd0176072 RBD Ubiquitin-like domain of RBD-like S/T kinases. 83.18
smart0045570 RBD Raf-like Ras-binding domain. 83.01
cd0176887 RA RA (Ras-associating) ubiquitin domain. The RA ( 80.93
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information 
Probab=99.84  E-value=5.4e-21  Score=119.10  Aligned_cols=66  Identities=35%  Similarity=0.662  Sum_probs=60.3

Q ss_pred             EEeCCC-eEEEEECCCChhhhHHHHHhcccCceeeeeeeeEE-ecCCCCeeccccCcccccccccCCC
Q psy11810         25 VTTMDA-ELEFAIQHTTTGKQLFDQTVKTIGLREVWFFGLQY-ADSRGDLTWIKLYKKIHKSTTLATT   90 (93)
Q Consensus        25 V~lLD~-~~~~~v~~~~~G~~Lfd~Vc~~L~L~E~dYFGL~y-~d~~~~~~WLdl~K~i~kQ~~~~~~   90 (93)
                      |++||+ +.+|+++++++|++|+++||++|||.|.+||||+| .++++..+||+++|+|.+|.....+
T Consensus         1 V~llD~~~~~~~v~~~~t~~~l~~~v~~~l~l~e~~~FgL~~~~~~~~~~~wL~~~k~l~~q~~~~~~   68 (80)
T PF09379_consen    1 VRLLDGTTKTFEVDPKTTGQDLLEQVCDKLGLKEKEYFGLQYQVDKDGEHHWLDLDKKLKKQLKKNNP   68 (80)
T ss_dssp             EEESSEEEEEEEEETTSBHHHHHHHHHHHHTTSSGGGEEEEE-EBTTSSEEEE-SSSBGGGSTBTSSS
T ss_pred             CCCcCCCcEEEEEcCCCcHHHHHHHHHHHcCCCCccEEEEEEeecCCCcceeccCcccHHHHcCCCCC
Confidence            789988 67899999999999999999999999999999999 7889999999999999999887433

The FERM domain (F for 4.1 protein, E for ezrin, R for radixin and M for moesin) is a widespread protein module involved in localising proteins to the plasma membrane []. FERM domains are found in a number of cytoskeletal-associated proteins that associate with various proteins at the interface between the plasma membrane and the cytoskeleton. The FERM domain is located at the N terminus of the majority of FERM-containing proteins [, ], which includes: Band 4.1, which links the spectrin-actin cytoskeleton of erythrocytes to the plasma membrane. Ezrin, a component of the undercoat of the microvilli plasma membrane. Moesin, which is probably involved in binding major cytoskeletal structures to the plasma membrane. Radixin, which is involved in the binding of the barbed end of actin filaments to the plasma membrane in the undercoat of the cell- to-cell adherens junction. Talin, a cytoskeletal protein concentrated in regions of cell-substratum contact and, in lymphocytes, of cell-cell contacts. Filopodin, a slime mold protein that binds actin and which is involved in the control of cell motility and chemotaxis. Merlin (or schwannomin). Protein NBL4. Unconventional myosins X, VIIa and XV, which are mutated in congenital deafness. Focal-adhesion kinases (FAKs), cytoplasmic protein tyrosine kinases involved in signalling through integrins. Janus tyrosine kinases (JAKs), cytoplasmic tyrosine kinases that are non-covalently associated with the cytoplasmic tails of receptors for cytokines or polypeptidic hormones. Non-receptor tyrosine-protein kinase TYK2. Protein-tyrosine phosphatases PTPN3 and PTPN4, enzyme that appear to act at junctions between the membrane and the cytoskeleton. Protein-tyrosine phosphatases PTPN14 and PTP-D1, PTP-RL10 and PTP2E. Caenorhabditis elegans protein phosphatase ptp-1. Ezrin, moesin, and radixin are highly related proteins (ERM protein family), but the other proteins in which the FERM domain is found do not share any region of similarity outside of this domain. ERM proteins are made of three domains, the FERM domain, a central helical domain and a C-terminal tail domain, which binds F-actin. The amino-acid sequence of the FERM domain is highly conserved among ERM proteins and is responsible for membrane association by direct binding to the cytoplasmic domain or tail of integral membrane proteins. ERM proteins are regulated by an intramolecular association of the FERM and C-terminal tail domains that masks their binding sites for other molecules. For cytoskeleton-membrane cross-linking, the dormant molecules becomes activated and the FERM domain attaches to the membrane by binding specific membrane proteins, while the last 34 residues of the tail bind actin filaments. Aside from binding to membranes, the activated FERM domain of ERM proteins can also bind the guanine nucleotide dissociation inhibitor of Rho GTPase (RhoDGI), which suggests that in addition to functioning as a cross-linker, ERM proteins may influence Rho signalling pathways. The crystal structure of the FERM domain reveals that it is composed of three structural modules (F1, F2, and F3) that together form a compact clover-shaped structure []. The FERM domain has also been called the amino-terminal domain, the 30kDa domain, 4.1N30, the membrane-cytoskeletal-linking domain, the ERM-like domain, the ezrin-like domain of the band 4.1 superfamily, the conserved N-terminal region, and the membrane attachment domain [].; PDB: 1EF1_B 1SGH_A 1E5W_A 2KC2_A 2KMA_A 3IVF_A 1H4R_B 3U8Z_A 1ISN_A 3BIN_A ....
>KOG3530|consensus Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information
>KOG3527|consensus Back     alignment and domain information
>KOG3529|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>smart00295 B41 Band 4 Back     alignment and domain information
>cd01777 SNX27_RA Ubiquitin domain of SNX27 (sorting nexin protein 27) Back     alignment and domain information
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62 Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA Back     alignment and domain information
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd06397 PB1_UP1 Uncharacterized protein 1 Back     alignment and domain information
>PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins Back     alignment and domain information
>PF00788 RA: Ras association (RalGDS/AF-6) domain; InterPro: IPR000159 Proteins with this domain are mostly RasGTP effectors and include guanine-nucleotide releasing factor in mammals [] Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>PF02196 RBD: Raf-like Ras-binding domain; InterPro: IPR003116 This is the Ras-binding domain found in proteins related to Ras Back     alignment and domain information
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>cd01760 RBD Ubiquitin-like domain of RBD-like S/T kinases Back     alignment and domain information
>smart00455 RBD Raf-like Ras-binding domain Back     alignment and domain information
>cd01768 RA RA (Ras-associating) ubiquitin domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
2i1j_A 575 Moesin From Spodoptera Frugiperda At 2.1 Angstroms 9e-29
1j19_A 317 Crystal Structure Of The Radxin Ferm Domain Complex 6e-24
1gc6_A 297 Crystal Structure Of The Radixin Ferm Domain Comple 6e-24
2d10_A 312 Crystal Structure Of The Radixin Ferm Domain Comple 6e-24
2zpy_A 312 Crystal Structure Of The Mouse Radxin Ferm Domain C 6e-24
2emt_A 322 Crystal Structure Analysis Of The Radixin Ferm Doma 6e-24
2d2q_A 310 Crystal Structure Of The Dimerized Radixin Ferm Dom 6e-24
1e5w_A 346 Structure Of Isolated Ferm Domain And First Long He 7e-23
1sgh_A 297 Moesin Ferm Domain Bound To Ebp50 C-Terminal Peptid 9e-23
1ni2_A 296 Structure Of The Active Ferm Domain Of Ezrin Length 1e-22
1ef1_A 294 Crystal Structure Of The Moesin Ferm DomainTAIL DOM 3e-22
1h4r_A 314 Crystal Structure Of The Ferm Domain Of Merlin, The 6e-12
1h4r_B 314 Crystal Structure Of The Ferm Domain Of Merlin, The 6e-12
3u8z_A 300 Human Merlin Ferm Domain Length = 300 6e-12
1isn_A 323 Crystal Structure Of Merlin Ferm Domain Length = 32 6e-12
>pdb|2I1J|A Chain A, Moesin From Spodoptera Frugiperda At 2.1 Angstroms Resolution Length = 575 Back     alignment and structure 
Iteration: 1

 Score =  121 bits (304), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 56/61 (91%), Positives = 58/61 (95%)
Query: 21 MNVRVTTMDAELEFAIQHTTTGKQLFDQTVKTIGLREVWFFGLQYADSRGDLTWIKLYKK 80
          MNVRVTTMDAELEFAIQ TTTGKQLFDQ VKTIGLREVWFFGLQY DS+GDLTWIKLYKK
Sbjct: 5  MNVRVTTMDAELEFAIQQTTTGKQLFDQVVKTIGLREVWFFGLQYTDSKGDLTWIKLYKK 64
Query: 81 I 81
          +
Sbjct: 65 V 65
>pdb|1J19|A Chain A, Crystal Structure Of The Radxin Ferm Domain Complexed With The Icam-2 Cytoplasmic Peptide Length = 317 Back     alignment and structure
>pdb|1GC6|A Chain A, Crystal Structure Of The Radixin Ferm Domain Complexed With Inositol-(1,4,5)-Triphosphate Length = 297 Back     alignment and structure
>pdb|2D10|A Chain A, Crystal Structure Of The Radixin Ferm Domain Complexed With The Nherf-1 C-Terminal Tail Peptide Length = 312 Back     alignment and structure
>pdb|2ZPY|A Chain A, Crystal Structure Of The Mouse Radxin Ferm Domain Complexed With The Mouse Cd44 Cytoplasmic Peptide Length = 312 Back     alignment and structure
>pdb|2EMT|A Chain A, Crystal Structure Analysis Of The Radixin Ferm Domain Complexed With Adhesion Molecule Psgl-1 Length = 322 Back     alignment and structure
>pdb|2D2Q|A Chain A, Crystal Structure Of The Dimerized Radixin Ferm Domain Length = 310 Back     alignment and structure
>pdb|1E5W|A Chain A, Structure Of Isolated Ferm Domain And First Long Helix Of Moesin Length = 346 Back     alignment and structure
>pdb|1SGH|A Chain A, Moesin Ferm Domain Bound To Ebp50 C-Terminal Peptide Length = 297 Back     alignment and structure
>pdb|1NI2|A Chain A, Structure Of The Active Ferm Domain Of Ezrin Length = 296 Back     alignment and structure
>pdb|1EF1|A Chain A, Crystal Structure Of The Moesin Ferm DomainTAIL DOMAIN COMPLEX Length = 294 Back     alignment and structure
>pdb|1H4R|A Chain A, Crystal Structure Of The Ferm Domain Of Merlin, The Neurofibromatosis 2 Tumor Suppressor Protein Length = 314 Back     alignment and structure
>pdb|1H4R|B Chain B, Crystal Structure Of The Ferm Domain Of Merlin, The Neurofibromatosis 2 Tumor Suppressor Protein Length = 314 Back     alignment and structure
>pdb|3U8Z|A Chain A, Human Merlin Ferm Domain Length = 300 Back     alignment and structure
>pdb|1ISN|A Chain A, Crystal Structure Of Merlin Ferm Domain Length = 323 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query93
1ef1_A 294 Moesin; membrane, FERM domain, tail domain, membra 9e-19
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 9e-19
3qij_A 296 Protein 4.1; cytoskeleton, structural genomics, st 2e-16
1h4r_A 314 Merlin; FERM, neurofibromatosis, NF2, structural p 2e-15
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 6e-12
3au4_A 555 Myosin-X; protein-protein complex, motor protein c 3e-07
3pvl_A 655 Myosin VIIA isoform 1; protein complex, novel fold 5e-07
4dxa_B 322 KREV interaction trapped protein 1; GTPase, FERM, 7e-07
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Length = 294 Back     alignment and structure
 Score = 76.9 bits (189), Expect = 9e-19
 Identities = 48/63 (76%), Positives = 54/63 (85%)

Query: 21 MNVRVTTMDAELEFAIQHTTTGKQLFDQTVKTIGLREVWFFGLQYADSRGDLTWIKLYKK 80
          ++VRVTTMDAELEFAIQ  TTGKQLFDQ VKTIGLREVWFFGLQY D++G  TW+KL KK
Sbjct: 2  ISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKK 61

Query: 81 IHK 83
          +  
Sbjct: 62 VTA 64
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Length = 575 Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Length = 296 Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Length = 314 Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Length = 371 Back     alignment and structure
>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Length = 555 Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Length = 655 Back     alignment and structure
>4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} Length = 322 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
1h4r_A 314 Merlin; FERM, neurofibromatosis, NF2, structural p 99.72
1ef1_A 294 Moesin; membrane, FERM domain, tail domain, membra 99.7
3qij_A 296 Protein 4.1; cytoskeleton, structural genomics, st 99.67
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 99.65
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 99.45
2al6_A 375 Focal adhesion kinase 1; transferase; 2.35A {Gallu 99.15
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 99.14
3pvl_A 655 Myosin VIIA isoform 1; protein complex, novel fold 98.92
3au4_A 555 Myosin-X; protein-protein complex, motor protein c 98.92
4dxa_B 322 KREV interaction trapped protein 1; GTPase, FERM, 98.49
4eku_A 392 Protein-tyrosine kinase 2-beta; proline-rich tyros 98.25
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 96.84
1vd2_A89 Protein kinase C, IOTA type; PB1 domain, OPCA moti 95.87
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 94.23
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 91.06
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 90.44
1wgr_A100 Growth factor receptor-bound protein 7; RA domain, 90.32
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 88.51
3dad_A 339 FH1/FH2 domain-containing protein 1; formin, FHOD1 87.62
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 87.61
3v6c_B91 Ubiquitin; structural genomics, structural genomic 87.4
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 87.32
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 86.97
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 86.61
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 85.93
2pjh_A80 Protein NPL4, nuclear protein localization protein 85.71
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 85.65
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 85.14
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 85.04
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 84.56
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 84.34
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 84.25
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 84.06
1q1o_A98 Cell division control protein 24; PB1 domain, PCCR 83.93
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 83.93
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 83.82
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 83.45
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 83.14
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 82.63
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 82.44
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 82.3
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 81.89
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Back     alignment and structure
Probab=99.72  E-value=5.6e-18  Score=126.50  Aligned_cols=82  Identities=39%  Similarity=0.721  Sum_probs=66.9

Q ss_pred             eeeeeeecCCCCCceEEEEEEeCCCeEEEEECCCChhhhHHHHHhcccCceeeeeeeeEEecCCCCeeccccCccccccc
Q psy11810          6 NFVTLTFGHPVDSYEMNVRVTTMDAELEFAIQHTTTGKQLFDQTVKTIGLREVWFFGLQYADSRGDLTWIKLYKKIHKST   85 (93)
Q Consensus         6 ~~~~l~~~~~~~~k~~~~~V~lLD~~~~~~v~~~~~G~~Lfd~Vc~~L~L~E~dYFGL~y~d~~~~~~WLdl~K~i~kQ~   85 (93)
                      .++.|+.+.   ++.+.|+|.++|+++++.++++++|++|++.||++|||.|.+||||+|. .++..+||+++++|.+|.
T Consensus        11 ~~~~~~~~~---~~~~~~~V~lldg~~~~~v~~~t~~~el~~~v~~~l~L~e~~~FgL~~~-~~~~~~wL~~~~~i~~q~   86 (314)
T 1h4r_A           11 SFSSLKRKQ---PKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYT-IKDTVAWLKMDKKVLDHD   86 (314)
T ss_dssp             -------------CEEEEEEECSSCEEEEEEETTCBHHHHHHHHHHHHTCCCGGGEEEEEE-ETTEEEECCTTSBGGGSS
T ss_pred             ccccccCCC---CCeeEEEEEeCCceEEEEeCCCCcHHHHHHHHHHHhCCCCCccceEEEE-eCCcCeeCCCccCHHHcC
Confidence            344555443   5889999999999999999999999999999999999999999999999 788999999999999997


Q ss_pred             ccCCCC
Q psy11810         86 TLATTE   91 (93)
Q Consensus        86 ~~~~~~   91 (93)
                      ...++|
T Consensus        87 ~~~~~~   92 (314)
T 1h4r_A           87 VSKEEP   92 (314)
T ss_dssp             CCCSSS
T ss_pred             CCCCCC
Confidence            655444
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Back     alignment and structure
>4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} PDB: 3u7d_A Back     alignment and structure
>4eku_A Protein-tyrosine kinase 2-beta; proline-rich tyrosine kinase 2, FERM domain, transferase; 3.25A {Homo sapiens} Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>1wgr_A Growth factor receptor-bound protein 7; RA domain, GRB7, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>1q1o_A Cell division control protein 24; PB1 domain, PCCR, PC motif, OPCA motif, yeast, cell polarity, protein-protein interaction; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 2kfj_A 2kfk_B Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 93
d1ef1a384 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [Ta 7e-23
d1h4ra384 d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens) [ 5e-21
d1gg3a381 d.15.1.4 (A:1-81) Erythroid membrane protein 4.1R 5e-18
>d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: First domain of FERM
domain: Moesin
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 81.7 bits (202), Expect = 7e-23
 Identities = 48/63 (76%), Positives = 54/63 (85%)

Query: 21 MNVRVTTMDAELEFAIQHTTTGKQLFDQTVKTIGLREVWFFGLQYADSRGDLTWIKLYKK 80
          ++VRVTTMDAELEFAIQ  TTGKQLFDQ VKTIGLREVWFFGLQY D++G  TW+KL KK
Sbjct: 2  ISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKK 61

Query: 81 IHK 83
          +  
Sbjct: 62 VTA 64
>d1h4ra3 d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1gg3a3 d.15.1.4 (A:1-81) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query93
d1ef1a384 Moesin {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1h4ra384 Merlin {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1gg3a381 Erythroid membrane protein 4.1R {Human (Homo sapie 99.95
d1wgra_100 Growth factor receptor-bound protein 7, GRB-7 {Hum 96.25
d1ip9a_85 Bud emergence mediator Bemp1 {Baker's yeast (Sacch 95.47
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 94.16
d2bkfa185 Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Hum 92.77
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 91.73
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 90.86
d1wgya_104 Rap guanine nucleotide exchange factor 5, RapGEF5 89.32
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 89.21
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 87.06
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 86.18
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 85.24
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 84.09
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 84.09
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 84.07
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 83.58
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 82.08
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 81.23
>d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: First domain of FERM
domain: Moesin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.95  E-value=3.4e-29  Score=158.87  Aligned_cols=72  Identities=67%  Similarity=1.017  Sum_probs=68.6

Q ss_pred             eEEEEEEeCCCeEEEEECCCChhhhHHHHHhcccCceeeeeeeeEEecCCCCeeccccCcccccccccCCCC
Q psy11810         20 EMNVRVTTMDAELEFAIQHTTTGKQLFDQTVKTIGLREVWFFGLQYADSRGDLTWIKLYKKIHKSTTLATTE   91 (93)
Q Consensus        20 ~~~~~V~lLD~~~~~~v~~~~~G~~Lfd~Vc~~L~L~E~dYFGL~y~d~~~~~~WLdl~K~i~kQ~~~~~~~   91 (93)
                      ++.|+|.+||++++|.++++|+|++||++||++|||.|+|||||+|.|++++.+|||++|+|+||...+++|
T Consensus         1 t~~v~V~~LD~~~~~~v~~~a~G~~l~~~Vc~~l~L~E~dYFGL~y~d~~~~~~WLd~~k~l~kq~~~~~~~   72 (84)
T d1ef1a3           1 TISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLKLNKKVTAQDVRKESP   72 (84)
T ss_dssp             CEEEEEEETTEEEEEEECTTCBHHHHHHHHHHHHTCCCGGGEEEEEEBTTSCEEECCSSSBGGGSCBCCCSS
T ss_pred             CEEEEEEEcCCEEEEEEcCCChHHHHHHHHHHHcCCcccccceEEEECCCCCeEeccCCCchhhhccCCCCC
Confidence            479999999999999999999999999999999999999999999999999999999999999998777665
>d1h4ra3 d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gg3a3 d.15.1.4 (A:1-81) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bkfa1 d.15.2.2 (A:1-85) Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgya_ d.15.1.5 (A:) Rap guanine nucleotide exchange factor 5, RapGEF5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure