Psyllid ID: psy11828

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440---
MQFIPIIWWKTNLKKLLQHLYVNYCMKYINMLLAHKIKVIMVFDGRHLPAKEATEEDRRKRAEIRHKQKAAELLHSGSSIIYKLDLSGNCCFMDREKLPSALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENALRKINVYGKIGSYVKITKEFLTSGAPQPFGARNEGRSLLSAVTERNIAGYADYVITEDSDLLVFGAKKIIYKLDLSGNCCFMDREKLPSALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENRKEYVKYAKVFPLTAILDMKVPAKWYRRIIGSIEVICGFSMATIPFNMKVPAKWYRRIIGSIEVICGFSMATIPFILAGKAILDMKVPAKWYRRIIGSIEVICGFSMATIPFSTYYLLVCKLDEMILRKNVQYTPAVIKQSYYYLHQTVKE
cccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccccEEEEcccccHHHcccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccEEEEEccccccccccccHHHHHccccccEEEEEccccHHHHccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccEEccccccccccccHHHHHHHHHHHHcccccccHHHHHccccccccccHHHHHHHHHcHHEEEcccccccccccEEEEEEcHHHHHHHHcccccHHHHHHHHHHHHHHccc
cccEEEEEEEccccccccHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccEEEEEHHHHHHHHccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHcccccccEccHHHHHHHcHcHHHHHHccccEEEEccHHcHcccEEEEEEccccEEEEcccEEEEEEcccccEEEEEHHHHHHHHccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHccEEEEEcccccccccHHHHHHHHHHHHHHHHHccccccHEEEEHEHHHHHHccc
MQFIPIIWWKTNLKKLLQHLYVNYCMKYINMLLAHKIKVIMVfdgrhlpakeatEEDRRKRAEIRHKQKAAELLHSGSSIIYkldlsgnccfmdreklpsalkmplakftdaKFRYMCILsgcdywtgikgmglkKAKDYVFSIMDPDFENALRKINVYGKIGSYVKITKEfltsgapqpfgarnegRSLLSAVTERNIAGYADYVITEDSDLLVFGAKKIIYKLdlsgnccfmdreklpsalkmplakftdaKFRYMCILsgcdywtgikgmglKKAKDYVFSimdpdfenRKEYVKYAKVFPltaildmkvpaKWYRRIIGSIEVICgfsmatipfnmkvpAKWYRRIIGSIEVICGFSMATIPFILAGKAILDMKVPAKWYRRIIGSIEVICgfsmatipfsTYYLLVCKLDEMILRKNVQYTPAVIKQSYYYLHQTVKE
MQFIPIIWWKTNLKKLLQHLYVNYCMKYINMLLAHKIKVIMVFDGRhlpakeateedrrKRAEIRHKQkaaellhsgsSIIYKLDLSGNCCFMDREKLPSALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENALRKINVYGKIGSYVKITKEFLtsgapqpfgarnEGRSLLSAVTERNIAGYADYVITEDSDLLVFGAKKIIYKLDLSGNCCFMDREKLPSALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENRKEYVKYAKVFpltaildmkvpAKWYRRIIGSIEVICGFSMATIPFNMKVPAKWYRRIIGSIEVICGFSMATIPFILAGKAILDMKVPAKWYRRIIGSIEVICGFSMATIPFSTYYLLVCKLDEMILRKNVQYTPAVIKQSYYYLHQTVKE
MQFIPIIWWKTNLKKLLQHLYVNYCMKYINMLLAHKIKVIMVFDGRHLPAKEATEEDRRKRAEIRHKQKAAELLHSGSSIIYKLDLSGNCCFMDREKLPSALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENALRKINVYGKIGSYVKITKEFLTSGAPQPFGARNEGRSLLSAVTERNIAGYADYVITEDSDLLVFGAKKIIYKLDLSGNCCFMDREKLPSALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENRKEYVKYAKVFPLTAILDMKVPAKWYRRIIGSIEVICGFSMATIPFNMKVPAKWYRRIIGSIEVICGFSMATIPFILAGKAILDMKVPAKWYRRIIGSIEVICGFSMATIPFSTYYLLVCKLDEMILRKNVQYTPAVIKQSYYYLHQTVKE
**FIPIIWWKTNLKKLLQHLYVNYCMKYINMLLAHKIKVIMVFDGRH*************************LLHSGSSIIYKLDLSGNCCFMDREKLPSALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENALRKINVYGKIGSYVKITKEFLTSGAP**F******RSLLSAVTERNIAGYADYVITEDSDLLVFGAKKIIYKLDLSGNCCFMDREKLPSALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENRKEYVKYAKVFPLTAILDMKVPAKWYRRIIGSIEVICGFSMATIPFNMKVPAKWYRRIIGSIEVICGFSMATIPFILAGKAILDMKVPAKWYRRIIGSIEVICGFSMATIPFSTYYLLVCKLDEMILRKNVQYTPAVIKQSYYYLHQ****
*QFIPIIWWKTNLKKLLQHLYVNYCMKYINMLLAHKIKVIMVFDGRH***********************AELLHSGSSIIYKLDLSGNCCFMDREKLPSALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENALRKINVYGKIGSYVKITKEFLTSGAPQPFGARNEGRSLLSAVTERNIAGYADYVITEDSDLLVFGAKKIIYKLDLSGNCCFMDREKLPSALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENRKEYVKYAKVFPLTAILDMKVPAKWYRRIIGSIEVICGFSMATIPFNMKVPAKWYRRIIGSIEVICGFSMATIPFILAGKAILDMKVPAKWYRRIIGSIEVICGFSMATIPFSTYYLLVCKLDEMILRKNVQYTPAVIKQSYYYLHQTV**
MQFIPIIWWKTNLKKLLQHLYVNYCMKYINMLLAHKIKVIMVFDGRHLPAK****************QKAAELLHSGSSIIYKLDLSGNCCFMDREKLPSALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENALRKINVYGKIGSYVKITKEFLTSGAPQPFGARNEGRSLLSAVTERNIAGYADYVITEDSDLLVFGAKKIIYKLDLSGNCCFMDREKLPSALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENRKEYVKYAKVFPLTAILDMKVPAKWYRRIIGSIEVICGFSMATIPFNMKVPAKWYRRIIGSIEVICGFSMATIPFILAGKAILDMKVPAKWYRRIIGSIEVICGFSMATIPFSTYYLLVCKLDEMILRKNVQYTPAVIKQSYYYLHQTVKE
MQFIPIIWWKTNLKKLLQHLYVNYCMKYINMLLAHKIKVIMVFDGRHLPAKEATEEDRRKRAEIRHKQKAAELLHSGSSIIYKLDLSGNCCFMDREKLPSALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENALRKINVYGKIGSYVKITKEFLTSGAPQPFGARNEGRSLLSAVTERNIAGYADYVITEDSDLLVFGAKKIIYKLDLSGNCCFMDREKLPSALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENRKEYVKYAKVFPLTAILDMKVPAKWYRRIIGSIEVICGFSMATIPFNMKVPAKWYRRIIGSIEVICGFSMATIPFILAGKAILDMKVPAKWYRRIIGSIEVICGFSMATIPFSTYYLLVCKLDEMILRKNVQYTPAVIKQSYYYLHQT***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQFIPIIWWKTNLKKLLQHLYVNYCMKYINMLLAHKIKVIMVFDGRHLPAKEATEEDRRKRAEIRHKQKAAELLHSGSSIIYKLDLSGNCCFMDREKLPSALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENALRKINVYGKIGSYVKITKEFLTSGAPQPFGARNEGRSLLSAVTERNIAGYADYVITEDSDLLVFGAKKIIYKLDLSGNCCFMDREKLPSALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENRKEYVKYAKVFPLTAILDMKVPAKWYRRIIGSIEVICGFSMATIPFNMKVPAKWYRRIIGSIEVICGFSMATIPFILAGKAILDMKVPAKWYRRIIGSIEVICGFSMATIPFSTYYLLVCKLDEMILRKNVQYTPAVIKQSYYYLHQTVKE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query443 2.2.26 [Sep-21-2011]
Q24558 732 Exonuclease 1 OS=Drosophi yes N/A 0.207 0.125 0.483 1e-16
Q9QZ11 837 Exonuclease 1 OS=Mus musc yes N/A 0.207 0.109 0.494 1e-15
Q9UQ84 846 Exonuclease 1 OS=Homo sap yes N/A 0.241 0.126 0.434 1e-15
Q9W6K2 734 Exonuclease 1 OS=Xenopus N/A N/A 0.243 0.147 0.413 2e-14
P53695 571 Exodeoxyribonuclease 1 OS yes N/A 0.189 0.147 0.447 8e-14
Q803U7 806 Exonuclease 1 OS=Danio re yes N/A 0.196 0.107 0.459 2e-13
Q8L6Z7 735 Exonuclease 1 OS=Arabidop yes N/A 0.178 0.107 0.45 3e-12
Q54ED2 1046 Exonuclease 1 OS=Dictyost yes N/A 0.196 0.083 0.438 2e-11
Q60GC1 836 Exonuclease 1 OS=Oryza sa no N/A 0.167 0.088 0.453 7e-10
P39875 702 Exodeoxyribonuclease 1 OS yes N/A 0.191 0.121 0.408 5e-09
>sp|Q24558|EXO1_DROME Exonuclease 1 OS=Drosophila melanogaster GN=tos PE=1 SV=1 Back     alignment and function desciption
 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 58/93 (62%)

Query: 198 NIAGYADYVITEDSDLLVFGAKKIIYKLDLSGNCCFMDREKLPSALKMPLAKFTDAKFRY 257
           N A  A Y+ITEDSDL +FGAK II+KLDL+G+   ++ EKL  A+     K+   KFR 
Sbjct: 159 NRADVAQYIITEDSDLTLFGAKNIIFKLDLNGSGLLVEAEKLHLAMGCTEEKYHFDKFRR 218

