Psyllid ID: psy11843
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 325 | ||||||
| 52630953 | 254 | putative phosphoglycerate mutase [Toxopt | 0.443 | 0.566 | 0.640 | 1e-47 | |
| 187111150 | 254 | phosphoglycerate mutase [Acyrthosiphon p | 0.443 | 0.566 | 0.633 | 2e-47 | |
| 383848034 | 319 | PREDICTED: phosphoglycerate mutase 1-lik | 0.418 | 0.426 | 0.671 | 3e-47 | |
| 345497959 | 254 | PREDICTED: phosphoglycerate mutase 2-lik | 0.418 | 0.535 | 0.657 | 3e-46 | |
| 307174061 | 254 | Phosphoglycerate mutase 1 [Camponotus fl | 0.418 | 0.535 | 0.664 | 5e-46 | |
| 332018491 | 254 | Phosphoglycerate mutase 1 [Acromyrmex ec | 0.418 | 0.535 | 0.650 | 6e-46 | |
| 307203820 | 254 | Phosphoglycerate mutase 1 [Harpegnathos | 0.415 | 0.531 | 0.669 | 6e-46 | |
| 451172030 | 141 | phosphoglycerate mutase, partial [Curcul | 0.393 | 0.907 | 0.703 | 1e-45 | |
| 322798069 | 284 | hypothetical protein SINV_04277 [Solenop | 0.418 | 0.478 | 0.657 | 1e-45 | |
| 451171976 | 141 | phosphoglycerate mutase, partial [Curcul | 0.393 | 0.907 | 0.688 | 2e-45 |
| >gi|52630953|gb|AAU84940.1| putative phosphoglycerate mutase [Toxoptera citricida] | Back alignment and taxonomy information |
|---|
Score = 196 bits (498), Expect = 1e-47, Method: Compositional matrix adjust.
Identities = 98/153 (64%), Positives = 117/153 (76%), Gaps = 9/153 (5%)
Query: 166 YPSSLNSVNEAEAA--GVALAKAGFKFDVAHTSVLTRAQNTLKAILKGIGQEDLPVHKSW 223
Y +SL+ E EAA G AL + +KFD+AHTSVL RAQNTL AILK +GQED+P+ K+W
Sbjct: 26 YDASLSPKGEEEAANAGKALKQGNYKFDLAHTSVLKRAQNTLGAILKELGQEDIPISKTW 85
Query: 224 RLNERHYGGLTGLDKAATAAKYGEEQ-RVHRDTIGL------EDHAYYSNIVDDPRYASE 276
RLNERHYGGLTGL+K+ TAAKYGEEQ ++ R + DHAYY IV+DPRY E
Sbjct: 86 RLNERHYGGLTGLNKSETAAKYGEEQVQIWRRSFDTPPPSMDTDHAYYDQIVNDPRYKDE 145
Query: 277 PSKEEFPMFESLKLTIERTLPYWNNVIVPQYSD 309
P KEEFPMFESLKLTI+RTLPYWN+VI+PQ +
Sbjct: 146 PLKEEFPMFESLKLTIQRTLPYWNDVIIPQLKE 178
|
Source: Toxoptera citricida Species: Toxoptera citricida Genus: Toxoptera Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|187111150|ref|NP_001119676.1| phosphoglycerate mutase [Acyrthosiphon pisum] gi|89473778|gb|ABD72701.1| putative phosphoglycerate mutase [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|383848034|ref|XP_003699657.1| PREDICTED: phosphoglycerate mutase 1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|345497959|ref|XP_001602648.2| PREDICTED: phosphoglycerate mutase 2-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|307174061|gb|EFN64748.1| Phosphoglycerate mutase 1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|332018491|gb|EGI59081.1| Phosphoglycerate mutase 1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307203820|gb|EFN82756.1| Phosphoglycerate mutase 1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|451172030|dbj|BAM83995.1| phosphoglycerate mutase, partial [Curculio sikkimensis] | Back alignment and taxonomy information |
|---|
| >gi|322798069|gb|EFZ19908.1| hypothetical protein SINV_04277 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|451171976|dbj|BAM83968.1| phosphoglycerate mutase, partial [Curculio hachijoensis] gi|451172000|dbj|BAM83980.1| phosphoglycerate mutase, partial [Curculio cerasorum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 325 | ||||||
| FB|FBgn0014869 | 255 | Pglym78 "Phosphoglyceromutase" | 0.366 | 0.466 | 0.666 | 2e-53 | |
| FB|FBgn0011270 | 309 | Pglym87 "Pglym87" [Drosophila | 0.366 | 0.385 | 0.634 | 6e-50 | |
| UNIPROTKB|P15259 | 253 | PGAM2 "Phosphoglycerate mutase | 0.350 | 0.450 | 0.548 | 1.5e-39 | |
| UNIPROTKB|B5KJG2 | 253 | PGAM2 "Phosphoglycerate mutase | 0.350 | 0.450 | 0.540 | 4e-39 | |
| ZFIN|ZDB-GENE-030131-1827 | 254 | pgam1a "phosphoglycerate mutas | 0.363 | 0.464 | 0.515 | 5.1e-39 | |
| UNIPROTKB|H9GW55 | 253 | PGAM2 "Uncharacterized protein | 0.350 | 0.450 | 0.532 | 2.8e-38 | |
| UNIPROTKB|F1N2F2 | 253 | PGAM2 "Phosphoglycerate mutase | 0.353 | 0.454 | 0.528 | 3.5e-38 | |
| UNIPROTKB|Q32KV0 | 253 | PGAM2 "Phosphoglycerate mutase | 0.353 | 0.454 | 0.528 | 3.5e-38 | |
| ZFIN|ZDB-GENE-030131-5376 | 254 | pgam1b "phosphoglycerate mutas | 0.363 | 0.464 | 0.492 | 1.2e-37 | |
| ZFIN|ZDB-GENE-040116-6 | 255 | pgam2 "phosphoglycerate mutase | 0.350 | 0.447 | 0.524 | 1.2e-37 |
| FB|FBgn0014869 Pglym78 "Phosphoglyceromutase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 412 (150.1 bits), Expect = 2.0e-53, Sum P(2) = 2.0e-53
Identities = 84/126 (66%), Positives = 97/126 (76%)
Query: 191 DVAHTSVLTRAQNTLKAILKGIGQEDLPVHKSWRLNERHYGGLTGLDKAATAAKYGEEQ- 249
DVAHTSVLTRAQ TL +ILK G +++P+ K+WRLNERHYGGLTGL+KA TAAKYGE Q
Sbjct: 54 DVAHTSVLTRAQVTLASILKASGHKEIPIQKTWRLNERHYGGLTGLNKAETAAKYGEAQV 113
Query: 250 RVHR---DTIG--LED-HAYYSNIVDDPRYASEPSKEEFPMFESLKLTIERTLPYWNNVI 303
++ R DT +E H YY NIV DPRYA P EEFP FESLKLTIERTLPYWN+VI
Sbjct: 114 QIWRRSFDTPPPPMEPGHPYYENIVKDPRYAEGPKPEEFPQFESLKLTIERTLPYWNDVI 173
Query: 304 VPQYSD 309
+PQ +
Sbjct: 174 IPQMKE 179
|
|
| FB|FBgn0011270 Pglym87 "Pglym87" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P15259 PGAM2 "Phosphoglycerate mutase 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B5KJG2 PGAM2 "Phosphoglycerate mutase 2" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-1827 pgam1a "phosphoglycerate mutase 1a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H9GW55 PGAM2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N2F2 PGAM2 "Phosphoglycerate mutase 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q32KV0 PGAM2 "Phosphoglycerate mutase 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-5376 pgam1b "phosphoglycerate mutase 1b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040116-6 pgam2 "phosphoglycerate mutase 2 (muscle)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 325 | |||
| PRK14115 | 247 | PRK14115, gpmA, phosphoglyceromutase; Provisional | 2e-53 | |
| TIGR01258 | 245 | TIGR01258, pgm_1, phosphoglycerate mutase, BPG-dep | 2e-47 | |
| COG0588 | 230 | COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohyd | 9e-45 | |
| PTZ00123 | 236 | PTZ00123, PTZ00123, phosphoglycerate mutase like-p | 1e-44 | |
| PRK14120 | 249 | PRK14120, gpmA, phosphoglyceromutase; Provisional | 2e-33 | |
| PRK14118 | 227 | PRK14118, gpmA, phosphoglyceromutase; Provisional | 2e-32 | |
| PRK14116 | 228 | PRK14116, gpmA, phosphoglyceromutase; Provisional | 6e-31 | |
| PRK14117 | 230 | PRK14117, gpmA, phosphoglyceromutase; Provisional | 3e-29 | |
| PRK14119 | 228 | PRK14119, gpmA, phosphoglyceromutase; Provisional | 3e-29 | |
| PRK01295 | 206 | PRK01295, PRK01295, phosphoglyceromutase; Provisio | 3e-29 | |
| pfam10242 | 181 | pfam10242, L_HGMIC_fpl, Lipoma HMGIC fusion partne | 1e-25 | |
| smart00855 | 158 | smart00855, PGAM, Phosphoglycerate mutase family | 2e-15 | |
| PRK01112 | 228 | PRK01112, PRK01112, phosphoglyceromutase; Provisio | 4e-14 | |
| pfam00300 | 154 | pfam00300, His_Phos_1, Histidine phosphatase super | 4e-13 | |
| cd07067 | 153 | cd07067, HP_PGM_like, Histidine phosphatase domain | 6e-12 | |
| TIGR01258 | 245 | TIGR01258, pgm_1, phosphoglycerate mutase, BPG-dep | 4e-11 | |
| COG0588 | 230 | COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohyd | 8e-11 | |
| PRK14120 | 249 | PRK14120, gpmA, phosphoglyceromutase; Provisional | 2e-09 | |
| cd07040 | 153 | cd07040, HP, Histidine phosphatase domain found in | 5e-09 | |
| PRK14115 | 247 | PRK14115, gpmA, phosphoglyceromutase; Provisional | 6e-09 | |
| PRK01295 | 206 | PRK01295, PRK01295, phosphoglyceromutase; Provisio | 2e-08 | |
| cd07067 | 153 | cd07067, HP_PGM_like, Histidine phosphatase domain | 4e-08 | |
| cd07040 | 153 | cd07040, HP, Histidine phosphatase domain found in | 4e-08 | |
| PRK01112 | 228 | PRK01112, PRK01112, phosphoglyceromutase; Provisio | 6e-08 | |
| PRK15004 | 199 | PRK15004, PRK15004, alpha-ribazole phosphatase; Pr | 1e-07 | |
| smart00855 | 158 | smart00855, PGAM, Phosphoglycerate mutase family | 2e-07 | |
| PRK14116 | 228 | PRK14116, gpmA, phosphoglyceromutase; Provisional | 5e-07 | |
| COG0406 | 208 | COG0406, phoE, Broad specificity phosphatase PhoE | 5e-07 | |
| PRK14118 | 227 | PRK14118, gpmA, phosphoglyceromutase; Provisional | 1e-06 | |
| PRK14117 | 230 | PRK14117, gpmA, phosphoglyceromutase; Provisional | 1e-06 | |
| PRK14119 | 228 | PRK14119, gpmA, phosphoglyceromutase; Provisional | 1e-06 | |
| pfam00300 | 154 | pfam00300, His_Phos_1, Histidine phosphatase super | 7e-05 | |
| COG0406 | 208 | COG0406, phoE, Broad specificity phosphatase PhoE | 9e-05 | |
| TIGR03162 | 177 | TIGR03162, ribazole_cobC, alpha-ribazole phosphata | 2e-04 |
| >gnl|CDD|184516 PRK14115, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
Score = 175 bits (446), Expect = 2e-53
Identities = 78/143 (54%), Positives = 92/143 (64%), Gaps = 14/143 (9%)
Query: 173 VNEAEAAGVALAKAGFKFDVAHTSVLTRAQNTLKAILKGIGQEDLPVHKSWRLNERHYGG 232
V+EA+AAG L + G+ FDVA+TSVL RA TL +L + Q LPV KSWRLNERHYG
Sbjct: 32 VSEAKAAGKLLKEEGYTFDVAYTSVLKRAIRTLWIVLDELDQMWLPVEKSWRLNERHYGA 91
Query: 233 LTGLDKAATAAKYGEEQRVH--R---DT----IGLEDHAYYSNIVDDPRYASEPSKEEFP 283
L GL+KA TAAKYG+EQ V R D + +D Y + DPRYA P +EE P
Sbjct: 92 LQGLNKAETAAKYGDEQ-VKIWRRSYDVPPPALEKDDERYPGH---DPRYAKLP-EEELP 146
Query: 284 MFESLKLTIERTLPYWNNVIVPQ 306
+ ESLK TI R LPYWN I PQ
Sbjct: 147 LTESLKDTIARVLPYWNETIAPQ 169
|
Length = 247 |
| >gnl|CDD|213596 TIGR01258, pgm_1, phosphoglycerate mutase, BPG-dependent, family 1 | Back alignment and domain information |
|---|
| >gnl|CDD|223661 COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|240280 PTZ00123, PTZ00123, phosphoglycerate mutase like-protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184519 PRK14120, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172608 PRK14118, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172606 PRK14116, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184517 PRK14117, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184518 PRK14119, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|167205 PRK01295, PRK01295, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220647 pfam10242, L_HGMIC_fpl, Lipoma HMGIC fusion partner-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|214859 smart00855, PGAM, Phosphoglycerate mutase family | Back alignment and domain information |
|---|
| >gnl|CDD|234902 PRK01112, PRK01112, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215845 pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1) | Back alignment and domain information |
|---|
| >gnl|CDD|132718 cd07067, HP_PGM_like, Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >gnl|CDD|213596 TIGR01258, pgm_1, phosphoglycerate mutase, BPG-dependent, family 1 | Back alignment and domain information |
|---|
| >gnl|CDD|223661 COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184519 PRK14120, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132716 cd07040, HP, Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >gnl|CDD|184516 PRK14115, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|167205 PRK01295, PRK01295, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132718 cd07067, HP_PGM_like, Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >gnl|CDD|132716 cd07040, HP, Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >gnl|CDD|234902 PRK01112, PRK01112, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184966 PRK15004, PRK15004, alpha-ribazole phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214859 smart00855, PGAM, Phosphoglycerate mutase family | Back alignment and domain information |
|---|
| >gnl|CDD|172606 PRK14116, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223483 COG0406, phoE, Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|172608 PRK14118, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184517 PRK14117, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184518 PRK14119, gpmA, phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215845 pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1) | Back alignment and domain information |
|---|
| >gnl|CDD|223483 COG0406, phoE, Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234131 TIGR03162, ribazole_cobC, alpha-ribazole phosphatase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 325 | |||
| PRK14119 | 228 | gpmA phosphoglyceromutase; Provisional | 100.0 | |
| PRK14116 | 228 | gpmA phosphoglyceromutase; Provisional | 100.0 | |
| PRK14117 | 230 | gpmA phosphoglyceromutase; Provisional | 100.0 | |
| PRK01295 | 206 | phosphoglyceromutase; Provisional | 100.0 | |
| PRK14118 | 227 | gpmA phosphoglyceromutase; Provisional | 100.0 | |
| COG0588 | 230 | GpmA Phosphoglycerate mutase 1 [Carbohydrate trans | 100.0 | |
| PRK14115 | 247 | gpmA phosphoglyceromutase; Provisional | 100.0 | |
| PRK01112 | 228 | phosphoglyceromutase; Provisional | 100.0 | |
| TIGR01258 | 245 | pgm_1 phosphoglycerate mutase, BPG-dependent, fami | 100.0 | |
| PRK13463 | 203 | phosphatase PhoE; Provisional | 100.0 | |
| PRK14120 | 249 | gpmA phosphoglyceromutase; Provisional | 100.0 | |
| PRK15004 | 199 | alpha-ribazole phosphatase; Provisional | 100.0 | |
| PRK03482 | 215 | phosphoglycerate mutase; Provisional | 100.0 | |
| TIGR03848 | 204 | MSMEG_4193 probable phosphomutase, MSMEG_4193 fami | 100.0 | |
| TIGR03162 | 177 | ribazole_cobC alpha-ribazole phosphatase. Members | 100.0 | |
| COG0406 | 208 | phoE Broad specificity phosphatase PhoE and relate | 100.0 | |
| PRK13462 | 203 | acid phosphatase; Provisional | 100.0 | |
| KOG0235|consensus | 214 | 100.0 | ||
| smart00855 | 155 | PGAM Phosphoglycerate mutase family. Phosphoglycer | 100.0 | |
| PRK07238 | 372 | bifunctional RNase H/acid phosphatase; Provisional | 99.97 | |
| PF00300 | 158 | His_Phos_1: Histidine phosphatase superfamily (bra | 99.97 | |
| PTZ00123 | 236 | phosphoglycerate mutase like-protein; Provisional | 99.97 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.96 | |
| PTZ00122 | 299 | phosphoglycerate mutase; Provisional | 99.89 | |
| cd07067 | 153 | HP_PGM_like Histidine phosphatase domain found in | 99.84 | |
| KOG4026|consensus | 207 | 99.8 | ||
| PRK14116 | 228 | gpmA phosphoglyceromutase; Provisional | 99.78 | |
| PRK14119 | 228 | gpmA phosphoglyceromutase; Provisional | 99.77 | |
| PRK06193 | 206 | hypothetical protein; Provisional | 99.76 | |
| cd07040 | 153 | HP Histidine phosphatase domain found in a functio | 99.75 | |
| PRK14117 | 230 | gpmA phosphoglyceromutase; Provisional | 99.74 | |
| PRK15416 | 201 | lipopolysaccharide core heptose(II)-phosphate phos | 99.72 | |
| PRK14118 | 227 | gpmA phosphoglyceromutase; Provisional | 99.72 | |
| PRK13463 | 203 | phosphatase PhoE; Provisional | 99.71 | |
| PRK14120 | 249 | gpmA phosphoglyceromutase; Provisional | 99.71 | |
| TIGR00249 | 152 | sixA phosphohistidine phosphatase SixA. | 99.7 | |
| KOG3734|consensus | 272 | 99.7 | ||
| KOG4609|consensus | 284 | 99.69 | ||
| PRK01112 | 228 | phosphoglyceromutase; Provisional | 99.68 | |
| KOG4754|consensus | 248 | 99.68 | ||
| COG0406 | 208 | phoE Broad specificity phosphatase PhoE and relate | 99.68 | |
| PRK10848 | 159 | phosphohistidine phosphatase; Provisional | 99.67 | |
| PRK15004 | 199 | alpha-ribazole phosphatase; Provisional | 99.67 | |
| PRK13462 | 203 | acid phosphatase; Provisional | 99.66 | |
| KOG0234|consensus | 438 | 99.66 | ||
| PF10242 | 181 | L_HGMIC_fpl: Lipoma HMGIC fusion partner-like prot | 99.65 | |
| PRK01295 | 206 | phosphoglyceromutase; Provisional | 99.64 | |
| PRK03482 | 215 | phosphoglycerate mutase; Provisional | 99.64 | |
| PRK14115 | 247 | gpmA phosphoglyceromutase; Provisional | 99.64 | |
| TIGR01258 | 245 | pgm_1 phosphoglycerate mutase, BPG-dependent, fami | 99.64 | |
| TIGR03848 | 204 | MSMEG_4193 probable phosphomutase, MSMEG_4193 fami | 99.62 | |
| COG2062 | 163 | SixA Phosphohistidine phosphatase SixA [Signal tra | 99.61 | |
| KOG0235|consensus | 214 | 99.59 | ||
| COG0588 | 230 | GpmA Phosphoglycerate mutase 1 [Carbohydrate trans | 99.53 | |
| PRK07238 | 372 | bifunctional RNase H/acid phosphatase; Provisional | 99.53 | |
| TIGR03162 | 177 | ribazole_cobC alpha-ribazole phosphatase. Members | 99.52 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.48 | |
| smart00855 | 155 | PGAM Phosphoglycerate mutase family. Phosphoglycer | 99.4 | |
| PF00300 | 158 | His_Phos_1: Histidine phosphatase superfamily (bra | 99.29 | |
| PTZ00123 | 236 | phosphoglycerate mutase like-protein; Provisional | 98.97 | |
| cd07067 | 153 | HP_PGM_like Histidine phosphatase domain found in | 98.82 | |
| PTZ00122 | 299 | phosphoglycerate mutase; Provisional | 98.64 | |
| PRK06193 | 206 | hypothetical protein; Provisional | 98.47 | |
| cd07040 | 153 | HP Histidine phosphatase domain found in a functio | 98.47 | |
| PRK10848 | 159 | phosphohistidine phosphatase; Provisional | 98.45 | |
| TIGR00249 | 152 | sixA phosphohistidine phosphatase SixA. | 98.42 | |
| PRK15416 | 201 | lipopolysaccharide core heptose(II)-phosphate phos | 98.23 | |
| COG2062 | 163 | SixA Phosphohistidine phosphatase SixA [Signal tra | 97.9 | |
| cd07061 | 242 | HP_HAP_like Histidine phosphatase domain found in | 97.84 | |
| KOG4754|consensus | 248 | 96.78 | ||
| KOG0234|consensus | 438 | 96.77 | ||
| PF00328 | 347 | His_Phos_2: Histidine phosphatase superfamily (bra | 96.75 | |
| PRK10173 | 413 | glucose-1-phosphatase/inositol phosphatase; Provis | 96.55 | |
| KOG3720|consensus | 411 | 96.53 | ||
| PRK10172 | 436 | phosphoanhydride phosphorylase; Provisional | 96.37 | |
| KOG4609|consensus | 284 | 93.07 | ||
| KOG1057|consensus | 1018 | 90.0 | ||
| KOG3734|consensus | 272 | 89.08 |
| >PRK14119 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.4e-37 Score=279.16 Aligned_cols=184 Identities=35% Similarity=0.507 Sum_probs=143.8
Q ss_pred ccceEEecCCCccccccccccccccCCCCCCCCCCCCCCChhhHHHHHHHHHHHHHcCCCcCEEEecCcHHHHHHHHHHH
Q psy11843 130 LHPVMLMPQGVHEQDRFSEFSNRTANSKSSRYARPEYPSSLNSVNEAEAAGVALAKAGFKFDVAHTSVLTRAQNTLKAIL 209 (325)
Q Consensus 130 ~~~i~lvRHGe~~~~~~t~~n~~~~~~~~~~~g~~d~~Lt~~G~~qa~~~~~~l~~~~~~~~~i~sSpl~Ra~qTA~~i~ 209 (325)
|++|||||||| |.||.. ...+|+.|.|||+.|++||++++++|++.+.+||.|||||++||+|||++|+
T Consensus 1 m~~l~LvRHGe------T~~N~~-----~~~~G~~D~pLt~~G~~QA~~l~~~L~~~~~~~d~i~sSpL~Ra~~TA~~i~ 69 (228)
T PRK14119 1 MPKLILCRHGQ------SEWNAK-----NLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTRALDTTHYIL 69 (228)
T ss_pred CCEEEEEeCCC------CCcccC-----CCccCCCCCCcCHHHHHHHHHHHHHHHhcCCCCCEEEeCccHHHHHHHHHHH
Confidence 45799999998 888763 5568899999999999999999999997667899999999999999999998
Q ss_pred HhcCCCCCCccccccchhhccCCCCCCcHHHHHHhhchhHH-HhhhccCccccc----ccccccCCcccCCCCCCCCCCC
Q psy11843 210 KGIGQEDLPVHKSWRLNERHYGGLTGLDKAATAAKYGEEQR-VHRDTIGLEDHA----YYSNIVDDPRYASEPSKEEFPM 284 (325)
Q Consensus 210 ~~~~~~~~~i~~~~~L~E~~~G~~eG~~~~e~~~~~~~~~~-~w~~~~~~~~~~----~~~~~~~~~~y~~~~~~~~~p~ 284 (325)
+..+...+|+.++++|+|++||.|||++.+++.+++|+... .|.+.++....+ .......++.|.+ +....+|+
T Consensus 70 ~~~~~~~~~~~~~~~LrE~~fG~weG~~~~ei~~~~~~~~~~~w~~~~~~~~p~~~~~~~~~~~~~~~~~~-~~~~~~p~ 148 (228)
T PRK14119 70 TESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVKPPAETEEQREAYLADRRYNH-LDKRMMPY 148 (228)
T ss_pred HhcccCCCCeeECCCccccccccccCCcHHHHHHHccHHHHHHHHcccccCCCcccccccccccccccccc-cccccCCC
Confidence 76543236888999999999999999999999999998755 787643210000 0000112233332 22345799
Q ss_pred CCCHHHHHHhHHHHHHHhhccccCCCCEEEEEecCCCccCC
Q psy11843 285 FESLKLTIERTLPYWNNVIVPQYSDETCYLATVTWNKNKKV 325 (325)
Q Consensus 285 gES~~~~~~Rv~~~l~~ii~~~~~~~~~vLvVsHg~~ir~~ 325 (325)
|||+.++.+|+..+|++++.....++++|||||||++||++
T Consensus 149 GES~~~~~~Rv~~~l~~~~~~~~~~~~~vlvVsHg~vir~l 189 (228)
T PRK14119 149 SESLKDTLVRVIPFWTDHISQYLLDGQTVLVSAHGNSIRAL 189 (228)
T ss_pred CCCHHHHHHHHHHHHHHHHHhhccCCCeEEEEeChHHHHHH
Confidence 99999999999999999764433467899999999999864
|
|
| >PRK14116 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK14117 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK01295 phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK14118 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >COG0588 GpmA Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14115 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK01112 phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >TIGR01258 pgm_1 phosphoglycerate mutase, BPG-dependent, family 1 | Back alignment and domain information |
|---|
| >PRK13463 phosphatase PhoE; Provisional | Back alignment and domain information |
|---|
| >PRK14120 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK15004 alpha-ribazole phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK03482 phosphoglycerate mutase; Provisional | Back alignment and domain information |
|---|
| >TIGR03848 MSMEG_4193 probable phosphomutase, MSMEG_4193 family | Back alignment and domain information |
|---|
| >TIGR03162 ribazole_cobC alpha-ribazole phosphatase | Back alignment and domain information |
|---|
| >COG0406 phoE Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13462 acid phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0235|consensus | Back alignment and domain information |
|---|
| >smart00855 PGAM Phosphoglycerate mutase family | Back alignment and domain information |
|---|
| >PRK07238 bifunctional RNase H/acid phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF00300 His_Phos_1: Histidine phosphatase superfamily (branch 1); InterPro: IPR013078 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle | Back alignment and domain information |
|---|
| >PTZ00123 phosphoglycerate mutase like-protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00122 phosphoglycerate mutase; Provisional | Back alignment and domain information |
|---|
| >cd07067 HP_PGM_like Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >KOG4026|consensus | Back alignment and domain information |
|---|
| >PRK14116 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK14119 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK06193 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd07040 HP Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >PRK14117 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK15416 lipopolysaccharide core heptose(II)-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14118 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK13463 phosphatase PhoE; Provisional | Back alignment and domain information |
|---|
| >PRK14120 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >TIGR00249 sixA phosphohistidine phosphatase SixA | Back alignment and domain information |
|---|
| >KOG3734|consensus | Back alignment and domain information |
|---|
| >KOG4609|consensus | Back alignment and domain information |
|---|
| >PRK01112 phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >KOG4754|consensus | Back alignment and domain information |
|---|
| >COG0406 phoE Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10848 phosphohistidine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK15004 alpha-ribazole phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13462 acid phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0234|consensus | Back alignment and domain information |
|---|
| >PF10242 L_HGMIC_fpl: Lipoma HMGIC fusion partner-like protein; InterPro: IPR019372 This is a group of proteins expressed from a series of genes referred to as Lipoma HGMIC fusion partner-like | Back alignment and domain information |
|---|
| >PRK01295 phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >PRK03482 phosphoglycerate mutase; Provisional | Back alignment and domain information |
|---|
| >PRK14115 gpmA phosphoglyceromutase; Provisional | Back alignment and domain information |
|---|
| >TIGR01258 pgm_1 phosphoglycerate mutase, BPG-dependent, family 1 | Back alignment and domain information |
|---|
| >TIGR03848 MSMEG_4193 probable phosphomutase, MSMEG_4193 family | Back alignment and domain information |
|---|
| >COG2062 SixA Phosphohistidine phosphatase SixA [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0235|consensus | Back alignment and domain information |
|---|
| >COG0588 GpmA Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07238 bifunctional RNase H/acid phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR03162 ribazole_cobC alpha-ribazole phosphatase | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >smart00855 PGAM Phosphoglycerate mutase family | Back alignment and domain information |
|---|
| >PF00300 His_Phos_1: Histidine phosphatase superfamily (branch 1); InterPro: IPR013078 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle | Back alignment and domain information |
|---|
| >PTZ00123 phosphoglycerate mutase like-protein; Provisional | Back alignment and domain information |
|---|
| >cd07067 HP_PGM_like Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >PTZ00122 phosphoglycerate mutase; Provisional | Back alignment and domain information |
|---|
| >PRK06193 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd07040 HP Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >PRK10848 phosphohistidine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR00249 sixA phosphohistidine phosphatase SixA | Back alignment and domain information |
|---|
| >PRK15416 lipopolysaccharide core heptose(II)-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG2062 SixA Phosphohistidine phosphatase SixA [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07061 HP_HAP_like Histidine phosphatase domain found in histidine acid phosphatases and phytases; contains a His residue which is phosphorylated during the reaction | Back alignment and domain information |
|---|
| >KOG4754|consensus | Back alignment and domain information |
|---|
| >KOG0234|consensus | Back alignment and domain information |
|---|
| >PF00328 His_Phos_2: Histidine phosphatase superfamily (branch 2); InterPro: IPR000560 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle | Back alignment and domain information |
|---|
| >PRK10173 glucose-1-phosphatase/inositol phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG3720|consensus | Back alignment and domain information |
|---|
| >PRK10172 phosphoanhydride phosphorylase; Provisional | Back alignment and domain information |
|---|
| >KOG4609|consensus | Back alignment and domain information |
|---|
| >KOG1057|consensus | Back alignment and domain information |
|---|
| >KOG3734|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 325 | ||||
| 1yfk_A | 262 | Crystal Structure Of Human B Type Phosphoglycerate | 3e-24 | ||
| 1e58_A | 249 | E.Coli Cofactor-Dependent Phosphoglycerate Mutase L | 2e-23 | ||
| 1e59_A | 249 | E.Coli Cofactor-Dependent Phosphoglycerate Mutase C | 2e-23 | ||
| 2hhj_A | 267 | Human Bisphosphoglycerate Mutase Complexed With 2,3 | 3e-21 | ||
| 1t8p_A | 267 | Crystal Structure Of Human Erythrocyte 2,3- Bisphos | 3e-21 | ||
| 4emb_A | 274 | Crystal Structure Of A Phosphoglycerate Mutase Gpma | 1e-20 | ||
| 3fdz_B | 257 | Crystal Structure Of Phosphoglyceromutase From Burk | 4e-20 | ||
| 3lnt_A | 250 | Crystal Structure Of Phosphoglyceromutase From Burk | 4e-20 | ||
| 3ezn_A | 257 | Crystal Structure Of Phosphoglyceromutase From Burk | 4e-20 | ||
| 1xq9_A | 258 | Structure Of Phosphoglycerate Mutase From Plasmodiu | 9e-17 | ||
| 3d8h_A | 267 | Crystal Structure Of Phosphoglycerate Mutase From C | 4e-16 | ||
| 3kkk_A | 258 | Y92c Catalytic Residue Mutant Of Phosphoglycerate M | 8e-16 | ||
| 1rii_A | 265 | Crystal Structure Of Phosphoglycerate Mutase From M | 9e-16 | ||
| 4eo9_A | 268 | Crystal Structure Of A Phosphoglycerate Mutase Gpm1 | 4e-15 | ||
| 1qhf_A | 240 | Yeast Phosphoglycerate Mutase-3pg Complex Structure | 2e-14 | ||
| 4pgm_A | 246 | Saccharomyces Cerevisiae Phosphoglycerate Mutase Le | 2e-14 | ||
| 3pgm_A | 244 | The Structure Of Yeast Phosphoglycerate Mutase At 0 | 7e-14 | ||
| 1fzt_A | 211 | Solution Structure And Dynamics Of An Open B-Sheet, | 1e-11 |
| >pdb|1YFK|A Chain A, Crystal Structure Of Human B Type Phosphoglycerate Mutase Length = 262 | Back alignment and structure |
|
| >pdb|1E58|A Chain A, E.Coli Cofactor-Dependent Phosphoglycerate Mutase Length = 249 | Back alignment and structure |
| >pdb|1E59|A Chain A, E.Coli Cofactor-Dependent Phosphoglycerate Mutase Complexed With Vanadate Length = 249 | Back alignment and structure |
| >pdb|2HHJ|A Chain A, Human Bisphosphoglycerate Mutase Complexed With 2,3- Bisphosphoglycerate (15 Days) Length = 267 | Back alignment and structure |
| >pdb|1T8P|A Chain A, Crystal Structure Of Human Erythrocyte 2,3- Bisphosphoglycerate Mutase Length = 267 | Back alignment and structure |
| >pdb|4EMB|A Chain A, Crystal Structure Of A Phosphoglycerate Mutase Gpma From Borrelia Burgdorferi B31 Length = 274 | Back alignment and structure |
| >pdb|3FDZ|B Chain B, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b With Bound 2,3-Diphosphoglyceric Acid And 3- Phosphoglyceric Acid Length = 257 | Back alignment and structure |
| >pdb|3LNT|A Chain A, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b With Bound Malonic Acid Length = 250 | Back alignment and structure |
| >pdb|3EZN|A Chain A, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b Length = 257 | Back alignment and structure |
| >pdb|1XQ9|A Chain A, Structure Of Phosphoglycerate Mutase From Plasmodium Falciparum At 2.6 Resolution Length = 258 | Back alignment and structure |
| >pdb|3D8H|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From Cryptosporidium Parvum, Cgd7_4270 Length = 267 | Back alignment and structure |
| >pdb|3KKK|A Chain A, Y92c Catalytic Residue Mutant Of Phosphoglycerate Mutase From Plasmodium Falciparum Length = 258 | Back alignment and structure |
| >pdb|1RII|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From M. Tuberculosis Length = 265 | Back alignment and structure |
| >pdb|4EO9|A Chain A, Crystal Structure Of A Phosphoglycerate Mutase Gpm1 From Mycobacterium Leprae Length = 268 | Back alignment and structure |
| >pdb|1QHF|A Chain A, Yeast Phosphoglycerate Mutase-3pg Complex Structure To 1.7 A Length = 240 | Back alignment and structure |
| >pdb|4PGM|A Chain A, Saccharomyces Cerevisiae Phosphoglycerate Mutase Length = 246 | Back alignment and structure |
| >pdb|3PGM|A Chain A, The Structure Of Yeast Phosphoglycerate Mutase At 0.28 Nm Resolution Length = 244 | Back alignment and structure |
| >pdb|1FZT|A Chain A, Solution Structure And Dynamics Of An Open B-Sheet, Glycolytic Enzyme-Monomeric 23.7 Kda Phosphoglycerate Mutase From Schizosaccharomyces Pombe Length = 211 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 325 | |||
| 1yfk_A | 262 | Phosphoglycerate mutase 1; alpha/beta, isomerase, | 1e-62 | |
| 1yfk_A | 262 | Phosphoglycerate mutase 1; alpha/beta, isomerase, | 8e-16 | |
| 2hhj_A | 267 | Bisphosphoglycerate mutase; isomerase; HET: NEP DG | 1e-62 | |
| 2hhj_A | 267 | Bisphosphoglycerate mutase; isomerase; HET: NEP DG | 8e-16 | |
| 1qhf_A | 240 | Protein (phosphoglycerate mutase); transferase (ph | 3e-60 | |
| 1qhf_A | 240 | Protein (phosphoglycerate mutase); transferase (ph | 2e-13 | |
| 3gp3_A | 257 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 5e-60 | |
| 3gp3_A | 257 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 9e-14 | |
| 3kkk_A | 258 | Phosphoglycerate mutase; PGAM, glycolysis, malaria | 1e-59 | |
| 3kkk_A | 258 | Phosphoglycerate mutase; PGAM, glycolysis, malaria | 4e-15 | |
| 3d8h_A | 267 | Glycolytic phosphoglycerate mutase; structural gen | 1e-59 | |
| 3d8h_A | 267 | Glycolytic phosphoglycerate mutase; structural gen | 4e-15 | |
| 1e58_A | 249 | Phosphoglycerate mutase; phosphohistidine, glycoly | 1e-59 | |
| 1e58_A | 249 | Phosphoglycerate mutase; phosphohistidine, glycoly | 5e-14 | |
| 4emb_A | 274 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 1e-59 | |
| 4emb_A | 274 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 1e-13 | |
| 4eo9_A | 268 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 2e-58 | |
| 4eo9_A | 268 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 1e-14 | |
| 1rii_A | 265 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 3e-58 | |
| 1rii_A | 265 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 1e-14 | |
| 1fzt_A | 211 | Phosphoglycerate mutase; open B-sheet-helices, iso | 5e-52 | |
| 1fzt_A | 211 | Phosphoglycerate mutase; open B-sheet-helices, iso | 4e-15 | |
| 3r7a_A | 237 | Phosphoglycerate mutase, putative; structural geno | 3e-40 | |
| 3r7a_A | 237 | Phosphoglycerate mutase, putative; structural geno | 7e-10 | |
| 3dcy_A | 275 | Regulator protein; OMIM 610775, C12ORF5, tigar, TP | 1e-39 | |
| 3dcy_A | 275 | Regulator protein; OMIM 610775, C12ORF5, tigar, TP | 4e-12 | |
| 3f3k_A | 265 | Uncharacterized protein YKR043C; structural genomi | 4e-28 | |
| 3f3k_A | 265 | Uncharacterized protein YKR043C; structural genomi | 9e-09 | |
| 3mbk_A | 264 | Ubiquitin-associated and SH3 domain-containing PR; | 8e-20 | |
| 3e9c_A | 265 | ZGC:56074; histidine phosphatase, hydrolase; 2.00A | 3e-19 | |
| 3e9c_A | 265 | ZGC:56074; histidine phosphatase, hydrolase; 2.00A | 2e-08 | |
| 1h2e_A | 207 | Phosphatase, YHFR; hydrolase, broad specificity ph | 7e-13 | |
| 1h2e_A | 207 | Phosphatase, YHFR; hydrolase, broad specificity ph | 2e-06 | |
| 2a6p_A | 208 | Possible phosphoglycerate mutase GPM2; predicted p | 1e-12 | |
| 2a6p_A | 208 | Possible phosphoglycerate mutase GPM2; predicted p | 4e-06 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 1e-09 | |
| 1v37_A | 177 | Phosphoglycerate mutase; riken structu genomics/pr | 2e-09 | |
| 1v37_A | 177 | Phosphoglycerate mutase; riken structu genomics/pr | 3e-06 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 6e-09 | |
| 3hjg_A | 213 | Putative alpha-ribazole-5'-phosphate phosphatase C | 9e-09 | |
| 3c7t_A | 263 | Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph | 1e-08 | |
| 3d4i_A | 273 | STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai | 1e-07 | |
| 3mxo_A | 202 | Serine/threonine-protein phosphatase PGAM5, mitoc; | 3e-07 | |
| 3eoz_A | 214 | Putative phosphoglycerate mutase; PGAM, malaria, s | 3e-06 | |
| 2qni_A | 219 | AGR_C_517P, uncharacterized protein ATU0299; MCSG, | 8e-04 |
| >1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* Length = 262 | Back alignment and structure |
|---|
Score = 198 bits (507), Expect = 1e-62
Identities = 73/142 (51%), Positives = 87/142 (61%), Gaps = 10/142 (7%)
Query: 173 VNEAEAAGVALAKAGFKFDVAHTSVLTRAQNTLKAILKGIGQEDLPVHKSWRLNERHYGG 232
EA+ G AL AG++FD+ TSV RA TL +L I Q LPV ++WRLNERHYGG
Sbjct: 35 HEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGG 94
Query: 233 LTGLDKAATAAKYGEEQRVHR-----DTI---GLEDHAYYSNIVDDPRYASEPSKEEFPM 284
LTGL+KA TAAK+GE Q V D DH +YSNI D RYA +++ P
Sbjct: 95 LTGLNKAETAAKHGEAQ-VKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLT-EDQLPS 152
Query: 285 FESLKLTIERTLPYWNNVIVPQ 306
ESLK TI R LP+WN IVPQ
Sbjct: 153 CESLKDTIARALPFWNEEIVPQ 174
|
| >1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* Length = 262 | Back alignment and structure |
|---|
| >2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A Length = 267 | Back alignment and structure |
|---|
| >2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A Length = 267 | Back alignment and structure |
|---|
| >1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* Length = 240 | Back alignment and structure |
|---|
| >1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* Length = 240 | Back alignment and structure |
|---|
| >3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A Length = 257 | Back alignment and structure |
|---|
| >3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A Length = 257 | Back alignment and structure |
|---|
| >3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A Length = 258 | Back alignment and structure |
|---|
| >3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A Length = 258 | Back alignment and structure |
|---|
| >3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} Length = 267 | Back alignment and structure |
|---|
| >3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} Length = 267 | Back alignment and structure |
|---|
| >1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* Length = 249 | Back alignment and structure |
|---|
| >1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* Length = 249 | Back alignment and structure |
|---|
| >4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} Length = 274 | Back alignment and structure |
|---|
| >4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} Length = 274 | Back alignment and structure |
|---|
| >4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} Length = 268 | Back alignment and structure |
|---|
| >4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} Length = 268 | Back alignment and structure |
|---|
| >1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 Length = 265 | Back alignment and structure |
|---|
| >1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 Length = 265 | Back alignment and structure |
|---|
| >1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 Length = 211 | Back alignment and structure |
|---|
| >1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 Length = 211 | Back alignment and structure |
|---|
| >3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} Length = 237 | Back alignment and structure |
|---|
| >3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} Length = 237 | Back alignment and structure |
|---|
| >3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Length = 275 | Back alignment and structure |
|---|
| >3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Length = 275 | Back alignment and structure |
|---|
| >3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* Length = 265 | Back alignment and structure |
|---|
| >3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* Length = 265 | Back alignment and structure |
|---|
| >3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A Length = 264 | Back alignment and structure |
|---|
| >3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A Length = 265 | Back alignment and structure |
|---|
| >3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A Length = 265 | Back alignment and structure |
|---|
| >1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Length = 207 | Back alignment and structure |
|---|
| >1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Length = 207 | Back alignment and structure |
|---|
| >2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} Length = 208 | Back alignment and structure |
|---|
| >2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} Length = 208 | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Length = 520 | Back alignment and structure |
|---|
| >1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Length = 177 | Back alignment and structure |
|---|
| >1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Length = 177 | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Length = 469 | Back alignment and structure |
|---|
| >3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} Length = 213 | Back alignment and structure |
|---|
| >3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Length = 263 | Back alignment and structure |
|---|
| >3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Length = 273 | Back alignment and structure |
|---|
| >3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A Length = 202 | Back alignment and structure |
|---|
| >3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} Length = 214 | Back alignment and structure |
|---|
| >2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} Length = 219 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 325 | |||
| 1yfk_A | 262 | Phosphoglycerate mutase 1; alpha/beta, isomerase, | 100.0 | |
| 3kkk_A | 258 | Phosphoglycerate mutase; PGAM, glycolysis, malaria | 100.0 | |
| 4emb_A | 274 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 100.0 | |
| 1rii_A | 265 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 100.0 | |
| 1e58_A | 249 | Phosphoglycerate mutase; phosphohistidine, glycoly | 100.0 | |
| 2hhj_A | 267 | Bisphosphoglycerate mutase; isomerase; HET: NEP DG | 100.0 | |
| 1qhf_A | 240 | Protein (phosphoglycerate mutase); transferase (ph | 100.0 | |
| 3gp3_A | 257 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 100.0 | |
| 3d8h_A | 267 | Glycolytic phosphoglycerate mutase; structural gen | 100.0 | |
| 4eo9_A | 268 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 100.0 | |
| 1fzt_A | 211 | Phosphoglycerate mutase; open B-sheet-helices, iso | 100.0 | |
| 1h2e_A | 207 | Phosphatase, YHFR; hydrolase, broad specificity ph | 100.0 | |
| 3hjg_A | 213 | Putative alpha-ribazole-5'-phosphate phosphatase C | 100.0 | |
| 3r7a_A | 237 | Phosphoglycerate mutase, putative; structural geno | 100.0 | |
| 2a6p_A | 208 | Possible phosphoglycerate mutase GPM2; predicted p | 99.98 | |
| 3f3k_A | 265 | Uncharacterized protein YKR043C; structural genomi | 99.97 | |
| 3d4i_A | 273 | STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai | 99.97 | |
| 2qni_A | 219 | AGR_C_517P, uncharacterized protein ATU0299; MCSG, | 99.97 | |
| 3e9c_A | 265 | ZGC:56074; histidine phosphatase, hydrolase; 2.00A | 99.97 | |
| 3dcy_A | 275 | Regulator protein; OMIM 610775, C12ORF5, tigar, TP | 99.97 | |
| 3mbk_A | 264 | Ubiquitin-associated and SH3 domain-containing PR; | 99.97 | |
| 1v37_A | 177 | Phosphoglycerate mutase; riken structu genomics/pr | 99.96 | |
| 3c7t_A | 263 | Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph | 99.96 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 99.95 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 99.95 | |
| 3eoz_A | 214 | Putative phosphoglycerate mutase; PGAM, malaria, s | 99.94 | |
| 3mxo_A | 202 | Serine/threonine-protein phosphatase PGAM5, mitoc; | 99.93 | |
| 1ujc_A | 161 | Phosphohistidine phosphatase SIXA; alpha-beta fold | 99.88 | |
| 2rfl_A | 173 | Putative phosphohistidine phosphatase SIXA; alpha- | 99.86 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 99.79 | |
| 3f2i_A | 172 | ALR0221 protein; alpha-beta protein, structural ge | 99.72 | |
| 1yfk_A | 262 | Phosphoglycerate mutase 1; alpha/beta, isomerase, | 99.72 | |
| 2hhj_A | 267 | Bisphosphoglycerate mutase; isomerase; HET: NEP DG | 99.69 | |
| 3gp3_A | 257 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 99.67 | |
| 1e58_A | 249 | Phosphoglycerate mutase; phosphohistidine, glycoly | 99.67 | |
| 3d8h_A | 267 | Glycolytic phosphoglycerate mutase; structural gen | 99.67 | |
| 4hbz_A | 186 | Putative phosphohistidine phosphatase, SIXA; struc | 99.66 | |
| 4emb_A | 274 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 99.66 | |
| 1rii_A | 265 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 99.66 | |
| 3hjg_A | 213 | Putative alpha-ribazole-5'-phosphate phosphatase C | 99.64 | |
| 1h2e_A | 207 | Phosphatase, YHFR; hydrolase, broad specificity ph | 99.64 | |
| 3r7a_A | 237 | Phosphoglycerate mutase, putative; structural geno | 99.63 | |
| 1fzt_A | 211 | Phosphoglycerate mutase; open B-sheet-helices, iso | 99.63 | |
| 3kkk_A | 258 | Phosphoglycerate mutase; PGAM, glycolysis, malaria | 99.62 | |
| 1qhf_A | 240 | Protein (phosphoglycerate mutase); transferase (ph | 99.62 | |
| 4eo9_A | 268 | 2,3-bisphosphoglycerate-dependent phosphoglycerat; | 99.61 | |
| 3e9c_A | 265 | ZGC:56074; histidine phosphatase, hydrolase; 2.00A | 99.6 | |
| 2a6p_A | 208 | Possible phosphoglycerate mutase GPM2; predicted p | 99.59 | |
| 3f3k_A | 265 | Uncharacterized protein YKR043C; structural genomi | 99.56 | |
| 1v37_A | 177 | Phosphoglycerate mutase; riken structu genomics/pr | 99.54 | |
| 3dcy_A | 275 | Regulator protein; OMIM 610775, C12ORF5, tigar, TP | 99.52 | |
| 2qni_A | 219 | AGR_C_517P, uncharacterized protein ATU0299; MCSG, | 99.52 | |
| 3d4i_A | 273 | STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai | 99.46 | |
| 3c7t_A | 263 | Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph | 99.43 | |
| 2rfl_A | 173 | Putative phosphohistidine phosphatase SIXA; alpha- | 99.32 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 99.27 | |
| 3eoz_A | 214 | Putative phosphoglycerate mutase; PGAM, malaria, s | 99.24 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 99.23 | |
| 3mxo_A | 202 | Serine/threonine-protein phosphatase PGAM5, mitoc; | 99.06 | |
| 1ujc_A | 161 | Phosphohistidine phosphatase SIXA; alpha-beta fold | 98.98 | |
| 3mbk_A | 264 | Ubiquitin-associated and SH3 domain-containing PR; | 98.66 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 98.65 | |
| 3f2i_A | 172 | ALR0221 protein; alpha-beta protein, structural ge | 98.58 | |
| 4hbz_A | 186 | Putative phosphohistidine phosphatase, SIXA; struc | 98.16 | |
| 1dkq_A | 410 | Phytase; histidine acid phosphatase fold, hydrolas | 96.46 | |
| 3ntl_A | 398 | Acid glucose-1-phosphate phosphatase; histidine ac | 96.12 | |
| 1nd6_A | 354 | Prostatic acid phosphatase; PAP, prostate, phospha | 96.02 | |
| 2wnh_A | 418 | 3-phytase; histidine acid phosphatase, hydrolase; | 96.02 | |
| 3it3_A | 342 | Acid phosphatase; HAP, hydrolase; HET: 3AM; 1.50A | 95.78 | |
| 1qwo_A | 442 | Phytase; alpha barrel, beta sandwich, orthogonal b | 94.69 | |
| 3k4q_A | 444 | 3-phytase A; PHYA, 3-phosphotase, MYO-inositol hex | 93.79 |
| >1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.3e-36 Score=275.28 Aligned_cols=185 Identities=42% Similarity=0.627 Sum_probs=148.5
Q ss_pred CccceEEecCCCccccccccccccccCCCCCCCCCCCCCCChhhHHHHHHHHHHHHHcCCCcCEEEecCcHHHHHHHHHH
Q psy11843 129 NLHPVMLMPQGVHEQDRFSEFSNRTANSKSSRYARPEYPSSLNSVNEAEAAGVALAKAGFKFDVAHTSVLTRAQNTLKAI 208 (325)
Q Consensus 129 ~~~~i~lvRHGe~~~~~~t~~n~~~~~~~~~~~g~~d~~Lt~~G~~qa~~~~~~l~~~~~~~~~i~sSpl~Ra~qTA~~i 208 (325)
.|++|||||||| |.||.. ...+|+.|.|||+.|++||+.+++.|++.+.+||.|||||+.||+|||+++
T Consensus 2 ~M~~l~LvRHGq------t~~n~~-----~~~~G~~D~pLt~~G~~QA~~l~~~L~~~~~~~d~i~sSpl~Ra~qTA~~i 70 (262)
T 1yfk_A 2 AAYKLVLIRHGE------SAWNLE-----NRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTV 70 (262)
T ss_dssp -CEEEEEEECCC------BTTTTT-----TBCCTTSCCCBCHHHHHHHHHHHHHHHHHTCCCSEEEECSCHHHHHHHHHH
T ss_pred CceEEEEEeCCC------cccccc-----cCcCCCCCCCCCHHHHHHHHHHHHHHHhCCCCCCEEEECCcHHHHHHHHHH
Confidence 357899999998 888863 355789999999999999999999999777899999999999999999999
Q ss_pred HHhcCCCCCCccccccchhhccCCCCCCcHHHHHHhhchhHH-HhhhccCcc------cccccccccCCcccCCCCCCCC
Q psy11843 209 LKGIGQEDLPVHKSWRLNERHYGGLTGLDKAATAAKYGEEQR-VHRDTIGLE------DHAYYSNIVDDPRYASEPSKEE 281 (325)
Q Consensus 209 ~~~~~~~~~~i~~~~~L~E~~~G~~eG~~~~e~~~~~~~~~~-~w~~~~~~~------~~~~~~~~~~~~~y~~~~~~~~ 281 (325)
++.++...+|+.++++|+|++||.|+|++.+++.+.+|+... .|..++... .+++|+.+..++.|.. .....
T Consensus 71 ~~~~~~~~~~v~~~~~L~E~~~G~~eG~~~~ei~~~~~~~~~~~w~~~~~~~p~~~~~~~~~~~~i~~d~~~~~-~~~~~ 149 (262)
T 1yfk_A 71 LDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYAD-LTEDQ 149 (262)
T ss_dssp HHHTTCTTSCEEECGGGSCCCCGGGTTSBHHHHHHHHCHHHHHHHHHCSSCCCCCCCTTSTTHHHHHTCGGGTT-SCTTT
T ss_pred HHhcCCCCCCeeeCcccccccCcccCCCcHHHHHHHccHHHHHHHHhccccCCCcccccccccccccccccccc-cccCC
Confidence 998875457888999999999999999999999999998765 887754311 1222222223455532 12345
Q ss_pred CCCCCCHHHHHHhHHHHHHHhhccccCCCCEEEEEecCCCccCC
Q psy11843 282 FPMFESLKLTIERTLPYWNNVIVPQYSDETCYLATVTWNKNKKV 325 (325)
Q Consensus 282 ~p~gES~~~~~~Rv~~~l~~ii~~~~~~~~~vLvVsHg~~ir~~ 325 (325)
+|+|||+.++.+|+..+|++++.....++++|||||||++||++
T Consensus 150 ~p~gEs~~~~~~Rv~~~l~~li~~~~~~~~~vlvVsHg~~ir~l 193 (262)
T 1yfk_A 150 LPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGI 193 (262)
T ss_dssp SCSCCCHHHHHHHHHHHHHHHHHHHHHTTCCEEEEECHHHHHHH
T ss_pred CCCCCCHHHHHHHHHHHHHHHHHhhccCCCeEEEEcChHHHHHH
Confidence 78999999999999999999653332456789999999999863
|
| >3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A | Back alignment and structure |
|---|
| >4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 | Back alignment and structure |
|---|
| >1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* | Back alignment and structure |
|---|
| >2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A | Back alignment and structure |
|---|
| >1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* | Back alignment and structure |
|---|
| >3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} SCOP: c.60.1.1 PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A | Back alignment and structure |
|---|
| >3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} | Back alignment and structure |
|---|
| >1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 | Back alignment and structure |
|---|
| >1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A | Back alignment and structure |
|---|
| >3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* | Back alignment and structure |
|---|
| >3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A | Back alignment and structure |
|---|
| >2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A | Back alignment and structure |
|---|
| >3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A | Back alignment and structure |
|---|
| >1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... | Back alignment and structure |
|---|
| >3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A | Back alignment and structure |
|---|
| >1ujc_A Phosphohistidine phosphatase SIXA; alpha-beta fold, hydrolase; 1.90A {Escherichia coli} PDB: 1ujb_A | Back alignment and structure |
|---|
| >2rfl_A Putative phosphohistidine phosphatase SIXA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 2.35A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3f2i_A ALR0221 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG, function; 2.00A {Nostoc SP} | Back alignment and structure |
|---|
| >1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* | Back alignment and structure |
|---|
| >2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A | Back alignment and structure |
|---|
| >3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} SCOP: c.60.1.1 PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A | Back alignment and structure |
|---|
| >1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* | Back alignment and structure |
|---|
| >3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >4hbz_A Putative phosphohistidine phosphatase, SIXA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, HP_PGM_LIKE; HET: PGE; 1.55A {Nakamurella multipartita} | Back alignment and structure |
|---|
| >4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 | Back alignment and structure |
|---|
| >3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A | Back alignment and structure |
|---|
| >3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 | Back alignment and structure |
|---|
| >3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A | Back alignment and structure |
|---|
| >1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* | Back alignment and structure |
|---|
| >4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} | Back alignment and structure |
|---|
| >3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A | Back alignment and structure |
|---|
| >2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* | Back alignment and structure |
|---|
| >1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... | Back alignment and structure |
|---|
| >3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A | Back alignment and structure |
|---|
| >3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} | Back alignment and structure |
|---|
| >2rfl_A Putative phosphohistidine phosphatase SIXA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 2.35A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A | Back alignment and structure |
|---|
| >1ujc_A Phosphohistidine phosphatase SIXA; alpha-beta fold, hydrolase; 1.90A {Escherichia coli} PDB: 1ujb_A | Back alignment and structure |
|---|
| >3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3f2i_A ALR0221 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG, function; 2.00A {Nostoc SP} | Back alignment and structure |
|---|
| >4hbz_A Putative phosphohistidine phosphatase, SIXA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, HP_PGM_LIKE; HET: PGE; 1.55A {Nakamurella multipartita} | Back alignment and structure |
|---|
| >1dkq_A Phytase; histidine acid phosphatase fold, hydrolase; HET: IHP; 2.05A {Escherichia coli} SCOP: c.60.1.2 PDB: 1dkp_A* 1dkm_A 1dkn_A 1dko_A 1dkl_A | Back alignment and structure |
|---|
| >3ntl_A Acid glucose-1-phosphate phosphatase; histidine acid phosphatase, phytate binding site, hydrolase; HET: IHP; 1.88A {Enterobacter cloacae} PDB: 1nt4_A* | Back alignment and structure |
|---|
| >1nd6_A Prostatic acid phosphatase; PAP, prostate, phosphate, inhibi hydrolase; HET: NAG MAN 1PE; 2.40A {Homo sapiens} SCOP: c.60.1.2 PDB: 1nd5_A* 2hpa_A* 1cvi_A* 1rpa_A* 1rpt_A* 2l3h_A 2l77_A 2l79_A | Back alignment and structure |
|---|
| >2wnh_A 3-phytase; histidine acid phosphatase, hydrolase; 1.68A {Klebsiella pneumoniae} PDB: 2wni_A 2wu0_A | Back alignment and structure |
|---|
| >3it3_A Acid phosphatase; HAP, hydrolase; HET: 3AM; 1.50A {Francisella tularensis subsp} PDB: 4e3w_A 2glc_A 2glb_A 2gla_A 3it0_A* 3it1_A* 3it2_A 2p36_A* | Back alignment and structure |
|---|
| >1qwo_A Phytase; alpha barrel, beta sandwich, orthogonal bundle, glycoprotein phosphohistidine, hydrolase; HET: NEP NAG; 1.50A {Aspergillus fumigatus} SCOP: c.60.1.2 PDB: 1skb_A* 1sk8_A* 1ska_A* 1sk9_A* | Back alignment and structure |
|---|
| >3k4q_A 3-phytase A; PHYA, 3-phosphotase, MYO-inositol hexakis phosphate phosphohydrolase, 37288-11-2, MYO-inositol hexakis sulfate, 62-1; HET: IHS NAG; 2.20A {Aspergillus niger} SCOP: c.60.1.2 PDB: 3k4p_A* 1ihp_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 325 | ||||
| d1e58a_ | 247 | c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia | 1e-17 | |
| d1e58a_ | 247 | c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia | 1e-08 | |
| d2hhja1 | 248 | c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human | 1e-11 | |
| d2hhja1 | 248 | c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human | 1e-09 | |
| d1xq9a_ | 241 | c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium | 2e-10 | |
| d1xq9a_ | 241 | c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium | 1e-09 | |
| d1riia_ | 243 | c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacteri | 1e-08 | |
| d1riia_ | 243 | c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacteri | 2e-07 | |
| d1qhfa_ | 240 | c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yea | 2e-08 | |
| d1qhfa_ | 240 | c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yea | 3e-08 | |
| d1fzta_ | 211 | c.60.1.1 (A:) Phosphoglycerate mutase {Fission yea | 1e-07 | |
| d1fzta_ | 211 | c.60.1.1 (A:) Phosphoglycerate mutase {Fission yea | 1e-05 | |
| d1h2ea_ | 207 | c.60.1.1 (A:) Broad specificity phosphatase PhoE ( | 6e-07 | |
| d1v37a_ | 171 | c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphat | 1e-06 | |
| d1bifa2 | 219 | c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fruc | 8e-04 |
| >d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Length = 247 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Phosphoglycerate mutase-like superfamily: Phosphoglycerate mutase-like family: Cofactor-dependent phosphoglycerate mutase domain: Phosphoglycerate mutase species: Escherichia coli [TaxId: 562]
Score = 78.8 bits (193), Expect = 1e-17
Identities = 66/140 (47%), Positives = 85/140 (60%), Gaps = 8/140 (5%)
Query: 173 VNEAEAAGVALAKAGFKFDVAHTSVLTRAQNTLKAILKGIGQEDLPVHKSWRLNERHYGG 232
V+EA+AAG L + G+ FD A+TSVL RA +TL +L + Q LPV KSW+LNERHYG
Sbjct: 34 VSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGA 93
Query: 233 LTGLDKAATAAKYGEEQRVHRDTIGLEDHAYYSNIVDDPRYAS------EPSKEEFPMFE 286
L GL+KA TA KYG+EQ DD RY + S++E P+ E
Sbjct: 94 LQGLNKAETAEKYGDEQVKQWRRG--FAVTPPELTKDDERYPGHDPRYAKLSEKELPLTE 151
Query: 287 SLKLTIERTLPYWNNVIVPQ 306
SL LTI+R +PYWN I+P+
Sbjct: 152 SLALTIDRVIPYWNETILPR 171
|
| >d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Length = 247 | Back information, alignment and structure |
|---|
| >d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 | Back information, alignment and structure |
|---|
| >d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 | Back information, alignment and structure |
|---|
| >d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 243 | Back information, alignment and structure |
|---|
| >d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 243 | Back information, alignment and structure |
|---|
| >d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 240 | Back information, alignment and structure |
|---|
| >d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 240 | Back information, alignment and structure |
|---|
| >d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 211 | Back information, alignment and structure |
|---|
| >d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 211 | Back information, alignment and structure |
|---|
| >d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} Length = 207 | Back information, alignment and structure |
|---|
| >d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} Length = 171 | Back information, alignment and structure |
|---|
| >d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 219 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 325 | |||
| d1e58a_ | 247 | Phosphoglycerate mutase {Escherichia coli [TaxId: | 100.0 | |
| d1h2ea_ | 207 | Broad specificity phosphatase PhoE (YhfR) {Bacillu | 100.0 | |
| d1fzta_ | 211 | Phosphoglycerate mutase {Fission yeast (Schizosacc | 100.0 | |
| d1riia_ | 243 | Phosphoglycerate mutase {Mycobacterium tuberculosi | 100.0 | |
| d2hhja1 | 248 | Phosphoglycerate mutase {Human (Homo sapiens) [Tax | 100.0 | |
| d1xq9a_ | 241 | Phosphoglycerate mutase {Plasmodium falciparum [Ta | 100.0 | |
| d1qhfa_ | 240 | Phosphoglycerate mutase {Baker's yeast (Saccharomy | 99.98 | |
| d1bifa2 | 219 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 99.97 | |
| d1v37a_ | 171 | Alpha-ribazole-5'-phosphate phosphatase {Thermus t | 99.97 | |
| d1e58a_ | 247 | Phosphoglycerate mutase {Escherichia coli [TaxId: | 99.79 | |
| d1riia_ | 243 | Phosphoglycerate mutase {Mycobacterium tuberculosi | 99.7 | |
| d1xq9a_ | 241 | Phosphoglycerate mutase {Plasmodium falciparum [Ta | 99.68 | |
| d2hhja1 | 248 | Phosphoglycerate mutase {Human (Homo sapiens) [Tax | 99.66 | |
| d1h2ea_ | 207 | Broad specificity phosphatase PhoE (YhfR) {Bacillu | 99.64 | |
| d1fzta_ | 211 | Phosphoglycerate mutase {Fission yeast (Schizosacc | 99.61 | |
| d1qhfa_ | 240 | Phosphoglycerate mutase {Baker's yeast (Saccharomy | 99.59 | |
| d1v37a_ | 171 | Alpha-ribazole-5'-phosphate phosphatase {Thermus t | 99.58 | |
| d1bifa2 | 219 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 99.42 | |
| d1dkla_ | 409 | Phytase (myo-inositol-hexakisphosphate-3-phosphohy | 97.01 | |
| d1nd6a_ | 342 | Prostatic acid phosphatase {Human (Homo sapiens) [ | 96.99 | |
| d1qwoa_ | 435 | Phytase (myo-inositol-hexakisphosphate-3-phosphohy | 96.8 | |
| d1ihpa_ | 438 | Phytase (myo-inositol-hexakisphosphate-3-phosphohy | 96.54 | |
| d1nt4a_ | 391 | Glucose-1-phosphatase {Escherichia coli [TaxId: 56 | 96.37 | |
| d1qfxa_ | 447 | Phytase (myo-inositol-hexakisphosphate-3-phosphohy | 95.3 |
| >d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Phosphoglycerate mutase-like superfamily: Phosphoglycerate mutase-like family: Cofactor-dependent phosphoglycerate mutase domain: Phosphoglycerate mutase species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=1.9e-37 Score=278.13 Aligned_cols=183 Identities=40% Similarity=0.627 Sum_probs=147.6
Q ss_pred CccceEEecCCCccccccccccccccCCCCCCCCCCCCCCChhhHHHHHHHHHHHHHcCCCcCEEEecCcHHHHHHHHHH
Q psy11843 129 NLHPVMLMPQGVHEQDRFSEFSNRTANSKSSRYARPEYPSSLNSVNEAEAAGVALAKAGFKFDVAHTSVLTRAQNTLKAI 208 (325)
Q Consensus 129 ~~~~i~lvRHGe~~~~~~t~~n~~~~~~~~~~~g~~d~~Lt~~G~~qa~~~~~~l~~~~~~~~~i~sSpl~Ra~qTA~~i 208 (325)
.|++|||||||| |+||.. +..+|+.|+|||+.|++||+.+|++|++.+++||.|||||+.||+|||+++
T Consensus 1 ~mtrl~LvRHGe------T~~N~~-----~~~~G~~D~pLTe~G~~QA~~~~~~L~~~~~~~d~i~sS~L~Ra~~Ta~~i 69 (247)
T d1e58a_ 1 AVTKLVLVRHGE------SQWNKE-----NRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVLKRAIHTLWNV 69 (247)
T ss_dssp CCEEEEEEECCC------BHHHHT-----TBCCTTCCCCBCHHHHHHHHHHHHHHHHTTCCCSEEEECSSHHHHHHHHHH
T ss_pred CceEEEEEECCC------Chhhhc-----CceeCCCCCCcCHHHHHHHHHHHHHHHhcCCCcccchhhHHHHHHHHHHHH
Confidence 378999999998 999874 466889999999999999999999999888999999999999999999999
Q ss_pred HHhcCCCCCCccccccchhhccCCCCCCcHHHHHHhhchhHHHhhh-ccC-ccc-----ccccccccCCcccCCCCCCCC
Q psy11843 209 LKGIGQEDLPVHKSWRLNERHYGGLTGLDKAATAAKYGEEQRVHRD-TIG-LED-----HAYYSNIVDDPRYASEPSKEE 281 (325)
Q Consensus 209 ~~~~~~~~~~i~~~~~L~E~~~G~~eG~~~~e~~~~~~~~~~~w~~-~~~-~~~-----~~~~~~~~~~~~y~~~~~~~~ 281 (325)
....+...+|+..+++|+|++||.|||++.+++.+.||+++..|.. .+. .|. ++++.. .+.+... +....
T Consensus 70 ~~~~~~~~~~i~~~~~L~E~~~G~~eG~~~~ei~~~~~~e~~~~~~~~~~~~p~~~~~~~~~~~~--~~~~~~~-~~~~~ 146 (247)
T d1e58a_ 70 LDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTKDDERYPG--HDPRYAK-LSEKE 146 (247)
T ss_dssp HHHHTCTTSCEEECGGGCCCCCGGGTTCBHHHHHHHHCHHHHHHHHHCTTCCCCCCCTTSTTCGG--GSGGGTT-CCTTT
T ss_pred HhhcccccCchheecchhhccccccCCCcHHHHHHHhHHHHHHHHhccccCCCccccccchhhhh--hhhhhcc-ccccc
Confidence 8877765688999999999999999999999999999998774432 221 111 011100 1111111 33456
Q ss_pred CCCCCCHHHHHHhHHHHHHHhhccccCCCCEEEEEecCCCccCC
Q psy11843 282 FPMFESLKLTIERTLPYWNNVIVPQYSDETCYLATVTWNKNKKV 325 (325)
Q Consensus 282 ~p~gES~~~~~~Rv~~~l~~ii~~~~~~~~~vLvVsHg~~ir~~ 325 (325)
.|+|||+.++.+|+.+++.+++......+++|||||||++||++
T Consensus 147 ~p~gEs~~~~~~Rv~~~~~~~i~~~~~~~~~ilvVtHg~~ir~l 190 (247)
T d1e58a_ 147 LPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRAL 190 (247)
T ss_dssp SCSCCCHHHHHHHHHHHHHHTHHHHHHTTCCEEEEECHHHHHHH
T ss_pred CCcchhHHHHHHHHHhhhhhhhhHhhcCCCCEEEECcHHHHHHH
Confidence 79999999999999999998775544677899999999999863
|
| >d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dkla_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nd6a_ c.60.1.2 (A:) Prostatic acid phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qwoa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1ihpa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus ficuum [TaxId: 5058]} | Back information, alignment and structure |
|---|
| >d1nt4a_ c.60.1.2 (A:) Glucose-1-phosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qfxa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|