Query: 258 MCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDF 290
           MCILSGCDY   + G+GL KA  ++      D 
Sbjct: 219 MCILSGCDYLDSLPGIGLAKACKFILKTEQEDM 251
5'->3' double-stranded DNA exonuclease which may also contain a cryptic 3'->5' double-stranded DNA exonuclease activity. Also exhibits endonuclease activity against 5'-overhanging flap structures similar to those generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. Required for DNA mismatch repair (MMR).
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 1EC: .EC: -EC: .EC: -
>sp|Q9QZ11|EXO1_MOUSE Exonuclease 1 OS=Mus musculus GN=Exo1 PE=2 SV=2 Back     alignment and function description
>sp|Q9UQ84|EXO1_HUMAN Exonuclease 1 OS=Homo sapiens GN=EXO1 PE=1 SV=2 Back     alignment and function description
>sp|Q9W6K2|EXO1_XENLA Exonuclease 1 OS=Xenopus laevis GN=exo1 PE=2 SV=1 Back     alignment and function description
>sp|P53695|EXO1_SCHPO Exodeoxyribonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=exo1 PE=1 SV=1 Back     alignment and function description
>sp|Q803U7|EXO1_DANRE Exonuclease 1 OS=Danio rerio GN=exo1 PE=2 SV=1 Back     alignment and function description
>sp|Q8L6Z7|EXO1_ARATH Exonuclease 1 OS=Arabidopsis thaliana GN=EXO1 PE=2 SV=2 Back     alignment and function description
>sp|Q54ED2|EXO1_DICDI Exonuclease 1 OS=Dictyostelium discoideum GN=exo1 PE=3 SV=1 Back     alignment and function description
>sp|Q60GC1|EXO1_ORYSJ Exonuclease 1 OS=Oryza sativa subsp. japonica GN=EXO1 PE=2 SV=1 Back     alignment and function description
>sp|P39875|EXO1_YEAST Exodeoxyribonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EXO1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query443
357603281 654 exonuclease [Danaus plexippus] 0.212 0.143 0.494 3e-19
350425172 619 PREDICTED: exonuclease 1-like [Bombus im 0.279 0.200 0.405 5e-19
340709250 725 PREDICTED: exonuclease 1-like [Bombus te 0.257 0.157 0.435 2e-18
328720558 675 PREDICTED: exonuclease 1-like [Acyrthosi 0.252 0.165 0.383 6e-18
307198944 1355 Exonuclease 1 [Harpegnathos saltator] 0.205 0.067 0.478 2e-17
157112576 770 exonuclease [Aedes aegypti] gi|108878018 0.207 0.119 0.505 4e-17
270016559 581 hypothetical protein TcasGA2_TC001970 [T 0.189 0.144 0.529 6e-17
213404598 566 exonuclease I Exo1 [Schizosaccharomyces 0.191 0.150 0.483 6e-17
383861101 612 PREDICTED: exonuclease 1-like [Megachile 0.189 0.137 0.470 6e-17
91094765 563 PREDICTED: similar to exonuclease [Tribo 0.189 0.149 0.529 7e-17
>gi|357603281|gb|EHJ63691.1| exonuclease [Danaus plexippus] Back     alignment and taxonomy information
 Score =  102 bits (254), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%)

Query: 198 NIAGYADYVITEDSDLLVFGAKKIIYKLDLSGNCCFMDREKLPSALKMPLAKFTDAKFRY 257
           NI  YA  VITEDSDL++FG  K+++K+DL GN   ++  KLP  +K P+  +T  KFR 
Sbjct: 159 NIKNYAQLVITEDSDLILFGCTKVLFKMDLEGNGTLVETIKLPLVMKCPIEHYTFDKFRR 218

Query: 258 MCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFEN 292
           MCILSGCDY   + G+GL KA+ +V +  D +F N
Sbjct: 219 MCILSGCDYLNSLPGIGLAKARQFVNASQDTNFAN 253

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350425172|ref|XP_003494035.1| PREDICTED: exonuclease 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340709250|ref|XP_003393224.1| PREDICTED: exonuclease 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328720558|ref|XP_001942954.2| PREDICTED: exonuclease 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307198944|gb|EFN79696.1| Exonuclease 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|157112576|ref|XP_001657573.1| exonuclease [Aedes aegypti] gi|108878018|gb|EAT42243.1| AAEL006209-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|270016559|gb|EFA13005.1| hypothetical protein TcasGA2_TC001970 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|213404598|ref|XP_002173071.1| exonuclease I Exo1 [Schizosaccharomyces japonicus yFS275] gi|212001118|gb|EEB06778.1| exonuclease I Exo1 [Schizosaccharomyces japonicus yFS275] Back     alignment and taxonomy information
>gi|383861101|ref|XP_003706025.1| PREDICTED: exonuclease 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|91094765|ref|XP_967471.1| PREDICTED: similar to exonuclease [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query443
FB|FBgn0015553 732 tos "tosca" [Drosophila melano 0.207 0.125 0.489 1.9e-27
UNIPROTKB|F1S8P2 836 EXO1 "Uncharacterized protein" 0.320 0.169 0.364 6.8e-24
UNIPROTKB|Q9UQ84 846 EXO1 "Exonuclease 1" [Homo sap 0.205 0.107 0.478 2e-23
UNIPROTKB|E2QWL7 836 EXO1 "Uncharacterized protein" 0.205 0.108 0.478 2.4e-23
UNIPROTKB|E1BF15 835 EXO1 "Uncharacterized protein" 0.205 0.108 0.489 3e-23
RGD|1309465 836 Exo1 "exonuclease 1" [Rattus n 0.205 0.108 0.489 1e-22
MGI|MGI:1349427 837 Exo1 "exonuclease 1" [Mus musc 0.205 0.108 0.489 1.3e-22
ZFIN|ZDB-GENE-040426-2828 806 exo1 "exonuclease 1" [Danio re 0.234 0.129 0.433 2.2e-22
UNIPROTKB|Q9W6K2 734 exo1 "Exonuclease 1" [Xenopus 0.196 0.118 0.465 2.3e-20
UNIPROTKB|E1C1G7 798 EXO1 "Uncharacterized protein" 0.205 0.114 0.467 1.4e-19
FB|FBgn0015553 tos "tosca" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 214 (80.4 bits), Expect = 1.9e-27, Sum P(2) = 1.9e-27
 Identities = 45/92 (48%), Positives = 58/92 (63%)

Query:   198 NIAGYADYVITEDSDLLVFGAKKIIYKLDLSGNCCFMDREKLPSALKMPLAKFTDAKFRY 257
             N A  A Y+ITEDSDL +FGAK II+KLDL+G+   ++ EKL  A+     K+   KFR 
Sbjct:   159 NRADVAQYIITEDSDLTLFGAKNIIFKLDLNGSGLLVEAEKLHLAMGCTEEKYHFDKFRR 218

Query:   258 MCILSGCDYWTGIKGMGLKKAKDYVFSIMDPD 289
             MCILSGCDY   + G+GL KA  ++      D
Sbjct:   219 MCILSGCDYLDSLPGIGLAKACKFILKTEQED 250
GO:0008852 "exodeoxyribonuclease I activity" evidence=ISS
GO:0004518 "nuclease activity" evidence=NAS
GO:0006281 "DNA repair" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
UNIPROTKB|F1S8P2 EXO1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UQ84 EXO1 "Exonuclease 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QWL7 EXO1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BF15 EXO1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1309465 Exo1 "exonuclease 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1349427 Exo1 "exonuclease 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2828 exo1 "exonuclease 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9W6K2 exo1 "Exonuclease 1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|E1C1G7 EXO1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query443
cd09857210 cd09857, PIN_EXO1, PIN domain of Exonuclease-1, a 1e-18
cd09857210 cd09857, PIN_EXO1, PIN domain of Exonuclease-1, a 4e-14
cd0990873 cd09908, H3TH_EXO1, H3TH domain of Exonuclease-1, 1e-10
cd0990873 cd09908, H3TH_EXO1, H3TH domain of Exonuclease-1, 9e-10
cd0990173 cd09901, H3TH_FEN1-like, H3TH domains of Flap endo 2e-09
smart0048473 smart00484, XPGI, Xeroderma pigmentosum G I-region 4e-09
cd0990173 cd09901, H3TH_FEN1-like, H3TH domains of Flap endo 9e-09
COG0258310 COG0258, Exo, 5'-3' exonuclease (including N-termi 3e-08
smart0048599 smart00485, XPGN, Xeroderma pigmentosum G N-region 1e-07
cd0989768 cd09897, H3TH_FEN1-XPG-like, H3TH domains of Flap 9e-07
cd0989768 cd09897, H3TH_FEN1-XPG-like, H3TH domains of Flap 9e-07
PTZ00217393 PTZ00217, PTZ00217, flap endonuclease-1; Provision 2e-06
cd09870239 cd09870, PIN_YEN1, PIN domain of Yeast Endonucleas 1e-05
TIGR03674338 TIGR03674, fen_arch, flap structure-specific endon 5e-05
pfam0086746 pfam00867, XPG_I, XPG I-region 6e-05
PRK03980292 PRK03980, PRK03980, flap endonuclease-1; Provision 8e-05
smart0027936 smart00279, HhH2, Helix-hairpin-helix class 2 (Pol 8e-04
smart0027936 smart00279, HhH2, Helix-hairpin-helix class 2 (Pol 8e-04
cd0990770 cd09907, H3TH_FEN1-Euk, H3TH domain of Flap Endonu 0.003
cd0990770 cd09907, H3TH_FEN1-Euk, H3TH domain of Flap Endonu 0.003
>gnl|CDD|189027 cd09857, PIN_EXO1, PIN domain of Exonuclease-1, a structure-specific, divalent-metal-ion dependent, 5' nuclease and homologs Back     alignment and domain information 
 Score = 84.1 bits (209), Expect = 1e-18
 Identities = 33/57 (57%), Positives = 42/57 (73%), Gaps = 1/57 (1%)

Query: 21  YVNYCMKYINMLLAHKIKVIMVFDGRHLPAKEATEEDRRKRAEIRHKQKAAELLHSG 77
           YV YCMK +NMLL + IK I+VFDG  LP+K+ TEE+RR+R E  + +KA ELL  G
Sbjct: 55  YVQYCMKRVNMLLHYGIKPILVFDGGPLPSKKGTEEERRERRE-ENLEKALELLREG 110

Exonuclease-1 (EXO1) is involved in multiple, eukaryotic DNA metabolic pathways, including DNA replication processes (5' flap DNA endonuclease activity and double stranded DNA 5'-exonuclease activity), DNA repair processes (DNA mismatch repair (MMR) and post-replication repair (PRR)), recombination, and telomere integrity. EXO1 functions in the MMS2 error-free branch of the PRR pathway in the maintenance and repair of stalled replication forks. Studies also suggest that EXO1 plays both structural and catalytic roles during MMR-mediated mutation avoidance. EXO1 belongs to the FEN1-EXO1-like family of structure-specific, 5' nucleases. These nucleases contain a PIN (PilT N terminus) domain with a helical arch/clamp region (I domain) of variable length (approximately 43 residues in EXO1 PIN domains) and a H3TH (helix-3-turn-helix) domain, an atypical helix-hairpin-helix-2-like region. Both the H3TH domain (not included here) and the helical arch/clamp region are involved in DNA binding. Nucleases within this group also have a carboxylate-rich active site that is involved in binding essential divalent metal ion cofactors (Mg2+/Mn2+). EXO1 nucleases also have C-terminal Mlh1- and Msh2-binding domains which allow interaction with MMR and PRR proteins, respectively. Length = 210
>gnl|CDD|189027 cd09857, PIN_EXO1, PIN domain of Exonuclease-1, a structure-specific, divalent-metal-ion dependent, 5' nuclease and homologs Back     alignment and domain information
>gnl|CDD|188628 cd09908, H3TH_EXO1, H3TH domain of Exonuclease-1, a structure-specific, divalent-metal-ion dependent, 5' nuclease Back     alignment and domain information
>gnl|CDD|188628 cd09908, H3TH_EXO1, H3TH domain of Exonuclease-1, a structure-specific, divalent-metal-ion dependent, 5' nuclease Back     alignment and domain information
>gnl|CDD|188621 cd09901, H3TH_FEN1-like, H3TH domains of Flap endonuclease-1 (FEN1)-like structure specific 5' nucleases: FEN1 (eukaryotic) and EXO1 Back     alignment and domain information
>gnl|CDD|214689 smart00484, XPGI, Xeroderma pigmentosum G I-region Back     alignment and domain information
>gnl|CDD|188621 cd09901, H3TH_FEN1-like, H3TH domains of Flap endonuclease-1 (FEN1)-like structure specific 5' nucleases: FEN1 (eukaryotic) and EXO1 Back     alignment and domain information
>gnl|CDD|223336 COG0258, Exo, 5'-3' exonuclease (including N-terminal domain of PolI) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|214690 smart00485, XPGN, Xeroderma pigmentosum G N-region Back     alignment and domain information
>gnl|CDD|188617 cd09897, H3TH_FEN1-XPG-like, H3TH domains of Flap endonuclease-1 (FEN1)-like structure specific 5' nucleases Back     alignment and domain information
>gnl|CDD|188617 cd09897, H3TH_FEN1-XPG-like, H3TH domains of Flap endonuclease-1 (FEN1)-like structure specific 5' nucleases Back     alignment and domain information
>gnl|CDD|240317 PTZ00217, PTZ00217, flap endonuclease-1; Provisional Back     alignment and domain information
>gnl|CDD|189040 cd09870, PIN_YEN1, PIN domain of Yeast Endonuclease 1, a structure-specific, divalent-metal-ion dependent, 5' nuclease and fungal homologs Back     alignment and domain information
>gnl|CDD|234306 TIGR03674, fen_arch, flap structure-specific endonuclease Back     alignment and domain information
>gnl|CDD|216163 pfam00867, XPG_I, XPG I-region Back     alignment and domain information
>gnl|CDD|235185 PRK03980, PRK03980, flap endonuclease-1; Provisional Back     alignment and domain information
>gnl|CDD|197623 smart00279, HhH2, Helix-hairpin-helix class 2 (Pol1 family) motifs Back     alignment and domain information
>gnl|CDD|197623 smart00279, HhH2, Helix-hairpin-helix class 2 (Pol1 family) motifs Back     alignment and domain information
>gnl|CDD|188627 cd09907, H3TH_FEN1-Euk, H3TH domain of Flap Endonuclease-1, a structure-specific, divalent-metal-ion dependent, 5' nuclease: Eukaryotic homologs Back     alignment and domain information
>gnl|CDD|188627 cd09907, H3TH_FEN1-Euk, H3TH domain of Flap Endonuclease-1, a structure-specific, divalent-metal-ion dependent, 5' nuclease: Eukaryotic homologs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 443
PRK03980292 flap endonuclease-1; Provisional 100.0
PTZ00217393 flap endonuclease-1; Provisional 100.0
KOG2518|consensus 556 100.0
cd00128316 XPG Xeroderma pigmentosum G N- and I-regions (XPGN 100.0
TIGR03674338 fen_arch flap structure-specific endonuclease. End 100.0
KOG2519|consensus449 100.0
TIGR006001034 rad2 DNA excision repair protein (rad2). All prote 100.0
KOG2520|consensus815 99.95
cd00008240 53EXOc 5'-3' exonuclease; T5 type 5'-3' exonucleas 99.89
smart00475259 53EXOc 5'-3' exonuclease. 99.89
COG0258310 Exo 5'-3' exonuclease (including N-terminal domain 99.89
PRK14976281 5'-3' exonuclease; Provisional 99.87
PF0086794 XPG_I: XPG I-region; InterPro: IPR006086 This entr 99.85
PRK05755 880 DNA polymerase I; Provisional 99.81
TIGR00593 887 pola DNA polymerase I. This family is based on the 99.8
PRK09482256 flap endonuclease-like protein; Provisional 99.68
smart0048473 XPGI Xeroderma pigmentosum G I-region. domain in n 99.61
cd0008075 HhH2_motif Helix-hairpin-helix class 2 (Pol1 famil 99.37
PF00752101 XPG_N: XPG N-terminal domain; InterPro: IPR006085 99.22
smart0048599 XPGN Xeroderma pigmentosum G N-region. domain in n 99.18
KOG2518|consensus556 99.17
TIGR00600 1034 rad2 DNA excision repair protein (rad2). All prote 98.98
smart0027936 HhH2 Helix-hairpin-helix class 2 (Pol1 family) mot 98.92
PHA00439286 exonuclease 98.86
PF01367101 5_3_exonuc: 5'-3' exonuclease, C-terminal SAM fold 98.75
cd0008075 HhH2_motif Helix-hairpin-helix class 2 (Pol1 famil 98.34
PRK03980292 flap endonuclease-1; Provisional 98.05
PTZ00217393 flap endonuclease-1; Provisional 97.99
cd00128316 XPG Xeroderma pigmentosum G N- and I-regions (XPGN 97.83
TIGR03674338 fen_arch flap structure-specific endonuclease. End 97.73
PF12813246 XPG_I_2: XPG domain containing 97.72
smart0027936 HhH2 Helix-hairpin-helix class 2 (Pol1 family) mot 97.55
PHA02567304 rnh RnaseH; Provisional 97.44
PF02739169 5_3_exonuc_N: 5'-3' exonuclease, N-terminal resolv 97.21
smart00475259 53EXOc 5'-3' exonuclease. 96.97
cd00008240 53EXOc 5'-3' exonuclease; T5 type 5'-3' exonucleas 96.92
COG0258310 Exo 5'-3' exonuclease (including N-terminal domain 96.84
PF04599425 Pox_G5: Poxvirus G5 protein; InterPro: IPR007678 P 96.82
KOG2519|consensus449 96.79
PRK14976281 5'-3' exonuclease; Provisional 96.38
PHA03065438 Hypothetical protein; Provisional 96.16
PF03159237 XRN_N: XRN 5'-3' exonuclease N-terminus; InterPro: 96.04
PF1224790 MKT1_N: Temperature dependent protein affecting M2 95.75
COG5049 953 XRN1 5'-3' exonuclease [DNA replication, recombina 95.56
PRK05755 880 DNA polymerase I; Provisional 95.2
KOG2045|consensus 1493 94.46
TIGR00593 887 pola DNA polymerase I. This family is based on the 94.13
PRK09482256 flap endonuclease-like protein; Provisional 94.01
COG5366 531 Protein involved in propagation of M2 dsRNA satell 92.02
PF1282664 HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS 90.48
PF01367101 5_3_exonuc: 5'-3' exonuclease, C-terminal SAM fold 86.39
PF0063330 HHH: Helix-hairpin-helix motif; InterPro: IPR00044 83.31
PF1039152 DNA_pol_lambd_f: Fingers domain of DNA polymerase 81.44
>PRK03980 flap endonuclease-1; Provisional Back     alignment and domain information 
Probab=100.00  E-value=8.7e-50  Score=397.75  Aligned_cols=247  Identities=24%  Similarity=0.245  Sum_probs=211.7

Q ss_pred             hhhhhhHHHHHHHHHHHHHhCCCEEEEEEcCCCCCcchhhHHHHHHHHHHHHHHHHHHHhhcCCcccccccccccceeee
Q psy11828         15 KLLQHLYVNYCMKYINMLLAHKIKVIMVFDGRHLPAKEATEEDRRKRAEIRHKQKAAELLHSGSSIIYKLDLSGNCCFMD   94 (443)
Q Consensus        15 ~~~~~~~l~~~~~~i~~L~~~gI~PvfVFDG~~pp~K~~t~~~R~~~R~~~~~~~a~~~~~~g~~~~fKld~~~~~~~~~   94 (443)
                      .|..++|+.++++|+..|+++||+|||||||.+|+.|.++.++|+++|++ +.+++.++.++|+.+.      +..++++
T Consensus         4 ~G~~Ts~l~g~~~r~~~ll~~gi~PvfVFDG~~p~~K~~~~~~rk~~R~~-a~~~~~~~~~~g~~~~------a~k~~~~   76 (292)
T PRK03980          4 KGRITSHLSGIFYRTINLLENGIKPVYVFDGKPPELKAEEIEERREVREE-AEEKYEEAKEEGDLEE------ARKYAQR   76 (292)
T ss_pred             CCcCcHHHHHHHHHHHHHHHCCCEEEEEECCCCchHHHHHHHHHHHHHHH-hHHHHHHHHHcCCHHH------HHHHHhc
Confidence            34567899999999999999999999999999999999999999999999 7778888888998766      7788888


Q ss_pred             ccCCChhhcccccccchHHHHHHHHhcCCCCCCCccccchhhHHHHHhhccCccHHHHHHHhhhhccccceEEeccchhc
Q psy11828         95 REKLPSALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENALRKINVYGKIGSYVKITKEFLT  174 (443)
Q Consensus        95 ~~~v~~~~~~~~~~~t~~~f~~~ciL~GCdYl~~i~g~G~k~A~~~V~~i~~~d~~~ll~~L~~~~k~~~~v~~~~~f~~  174 (443)
                      +.++++++...+.+        +|.++|                                           |||      
T Consensus        77 ~~~vt~~~~~~~k~--------lL~~~G-------------------------------------------Ip~------   99 (292)
T PRK03980         77 SSRLTDEIVEDSKK--------LLDLMG-------------------------------------------IPY------   99 (292)
T ss_pred             cccCCHHHHHHHHH--------HHHHCC-------------------------------------------CCE------
Confidence            99999887654443        366666                                           999      


Q ss_pred             CCccCCCccccchhhhHHHhHhhhhCCCeEEEecCCCceeeeccCEEEEecCCCCC-------------eEEeccccccc
Q psy11828        175 SGAPQPFGARNEGRSLLSAVTERNIAGYADYVITEDSDLLVFGAKKIIYKLDLSGN-------------CCFMDREKLPS  241 (443)
Q Consensus       175 ~~i~AP~EAdaEgEAQ~A~L~~~~~~g~vd~ViTeDsD~L~fG~~~vi~~l~~~g~-------------~~~i~~~~l~~  241 (443)
                        ++||+||||    |||+|++.   |.||+|+|+|+|+|+||+++|+++++..++             ...|+.+.+.+
T Consensus       100 --i~AP~EAEA----q~A~L~~~---g~vd~V~S~D~D~l~fg~~~vir~l~~~~~~~~p~~~~~~~~~~e~~~~~~vl~  170 (292)
T PRK03980        100 --VQAPSEGEA----QAAYMAKK---GDAWAVGSQDYDSLLFGAPRLVRNLTISGKRKLPGKNVYVEVKPELIELEEVLK  170 (292)
T ss_pred             --EecCchHHH----HHHHHHHC---CCeEEEecCCcCeeeecCCEEEEeecccccccCccccccccccceeeeHHHHHH
Confidence              999998888    99999877   999999999999999999999999986542             23577777765


Q ss_pred             cccCCCCCCCHHHHHHHHHHhCCCCCCCCCCCcHHHHHHHHHHcCCCChhhHHHhhhhccccccccccCCCCCh-hHHHh
Q psy11828        242 ALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENRKEYVKYAKVFPLTAILDMKVPA-KWYRR  320 (443)
Q Consensus       242 ~~~l~~~~lt~eqfidl~iL~G~DY~~gipGiG~ktA~~li~~~~~~sle~~~~~~~~~~~~~~~~~~~~~~P~-~~~r~  320 (443)
                      .     +|++++||+|+|+|+||||+|||||||||||++||++|+  +||++++++.            ..+|+ ..-|+
T Consensus       171 ~-----lgl~~~q~id~~iL~G~Dy~~GI~GIG~ktA~kLi~~~~--sle~i~~~~~------------~~~~~~~~~r~  231 (292)
T PRK03980        171 E-----LGITREQLIDIAILVGTDYNPGIKGIGPKTALKLIKKHG--DLEKVLEERG------------FEIENYDEIRE  231 (292)
T ss_pred             H-----hCCCHHHHHHHHHhcCCCCCCCCCCccHHHHHHHHHHCC--CHHHHHHhcc------------CCCCCHHHHHH
Confidence            4     689999999999999999999999999999999999998  8999998654            23443 44499


Q ss_pred             hhcCCcccccccccccCCCCCCCchhhcccCCcHHHHHHHhhhhhhH
Q psy11828        321 IIGSIEVICGFSMATIPFNMKVPAKWYRRIIGSIEVICGFSMATIPF  367 (443)
Q Consensus       321 l~~~p~v~~~~~~~~vp~~~~~~~~w~~~~v~~l~~l~~fl~~~i~~  367 (443)
                      +|++|+|++           ...++|   ..|+++.|+.||....+|
T Consensus       232 ~f~~p~v~~-----------~~~~~~---~~pd~~~l~~fl~~e~~f  264 (292)
T PRK03980        232 FFLNPPVTD-----------DYELKW---KEPDKEGIIEFLVEEHDF  264 (292)
T ss_pred             HhcCCCCCC-----------CCCccC---CCCCHHHHHHHHhccCCC
Confidence            999999983           335677   899999999999877654

>PTZ00217 flap endonuclease-1; Provisional Back     alignment and domain information
>KOG2518|consensus Back     alignment and domain information
>cd00128 XPG Xeroderma pigmentosum G N- and I-regions (XPGN, XPGI); contains the HhH2 motif; domain in nucleases Back     alignment and domain information
>TIGR03674 fen_arch flap structure-specific endonuclease Back     alignment and domain information
>KOG2519|consensus Back     alignment and domain information
>TIGR00600 rad2 DNA excision repair protein (rad2) Back     alignment and domain information
>KOG2520|consensus Back     alignment and domain information
>cd00008 53EXOc 5'-3' exonuclease; T5 type 5'-3' exonuclease domains may co-occur with DNA polymerase I (Pol I) domains, or be part of Pol I containing complexes Back     alignment and domain information
>smart00475 53EXOc 5'-3' exonuclease Back     alignment and domain information
>COG0258 Exo 5'-3' exonuclease (including N-terminal domain of PolI) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14976 5'-3' exonuclease; Provisional Back     alignment and domain information
>PF00867 XPG_I: XPG I-region; InterPro: IPR006086 This entry represents endonucleases that cleave the 5'-overhanging flap structure that is generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment Back     alignment and domain information
>PRK05755 DNA polymerase I; Provisional Back     alignment and domain information
>TIGR00593 pola DNA polymerase I Back     alignment and domain information
>PRK09482 flap endonuclease-like protein; Provisional Back     alignment and domain information
>smart00484 XPGI Xeroderma pigmentosum G I-region Back     alignment and domain information
>cd00080 HhH2_motif Helix-hairpin-helix class 2 (Pol1 family) motif Back     alignment and domain information
>PF00752 XPG_N: XPG N-terminal domain; InterPro: IPR006085 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer Back     alignment and domain information
>smart00485 XPGN Xeroderma pigmentosum G N-region Back     alignment and domain information
>KOG2518|consensus Back     alignment and domain information
>TIGR00600 rad2 DNA excision repair protein (rad2) Back     alignment and domain information
>smart00279 HhH2 Helix-hairpin-helix class 2 (Pol1 family) motifs Back     alignment and domain information
>PHA00439 exonuclease Back     alignment and domain information
>PF01367 5_3_exonuc: 5'-3' exonuclease, C-terminal SAM fold; InterPro: IPR020045 This entry represents the C-terminal domain of 5' to 3' exonucleases Back     alignment and domain information
>cd00080 HhH2_motif Helix-hairpin-helix class 2 (Pol1 family) motif Back     alignment and domain information
>PRK03980 flap endonuclease-1; Provisional Back     alignment and domain information
>PTZ00217 flap endonuclease-1; Provisional Back     alignment and domain information
>cd00128 XPG Xeroderma pigmentosum G N- and I-regions (XPGN, XPGI); contains the HhH2 motif; domain in nucleases Back     alignment and domain information
>TIGR03674 fen_arch flap structure-specific endonuclease Back     alignment and domain information
>PF12813 XPG_I_2: XPG domain containing Back     alignment and domain information
>smart00279 HhH2 Helix-hairpin-helix class 2 (Pol1 family) motifs Back     alignment and domain information
>PHA02567 rnh RnaseH; Provisional Back     alignment and domain information
>PF02739 5_3_exonuc_N: 5'-3' exonuclease, N-terminal resolvase-like domain; InterPro: IPR020046 The N-terminal and internal 5'3'-exonuclease domains are commonly found together, and are most often associated with 5' to 3' nuclease activities Back     alignment and domain information
>smart00475 53EXOc 5'-3' exonuclease Back     alignment and domain information
>cd00008 53EXOc 5'-3' exonuclease; T5 type 5'-3' exonuclease domains may co-occur with DNA polymerase I (Pol I) domains, or be part of Pol I containing complexes Back     alignment and domain information
>COG0258 Exo 5'-3' exonuclease (including N-terminal domain of PolI) [DNA replication, recombination, and repair] Back     alignment and domain information
>PF04599 Pox_G5: Poxvirus G5 protein; InterPro: IPR007678 Protein G5 is found in a number of Poxviruses Back     alignment and domain information
>KOG2519|consensus Back     alignment and domain information
>PRK14976 5'-3' exonuclease; Provisional Back     alignment and domain information
>PHA03065 Hypothetical protein; Provisional Back     alignment and domain information
>PF03159 XRN_N: XRN 5'-3' exonuclease N-terminus; InterPro: IPR004859 Signatures of this entry align residues towards the N terminus of several proteins with multiple functions Back     alignment and domain information
>PF12247 MKT1_N: Temperature dependent protein affecting M2 dsRNA replication; InterPro: IPR022040 This domain family is found in eukaryotes, and is typically between 231 and 255 amino acids in length Back     alignment and domain information
>COG5049 XRN1 5'-3' exonuclease [DNA replication, recombination, and repair / Cell division and chromosome partitioning / Translation] Back     alignment and domain information
>PRK05755 DNA polymerase I; Provisional Back     alignment and domain information
>KOG2045|consensus Back     alignment and domain information
>TIGR00593 pola DNA polymerase I Back     alignment and domain information
>PRK09482 flap endonuclease-like protein; Provisional Back     alignment and domain information
>COG5366 Protein involved in propagation of M2 dsRNA satellite of L-A virus [General function prediction only] Back     alignment and domain information
>PF12826 HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS_A 1V9P_B Back     alignment and domain information
>PF01367 5_3_exonuc: 5'-3' exonuclease, C-terminal SAM fold; InterPro: IPR020045 This entry represents the C-terminal domain of 5' to 3' exonucleases Back     alignment and domain information
>PF00633 HHH: Helix-hairpin-helix motif; InterPro: IPR000445 The HhH motif is an around 20 amino acids domain present in prokaryotic and eukaryotic non-sequence-specific DNA binding proteins [, , ] Back     alignment and domain information
>PF10391 DNA_pol_lambd_f: Fingers domain of DNA polymerase lambda; InterPro: IPR018944 DNA polymerases catalyse the addition of dNMPs onto the 3-prime ends of DNA chains Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query443
3qea_Z352 Crystal Structure Of Human Exonuclease 1 Exo1 (Wt) 5e-17
3qe9_Y352 Crystal Structure Of Human Exonuclease 1 Exo1 (D173 4e-16
1rxv_A336 Crystal Structure Of A. Fulgidus Fen-1 Bound To Dna 4e-04
>pdb|3QEA|Z Chain Z, Crystal Structure Of Human Exonuclease 1 Exo1 (Wt) In Complex With Dna (Complex Ii) Length = 352 Back     alignment and structure 
Iteration: 1

 Score = 85.9 bits (211), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 67/116 (57%), Gaps = 8/116 (6%)
Query: 182 GARNEGRSLLSAVTER-------NIAGYADYVITEDSDLLVFGAKKIIYKLDLSGNCCFM 234
            AR++G   L A  E        N AG    +ITEDSDLL FG KK+I K+D  GN   +
Sbjct: 136 AARSQGVDCLVAPYEADAQLAYLNKAGIVQAIITEDSDLLAFGCKKVILKMDQFGNGLEI 195
Query: 235 DREKLPSALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDF 290
           D+ +L    ++    FT+ KFRYMCILSGCDY + ++G+GL KA   +    +PD 
Sbjct: 196 DQARLGMCRQLGDV-FTEEKFRYMCILSGCDYLSSLRGIGLAKACKVLRLANNPDI 250
>pdb|3QE9|Y Chain Y, Crystal Structure Of Human Exonuclease 1 Exo1 (D173a) In Complex With Dna (Complex I) Length = 352 Back     alignment and structure
>pdb|1RXV|A Chain A, Crystal Structure Of A. Fulgidus Fen-1 Bound To Dna Length = 336 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query443
3qe9_Y352 Exonuclease 1; exonuclease, hydrolase-DNA complex; 5e-22
3qe9_Y352 Exonuclease 1; exonuclease, hydrolase-DNA complex; 6e-15
3qe9_Y352 Exonuclease 1; exonuclease, hydrolase-DNA complex; 1e-07
1a76_A326 Flap endonuclease-1 protein; 5'-3' EXO/endo nuclea 4e-21
1a76_A326 Flap endonuclease-1 protein; 5'-3' EXO/endo nuclea 1e-09
1rxw_A336 Flap structure-specific endonuclease; helical clam 1e-20
1rxw_A336 Flap structure-specific endonuclease; helical clam 6e-12
1rxw_A336 Flap structure-specific endonuclease; helical clam 1e-05
3q8k_A341 Flap endonuclease 1; helix-3 turn-helix, hydrophob 2e-20
3q8k_A341 Flap endonuclease 1; helix-3 turn-helix, hydrophob 3e-12
3q8k_A341 Flap endonuclease 1; helix-3 turn-helix, hydrophob 2e-05
1ul1_X379 Flap endonuclease-1; protein complex, DNA-binding 9e-20
1ul1_X379 Flap endonuclease-1; protein complex, DNA-binding 4e-12
1ul1_X379 Flap endonuclease-1; protein complex, DNA-binding 1e-05
1b43_A340 Protein (FEN-1); nuclease, DNA repair, DNA replica 2e-19
1b43_A340 Protein (FEN-1); nuclease, DNA repair, DNA replica 2e-09
1b43_A340 Protein (FEN-1); nuclease, DNA repair, DNA replica 1e-04
3ory_A363 Flap endonuclease 1; hydrolase; 2.00A {Desulfuroco 2e-18
3ory_A363 Flap endonuclease 1; hydrolase; 2.00A {Desulfuroco 2e-10
3ory_A363 Flap endonuclease 1; hydrolase; 2.00A {Desulfuroco 3e-06
2izo_A346 FEN1, flap structure-specific endonuclease; hydrol 9e-18
2izo_A346 FEN1, flap structure-specific endonuclease; hydrol 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
>3qe9_Y Exonuclease 1; exonuclease, hydrolase-DNA complex; HET: DNA; 2.51A {Homo sapiens} PDB: 3qeb_Z* 3qea_Z* Length = 352 Back     alignment and structure
 Score = 95.8 bits (238), Expect = 5e-22
 Identities = 46/113 (40%), Positives = 63/113 (55%), Gaps = 5/113 (4%)

Query: 196 ERNIAGYADYVITEDSDLLVFGAKKIIYKLDLSGNCCFMDREKLPSALKMPLAKFTDAKF 255
             N AG    +ITEDS LL FG KK+I K+D  GN   +D+ +L    ++    FT+ KF
Sbjct: 157 YLNKAGIVQAIITEDSALLAFGCKKVILKMDQFGNGLEIDQARLGMCRQLGD-VFTEEKF 215

Query: 256 RYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPD----FENRKEYVKYAKVFP 304
           RYMCILSGCDY + ++G+GL KA   +    +PD     +    Y+K     P
Sbjct: 216 RYMCILSGCDYLSSLRGIGLAKACKVLRLANNPDIVKVIKKIGHYLKMNITVP 268
>3qe9_Y Exonuclease 1; exonuclease, hydrolase-DNA complex; HET: DNA; 2.51A {Homo sapiens} PDB: 3qeb_Z* 3qea_Z* Length = 352 Back     alignment and structure
>3qe9_Y Exonuclease 1; exonuclease, hydrolase-DNA complex; HET: DNA; 2.51A {Homo sapiens} PDB: 3qeb_Z* 3qea_Z* Length = 352 Back     alignment and structure
>1a76_A Flap endonuclease-1 protein; 5'-3' EXO/endo nuclease, DNA replication, RTH, RAD27, DNA repair; 2.00A {Methanocaldococcus jannaschii} SCOP: a.60.7.1 c.120.1.2 PDB: 1a77_A Length = 326 Back     alignment and structure
>1a76_A Flap endonuclease-1 protein; 5'-3' EXO/endo nuclease, DNA replication, RTH, RAD27, DNA repair; 2.00A {Methanocaldococcus jannaschii} SCOP: a.60.7.1 c.120.1.2 PDB: 1a77_A Length = 326 Back     alignment and structure
>1rxw_A Flap structure-specific endonuclease; helical clamp, helix-3 turn-helix, hydrophobic wedge, 3' FLA site, hydrolase-DNA complex; 2.00A {Archaeoglobus fulgidus} SCOP: a.60.7.1 c.120.1.2 PDB: 1rxv_A Length = 336 Back     alignment and structure
>1rxw_A Flap structure-specific endonuclease; helical clamp, helix-3 turn-helix, hydrophobic wedge, 3' FLA site, hydrolase-DNA complex; 2.00A {Archaeoglobus fulgidus} SCOP: a.60.7.1 c.120.1.2 PDB: 1rxv_A Length = 336 Back     alignment and structure
>1rxw_A Flap structure-specific endonuclease; helical clamp, helix-3 turn-helix, hydrophobic wedge, 3' FLA site, hydrolase-DNA complex; 2.00A {Archaeoglobus fulgidus} SCOP: a.60.7.1 c.120.1.2 PDB: 1rxv_A Length = 336 Back     alignment and structure
>3q8k_A Flap endonuclease 1; helix-3 turn-helix, hydrophobic wedge, 3' flap binding site, hydrolase-DNA complex, DNA repair, replication; HET: DNA; 2.20A {Homo sapiens} PDB: 3q8l_A* 3q8m_A* Length = 341 Back     alignment and structure
>3q8k_A Flap endonuclease 1; helix-3 turn-helix, hydrophobic wedge, 3' flap binding site, hydrolase-DNA complex, DNA repair, replication; HET: DNA; 2.20A {Homo sapiens} PDB: 3q8l_A* 3q8m_A* Length = 341 Back     alignment and structure
>3q8k_A Flap endonuclease 1; helix-3 turn-helix, hydrophobic wedge, 3' flap binding site, hydrolase-DNA complex, DNA repair, replication; HET: DNA; 2.20A {Homo sapiens} PDB: 3q8l_A* 3q8m_A* Length = 341 Back     alignment and structure
>1ul1_X Flap endonuclease-1; protein complex, DNA-binding protein, flap DNA, flap endonuclease, sliding clamp, DNA clamp; 2.90A {Homo sapiens} SCOP: a.60.7.1 c.120.1.2 Length = 379 Back     alignment and structure
>1ul1_X Flap endonuclease-1; protein complex, DNA-binding protein, flap DNA, flap endonuclease, sliding clamp, DNA clamp; 2.90A {Homo sapiens} SCOP: a.60.7.1 c.120.1.2 Length = 379 Back     alignment and structure
>1ul1_X Flap endonuclease-1; protein complex, DNA-binding protein, flap DNA, flap endonuclease, sliding clamp, DNA clamp; 2.90A {Homo sapiens} SCOP: a.60.7.1 c.120.1.2 Length = 379 Back     alignment and structure
>1b43_A Protein (FEN-1); nuclease, DNA repair, DNA replication, transferase; 2.00A {Pyrococcus furiosus} SCOP: a.60.7.1 c.120.1.2 PDB: 1mc8_A Length = 340 Back     alignment and structure
>1b43_A Protein (FEN-1); nuclease, DNA repair, DNA replication, transferase; 2.00A {Pyrococcus furiosus} SCOP: a.60.7.1 c.120.1.2 PDB: 1mc8_A Length = 340 Back     alignment and structure
>1b43_A Protein (FEN-1); nuclease, DNA repair, DNA replication, transferase; 2.00A {Pyrococcus furiosus} SCOP: a.60.7.1 c.120.1.2 PDB: 1mc8_A Length = 340 Back     alignment and structure
>3ory_A Flap endonuclease 1; hydrolase; 2.00A {Desulfurococcus amylolyticus} Length = 363 Back     alignment and structure
>3ory_A Flap endonuclease 1; hydrolase; 2.00A {Desulfurococcus amylolyticus} Length = 363 Back     alignment and structure
>3ory_A Flap endonuclease 1; hydrolase; 2.00A {Desulfurococcus amylolyticus} Length = 363 Back     alignment and structure
>2izo_A FEN1, flap structure-specific endonuclease; hydrolase, DNA repair, DNA-binding, endonuclease, metal-BIND excision repair, DNA replication, PCNA; HET: DNA; 2.9A {Sulfolobus solfataricus} Length = 346 Back     alignment and structure
>2izo_A FEN1, flap structure-specific endonuclease; hydrolase, DNA repair, DNA-binding, endonuclease, metal-BIND excision repair, DNA replication, PCNA; HET: DNA; 2.9A {Sulfolobus solfataricus} Length = 346 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query443
3qe9_Y352 Exonuclease 1; exonuclease, hydrolase-DNA complex; 100.0
3ory_A363 Flap endonuclease 1; hydrolase; 2.00A {Desulfuroco 100.0
3q8k_A341 Flap endonuclease 1; helix-3 turn-helix, hydrophob 100.0
2izo_A346 FEN1, flap structure-specific endonuclease; hydrol 100.0
1ul1_X379 Flap endonuclease-1; protein complex, DNA-binding 100.0
1b43_A340 Protein (FEN-1); nuclease, DNA repair, DNA replica 100.0
1rxw_A336 Flap structure-specific endonuclease; helical clam 100.0
1a76_A326 Flap endonuclease-1 protein; 5'-3' EXO/endo nuclea 100.0
1exn_A290 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Ent 99.91
1bgx_T 832 TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhi 99.9
3h7i_A305 Ribonuclease H, RNAse H; BPT4 RNAse H, 5'-3' exonu 98.83
3qe9_Y352 Exonuclease 1; exonuclease, hydrolase-DNA complex; 98.37
1a76_A326 Flap endonuclease-1 protein; 5'-3' EXO/endo nuclea 97.84
1rxw_A336 Flap structure-specific endonuclease; helical clam 97.79
2izo_A346 FEN1, flap structure-specific endonuclease; hydrol 97.77
3q8k_A341 Flap endonuclease 1; helix-3 turn-helix, hydrophob 97.73
1b43_A340 Protein (FEN-1); nuclease, DNA repair, DNA replica 97.65
1ul1_X379 Flap endonuclease-1; protein complex, DNA-binding 97.58
2y35_A 1140 LD22664P; hydrolase-DNA complex, RNA degradation, 97.56
3ory_A363 Flap endonuclease 1; hydrolase; 2.00A {Desulfuroco 97.43
3pie_A 1155 5'->3' exoribonuclease (XRN1); beta berrel, tudor 97.42
1exn_A290 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Ent 96.97
3fqd_A 899 Protein DHP1, 5'-3' exoribonuclease 2; protein-pro 96.88
1bgx_T 832 TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhi 95.55
2a1j_A63 DNA repair endonuclease XPF; XPF, xeroderma pigmen 92.73
1z00_B84 DNA repair endonuclease XPF; helix-hairpin-helix, 90.76
1x2i_A75 HEF helicase/nuclease; alpha helix, helix-hairpin- 87.55
1kft_A78 UVRC, excinuclease ABC subunit C; helix-hairpin-he 87.4
1z00_A89 DNA excision repair protein ERCC-1; helix-hairpin- 86.97
2a1j_B91 DNA excision repair protein ERCC-1; XPF, xeroderma 85.3
>3qe9_Y Exonuclease 1; exonuclease, hydrolase-DNA complex; HET: DNA; 2.51A {Homo sapiens} PDB: 3qeb_Z* 3qea_Z* Back     alignment and structure
Probab=100.00  E-value=1.2e-46  Score=382.89  Aligned_cols=245  Identities=34%  Similarity=0.543  Sum_probs=205.5

Q ss_pred             chhhhhhHHHHHHHHHHHHHhCCCEEEEEEcCCCCCcchhhHHHHHHHHHHHHHHHHHHHhhcCCcccccccccccceee
Q psy11828         14 KKLLQHLYVNYCMKYINMLLAHKIKVIMVFDGRHLPAKEATEEDRRKRAEIRHKQKAAELLHSGSSIIYKLDLSGNCCFM   93 (443)
Q Consensus        14 ~~~~~~~~l~~~~~~i~~L~~~gI~PvfVFDG~~pp~K~~t~~~R~~~R~~~~~~~a~~~~~~g~~~~fKld~~~~~~~~   93 (443)
                      .|..|..++.++++++++|+++||+|||||||.+||.|..|+.+|+++|++ +.+++++++++|+.+.      +..++.
T Consensus        48 ~G~~t~~l~~~~~r~l~~L~~~gI~PvfVFDG~~~p~Kk~~~~~Rr~~r~~-~~~~~~~~~~~g~~~~------a~~~f~  120 (352)
T 3qe9_Y           48 KGEPTDRYVGFCMKFVNMLLSHGIKPILVFDGCTLPSKKEVERSRRERRQA-NLLKGKQLLREGKVSE------ARECFT  120 (352)
T ss_dssp             TTCCCCHHHHHHHHHHHHHHHTTCEEEEEECCSCCTTTHHHHHHHHHHHHH-HHHHHHHHTTSSCCHH------HHHHHG
T ss_pred             CCCCcHHHHHHHHHHHHHHHHcCCEEEEEECCCCcHHHHHHHHHHHHHHHH-HHHHHHHHHHhCCHHH------HHHHHh
Confidence            344455677788888889999999999999999999999999999999999 8899999999998765      777788


Q ss_pred             eccCCChhhcccccccchHHHHHHHHhcCCCCCCCccccchhhHHHHHhhccCccHHHHHHHhhhhccccceEEeccchh
Q psy11828         94 DREKLPSALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENALRKINVYGKIGSYVKITKEFL  173 (443)
Q Consensus        94 ~~~~v~~~~~~~~~~~t~~~f~~~ciL~GCdYl~~i~g~G~k~A~~~V~~i~~~d~~~ll~~L~~~~k~~~~v~~~~~f~  173 (443)
                      ++.++++.+...++        .++...|                                           |||     
T Consensus       121 ~~~~vt~~~~~~i~--------~~L~~~g-------------------------------------------Ip~-----  144 (352)
T 3qe9_Y          121 RSINITHAMAHKVI--------KAARSQG-------------------------------------------VDC-----  144 (352)
T ss_dssp             GGCCCCHHHHHHHH--------HHHHHTT-------------------------------------------CEE-----
T ss_pred             hcCCCCHHHHHHHH--------HHHHHcC-------------------------------------------CcE-----
Confidence            88888887654333        3355555                                           999     


Q ss_pred             cCCccCCCccccchhhhHHHhHhhhhCCCeEEEecCCCceeeeccCEEEEecCCCCCeEEeccccccccccCCCCC--CC
Q psy11828        174 TSGAPQPFGARNEGRSLLSAVTERNIAGYADYVITEDSDLLVFGAKKIIYKLDLSGNCCFMDREKLPSALKMPLAK--FT  251 (443)
Q Consensus       174 ~~~i~AP~EAdaEgEAQ~A~L~~~~~~g~vd~ViTeDsD~L~fG~~~vi~~l~~~g~~~~i~~~~l~~~~~l~~~~--lt  251 (443)
                         ++|||||||    |||+|++.   |.+|+|+|+|+|+|+||+++|+++++..++..+++.+.+..   ++.+|  ++
T Consensus       145 ---i~ap~EADa----qiA~La~~---g~~~~I~S~D~Dll~~~~~~v~~~~~~~~~~~~~~~~~~~~---~~~~g~~l~  211 (352)
T 3qe9_Y          145 ---LVAPYEADA----QLAYLNKA---GIVQAIITEDSALLAFGCKKVILKMDQFGNGLEIDQARLGM---CRQLGDVFT  211 (352)
T ss_dssp             ---EECSSCHHH----HHHHHHHT---TSCSEEECSCGGGGGGTCSEEEESCCTTSEEEEEEGGGGTT---CCTTCSSCC
T ss_pred             ---EECCcchHH----HHHHHHHC---CCeEEEEeCCcCcccccCCeEEEeccCCCCcEEEeHHHHHH---HHHhCCCCC
Confidence               999999999    99999887   99999999999999999999999998877766788776521   12356  99


Q ss_pred             HHHHHHHHHHhCCCCCCCCCCCcHHHHHHHHHHcCCCChhhHHHhhhhccccccccccCCCCChhHH------HhhhcCC
Q psy11828        252 DAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENRKEYVKYAKVFPLTAILDMKVPAKWY------RRIIGSI  325 (443)
Q Consensus       252 ~eqfidl~iL~G~DY~~gipGiG~ktA~~li~~~~~~sle~~~~~~~~~~~~~~~~~~~~~~P~~~~------r~l~~~p  325 (443)
                      ++||+|+|+|+||||+|||||||+|||++||++|++.+|++++++++...      ..++.+|++|.      +.+|+|+
T Consensus       212 ~~q~id~~~L~G~D~~pgv~GiG~ktA~kli~~~~~~~l~~il~~~~~~l------~~~~~vp~~~~~~~~~A~~~F~~q  285 (352)
T 3qe9_Y          212 EEKFRYMCILSGCDYLSSLRGIGLAKACKVLRLANNPDIVKVIKKIGHYL------KMNITVPEDYINGFIRANNTFLYQ  285 (352)
T ss_dssp             HHHHHHHHHHHCCSSSCCCTTCCHHHHHHHHHHCCCSCHHHHHTTHHHHH------TCCCCCCHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHhcCCCCCCCCCCeeHHHHHHHHHHhCCCCHHHHHHHHHhhh------ccCCCCCHHHHHHHHHHHHHhCCC
Confidence            99999999999999999999999999999999997558999999987321      12568999997      8889999


Q ss_pred             cccccccccccCCCC
Q psy11828        326 EVICGFSMATIPFNM  340 (443)
Q Consensus       326 ~v~~~~~~~~vp~~~  340 (443)
                      .|-+......++.++
T Consensus       286 ~V~dp~~~~~~~l~~  300 (352)
T 3qe9_Y          286 LVFDPIKRKLIPLNA  300 (352)
T ss_dssp             EEEETTTTEEEESSC
T ss_pred             EEECCCCCeEeeCCC
Confidence            997766666665554
>3ory_A Flap endonuclease 1; hydrolase; 2.00A {Desulfurococcus amylolyticus} Back     alignment and structure
>3q8k_A Flap endonuclease 1; helix-3 turn-helix, hydrophobic wedge, 3' flap binding site, hydrolase-DNA complex, DNA repair, replication; HET: DNA; 2.20A {Homo sapiens} PDB: 3q8l_A* 3q8m_A* Back     alignment and structure
>2izo_A FEN1, flap structure-specific endonuclease; hydrolase, DNA repair, DNA-binding, endonuclease, metal-BIND excision repair, DNA replication, PCNA; HET: DNA; 2.9A {Sulfolobus solfataricus} Back     alignment and structure
>1ul1_X Flap endonuclease-1; protein complex, DNA-binding protein, flap DNA, flap endonuclease, sliding clamp, DNA clamp; 2.90A {Homo sapiens} SCOP: a.60.7.1 c.120.1.2 Back     alignment and structure
>1b43_A Protein (FEN-1); nuclease, DNA repair, DNA replication, transferase; 2.00A {Pyrococcus furiosus} SCOP: a.60.7.1 c.120.1.2 PDB: 1mc8_A Back     alignment and structure
>1rxw_A Flap structure-specific endonuclease; helical clamp, helix-3 turn-helix, hydrophobic wedge, 3' FLA site, hydrolase-DNA complex; 2.00A {Archaeoglobus fulgidus} SCOP: a.60.7.1 c.120.1.2 PDB: 1rxv_A Back     alignment and structure
>1a76_A Flap endonuclease-1 protein; 5'-3' EXO/endo nuclease, DNA replication, RTH, RAD27, DNA repair; 2.00A {Methanocaldococcus jannaschii} SCOP: a.60.7.1 c.120.1.2 PDB: 1a77_A Back     alignment and structure
>1exn_A 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Enterobacteria phage T5} SCOP: a.60.7.1 c.120.1.2 PDB: 1ut5_A 1ut8_A 1xo1_A Back     alignment and structure
>1bgx_T TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhibition, helix-coil dynamics, inhibitor design, complex (polymerase/inhibitor); 2.30A {Thermus aquaticus} SCOP: a.60.7.1 c.120.1.2 c.55.3.5 e.8.1.1 PDB: 1cmw_A 1tau_A* 1taq_A* Back     alignment and structure
>3h7i_A Ribonuclease H, RNAse H; BPT4 RNAse H, 5'-3' exonuclease, hydrolase, endonuclease; 1.50A {Enterobacteria phage T4} PDB: 2ihn_A 3h8w_A 3h8j_A 1tfr_A 3h8s_A Back     alignment and structure
>3qe9_Y Exonuclease 1; exonuclease, hydrolase-DNA complex; HET: DNA; 2.51A {Homo sapiens} PDB: 3qeb_Z* 3qea_Z* Back     alignment and structure
>1a76_A Flap endonuclease-1 protein; 5'-3' EXO/endo nuclease, DNA replication, RTH, RAD27, DNA repair; 2.00A {Methanocaldococcus jannaschii} SCOP: a.60.7.1 c.120.1.2 PDB: 1a77_A Back     alignment and structure
>1rxw_A Flap structure-specific endonuclease; helical clamp, helix-3 turn-helix, hydrophobic wedge, 3' FLA site, hydrolase-DNA complex; 2.00A {Archaeoglobus fulgidus} SCOP: a.60.7.1 c.120.1.2 PDB: 1rxv_A Back     alignment and structure
>2izo_A FEN1, flap structure-specific endonuclease; hydrolase, DNA repair, DNA-binding, endonuclease, metal-BIND excision repair, DNA replication, PCNA; HET: DNA; 2.9A {Sulfolobus solfataricus} Back     alignment and structure
>3q8k_A Flap endonuclease 1; helix-3 turn-helix, hydrophobic wedge, 3' flap binding site, hydrolase-DNA complex, DNA repair, replication; HET: DNA; 2.20A {Homo sapiens} PDB: 3q8l_A* 3q8m_A* Back     alignment and structure
>1b43_A Protein (FEN-1); nuclease, DNA repair, DNA replication, transferase; 2.00A {Pyrococcus furiosus} SCOP: a.60.7.1 c.120.1.2 PDB: 1mc8_A Back     alignment and structure
>1ul1_X Flap endonuclease-1; protein complex, DNA-binding protein, flap DNA, flap endonuclease, sliding clamp, DNA clamp; 2.90A {Homo sapiens} SCOP: a.60.7.1 c.120.1.2 Back     alignment and structure
>2y35_A LD22664P; hydrolase-DNA complex, RNA degradation, exonuclease 5'-3', R interference; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3ory_A Flap endonuclease 1; hydrolase; 2.00A {Desulfurococcus amylolyticus} Back     alignment and structure
>3pie_A 5'->3' exoribonuclease (XRN1); beta berrel, tudor domain, chromo domain, mRNA turnover, RRN processing, RNA binding, DNA binding; 2.90A {Kluyveromyces lactis} PDB: 3pif_A Back     alignment and structure
>1exn_A 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Enterobacteria phage T5} SCOP: a.60.7.1 c.120.1.2 PDB: 1ut5_A 1ut8_A 1xo1_A Back     alignment and structure
>3fqd_A Protein DHP1, 5'-3' exoribonuclease 2; protein-protein complex, exonuclease, hydrolase, mRNA proces nuclease, nucleus, rRNA processing, transcription; 2.20A {Schizosaccharomyces pombe} Back     alignment and structure
>1bgx_T TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhibition, helix-coil dynamics, inhibitor design, complex (polymerase/inhibitor); 2.30A {Thermus aquaticus} SCOP: a.60.7.1 c.120.1.2 c.55.3.5 e.8.1.1 PDB: 1cmw_A 1tau_A* 1taq_A* Back     alignment and structure
>2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A* Back     alignment and structure
>1z00_B DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 PDB: 2aq0_A* Back     alignment and structure
>1x2i_A HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} SCOP: a.60.2.5 Back     alignment and structure
>1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3 Back     alignment and structure
>1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 Back     alignment and structure
>2a1j_B DNA excision repair protein ERCC-1; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 443
d1a77a2207 c.120.1.2 (A:2-208) Flap endonuclease-1 (Fen-1 nuc 6e-07
d1a77a2207 c.120.1.2 (A:2-208) Flap endonuclease-1 (Fen-1 nuc 0.001
d1b43a2219 c.120.1.2 (A:1-219) Flap endonuclease-1 (Fen-1 nuc 9e-07
d1rxwa2217 c.120.1.2 (A:3-219) Flap endonuclease-1 (Fen-1 nuc 2e-06
d1rxwa2217 c.120.1.2 (A:3-219) Flap endonuclease-1 (Fen-1 nuc 2e-04
d1ul1x2216 c.120.1.2 (X:2-217) Flap endonuclease-1 (Fen-1 nuc 5e-06
d1ul1x1140 a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nu 2e-04
d1ul1x1140 a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nu 3e-04
d1rxwa1105 a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nu 0.001
>d1a77a2 c.120.1.2 (A:2-208) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 207 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PIN domain-like
superfamily: PIN domain-like
family: 5' to 3' exonuclease catalytic domain
domain: Flap endonuclease-1 (Fen-1 nuclease)
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

 Score = 47.8 bits (113), Expect = 6e-07
 Identities = 9/48 (18%), Positives = 23/48 (47%), Gaps = 1/48 (2%)

Query: 198 NIAGYADYVITEDSDLLVFGAKKIIYKLDLSGNCC-FMDREKLPSALK 244
              G    V+++D D L++GA +++  L  +      ++  ++   L+
Sbjct: 160 AKKGDVWAVVSQDYDALLYGAPRVVRNLTTTKEMPELIELNEVLEDLR 207
>d1a77a2 c.120.1.2 (A:2-208) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 207 Back     information, alignment and structure
>d1b43a2 c.120.1.2 (A:1-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 219 Back     information, alignment and structure
>d1rxwa2 c.120.1.2 (A:3-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 217 Back     information, alignment and structure
>d1rxwa2 c.120.1.2 (A:3-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 217 Back     information, alignment and structure
>d1ul1x2 c.120.1.2 (X:2-217) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} Length = 216 Back     information, alignment and structure
>d1ul1x1 a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1ul1x1 a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1rxwa1 a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 105 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query443
d1rxwa2217 Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Arc 99.97
d1b43a2219 Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyr 99.96
d1a77a2207 Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Met 99.96
d1ul1x2216 Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo 99.95
d1rxwa1105 Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Arc 99.74
d1b43a1120 Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyr 99.74
d1a77a1108 Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Met 99.71
d1ul1x1140 Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo 99.69
d1cmwa1116 5' to 3' exonuclease domain of DNA polymerase Taq 99.07
d1xo1a1105 T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726] 99.07
d1ul1x1140 Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo 98.5
d1rxwa1105 Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Arc 98.49
d1a77a1108 Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Met 98.2
d1b43a1120 Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyr 98.19
d1xo1a1105 T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726] 96.92
d1tfra2169 T4 RNase H {Bacteriophage T4 [TaxId: 10665]} 94.9
d1cmwa1116 5' to 3' exonuclease domain of DNA polymerase Taq 94.89
d1cmwa2164 5' to 3' exonuclease domain of DNA polymerase Taq 94.54
d1kfta_56 Excinuclease UvrC C-terminal domain {Escherichia c 93.61
d2a1ja162 DNA repair endonuclease XPF {Human (Homo sapiens) 93.52
d1x2ia168 ATP-dependent RNA helicase PF2015 {Pyrococcus furi 93.47
d2bgwa170 DNA repair endonuclease XPF {Aeropyrum pernix [Tax 92.7
d1xo1a2167 T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726] 90.54
d1bvsa271 DNA helicase RuvA subunit, middle domain {Mycobact 89.47
d2bcqa257 DNA polymerase lambda {Human (Homo sapiens) [TaxId 89.16
d1ixra173 DNA helicase RuvA subunit, middle domain {Thermus 89.12
d1jmsa360 Terminal deoxynucleotidyl transferase {Mouse (Mus 88.52
d2a1jb178 DNA excision repair protein ERCC-1 {Human (Homo sa 88.06
d2fmpa257 DNA polymerase beta {Human (Homo sapiens) [TaxId: 87.62
d1cuka278 DNA helicase RuvA subunit, middle domain {Escheric 87.08
d2i1qa160 DNA repair protein Rad51, N-terminal domain {Archa 87.01
d1pzna161 DNA repair protein Rad51, N-terminal domain {Archa 85.3
d1ixra173 DNA helicase RuvA subunit, middle domain {Thermus 82.56
d1cuka278 DNA helicase RuvA subunit, middle domain {Escheric 81.04
>d1rxwa2 c.120.1.2 (A:3-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PIN domain-like
superfamily: PIN domain-like
family: 5' to 3' exonuclease catalytic domain
domain: Flap endonuclease-1 (Fen-1 nuclease)
species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]

Probab=99.97  E-value=8e-32  Score=254.16  Aligned_cols=141  Identities=17%  Similarity=0.246  Sum_probs=114.9

Q ss_pred             hhhhHHHHHHHHHHHHHhCCCEEEEEEcCCCCCcchhhHHHHHHHHHHHHHHHHHHHhhcCCcccccccccccceeeecc
Q psy11828         17 LQHLYVNYCMKYINMLLAHKIKVIMVFDGRHLPAKEATEEDRRKRAEIRHKQKAAELLHSGSSIIYKLDLSGNCCFMDRE   96 (443)
Q Consensus        17 ~~~~~l~~~~~~i~~L~~~gI~PvfVFDG~~pp~K~~t~~~R~~~R~~~~~~~a~~~~~~g~~~~fKld~~~~~~~~~~~   96 (443)
                      .+++|+.+++.++..|+++||+|||||||.+||.|..|.++|+++|++ +.+++.++..+++.+       ...+..+..
T Consensus        51 ~~~~~l~~~~~ri~~l~~~~I~pifVFDG~~p~~K~~~~~~R~~~r~~-~~~~~~~~~~~~~~~-------~~~~~~~~~  122 (217)
T d1rxwa2          51 RITSHLSGILYRVSNMVEVGIRPVFVFDGEPPEFKKAEIEERKKRRAE-AEEMWIAALQAGDKD-------AKKYAQAAG  122 (217)
T ss_dssp             CBCHHHHHHHHHHHHHHHHTCEEEEEECCSCCGGGHHHHHHHHHHHHH-HHHHHHHHHHHTCTT-------HHHHHHHHC
T ss_pred             CccHHHHHHHHHHHHHHHcCCeEEEEECCCCCcchhhHHHHHHHHHHh-hhhhhhhhhhhhhHH-------HHHHHHhhc
Confidence            456899999999999999999999999999999999999999999999 777777777776653       233444556


Q ss_pred             CCChhhcccccccchHHHHHHHHhcCCCCCCCccccchhhHHHHHhhccCccHHHHHHHhhhhccccceEEeccchhcCC
Q psy11828         97 KLPSALKMPLAKFTDAKFRYMCILSGCDYWTGIKGMGLKKAKDYVFSIMDPDFENALRKINVYGKIGSYVKITKEFLTSG  176 (443)
Q Consensus        97 ~v~~~~~~~~~~~t~~~f~~~ciL~GCdYl~~i~g~G~k~A~~~V~~i~~~d~~~ll~~L~~~~k~~~~v~~~~~f~~~~  176 (443)
                      .+++++..        .+..++...|                                           |||        
T Consensus       123 ~vt~~~~~--------~~~~lL~~~g-------------------------------------------i~~--------  143 (217)
T d1rxwa2         123 RVDEYIVD--------SAKTLLSYMG-------------------------------------------IPF--------  143 (217)
T ss_dssp             CCCHHHHH--------HHHHHHHHTT-------------------------------------------CCE--------
T ss_pred             cCCHHHHH--------HHHHHHHHcC-------------------------------------------ceE--------
Confidence            66665543        2233355555                                           999        


Q ss_pred             ccCCCccccchhhhHHHhHhhhhCCCeEEEecCCCceeeeccCEEEEecCCCCCe
Q psy11828        177 APQPFGARNEGRSLLSAVTERNIAGYADYVITEDSDLLVFGAKKIIYKLDLSGNC  231 (443)
Q Consensus       177 i~AP~EAdaEgEAQ~A~L~~~~~~g~vd~ViTeDsD~L~fG~~~vi~~l~~~g~~  231 (443)
                      ++|||||||    |||+|++.   |.||+|+|+|||+|+|||++|||+++.+++.
T Consensus       144 i~Ap~EAea----qcA~L~~~---g~vd~v~seDsD~l~fG~~~vir~l~~~~~~  191 (217)
T d1rxwa2         144 VDAPSEGEA----QAAYMAAK---GDVEYTGSQDYDSLLFGSPRLARNLAITGKR  191 (217)
T ss_dssp             EECSSCHHH----HHHHHHHT---TSSSEEECSSSHHHHTTCSEEEESCCC----
T ss_pred             EecCchHHH----HHHHHHhC---CCeEEEEecccceeeeCCCEEEEecccccCc
Confidence            999999999    99999888   9999999999999999999999999986654
>d1b43a2 c.120.1.2 (A:1-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a77a2 c.120.1.2 (A:2-208) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ul1x2 c.120.1.2 (X:2-217) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rxwa1 a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1b43a1 a.60.7.1 (A:220-339) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a77a1 a.60.7.1 (A:209-316) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ul1x1 a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cmwa1 a.60.7.1 (A:174-289) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xo1a1 a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} Back     information, alignment and structure
>d1ul1x1 a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rxwa1 a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a77a1 a.60.7.1 (A:209-316) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b43a1 a.60.7.1 (A:220-339) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xo1a1 a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} Back     information, alignment and structure
>d1tfra2 c.120.1.2 (A:12-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1cmwa1 a.60.7.1 (A:174-289) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1cmwa2 c.120.1.2 (A:10-173) 5' to 3' exonuclease domain of DNA polymerase Taq {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xo1a2 c.120.1.2 (A:19-185) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} Back     information, alignment and structure
>d1bvsa2 a.60.2.1 (A:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae [TaxId: 1769]} Back     information, alignment and structure
>d2bcqa2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixra1 a.60.2.1 (A:63-135) DNA helicase RuvA subunit, middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jmsa3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a1jb1 a.60.2.5 (B:219-296) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fmpa2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ixra1 a.60.2.1 (A:63-135) DNA helicase RuvA subunit, middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure