Psyllid ID: psy11844

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-
MGSKVEYVETSQIYATNYVRNSKAVGVLWGIFTLCFALIVSVAFLTPEWIGIANKGRLGLWSSCEFDVNGFEECTGKFAEFMEISNAAFKISTVLCLVSVTLALVTIAVMLLFFFMQPTSVYMVAAWLQIISEEFPMFESLKLTIERTLPYWNNVIVPQLKEGKKILIAAHGNSLRGIVKHLDNMSDEAIMGLNLPTGIPFVYELDENLKPVVSMKFLGDEETVKKAMEAVANQGKANTRH
ccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHEEEEEEccEEcccccccccccEEEEccccccccccccccHHHHHccHHHHHHHHHHHHHHHHEEEEcccccccccccccccccccccccccccccccccccHHHHcccccccccccccHHHHcccEEEEEEccHHHHHHHHHcccccHHHHHcccccccccEEEEEcccccccccccccccHHHHHHHHHHHHHcccccccc
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEccccccccEEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHcccccccccccccHHHHHHHHHHHHHHcHHHHHHcccEEEEEEcHHHHHHHHHHHHccccccHHHccccccccEEEEEcccccEccccEEccHHHHHHHHHHHHHHHccccccc
MGSKVEYVETSQIYATNYVRNSKAVGVLWGIFTLCFALIVSVAFltpewigiankgrlglwsscefdvngfeECTGKFAEFMEISNAAFKISTVLCLVSVTLALVTIAVMLLFFFMQPTSVYMVAAWLQIISEEFPMFESLKLTIertlpywnnvivpqlKEGKKILIAAHGNSLRGIVKHLDnmsdeaimglnlptgipfvyeldenlkpvvsmkflgdEETVKKAMEAVANqgkantrh
MGSKVEYVETSQIYATNYVRNSKAVGVLWGIFTLCFALIVSVAFLTPEWIGIANKGRLGLWSSCEFDVNGFEECTGKFAEFMEISNAAFKISTVLCLVSVTLALVTIAVMLLFFFMQPTSVYMVAAWLQIISEEFPMFESLKLTIERTLPYWNNVIVPQLKEGKKILIAAHGNSLRGIVKHLDNMSDEAIMGLNLPTGIPFVYELDENLKPVVSMKFLGDEETVKKAMEAVanqgkantrh
MGSKVEYVETSQIYATNYVRNSKAVGVLWGIFTLCFALIVSVAFLTPEWIGIANKGRLGLWSSCEFDVNGFEECTGKFAEFMEISNAAFKISTVLCLVSVTLALVTIAVMLLFFFMQPTSVYMVAAWLQIISEEFPMFESLKLTIERTLPYWNNVIVPQLKEGKKILIAAHGNSLRGIVKHLDNMSDEAIMGLNLPTGIPFVYELDENLKPVVSMKFLGDEETVKKAMEAVANQGKANTRH
******YVETSQIYATNYVRNSKAVGVLWGIFTLCFALIVSVAFLTPEWIGIANKGRLGLWSSCEFDVNGFEECTGKFAEFMEISNAAFKISTVLCLVSVTLALVTIAVMLLFFFMQPTSVYMVAAWLQIISEEFPMFESLKLTIERTLPYWNNVIVPQLKEGKKILIAAHGNSLRGIVKHLDNMSDEAIMGLNLPTGIPFVYELDENLKPVVSMKFLG**********************
**********SQIYATNYVRNSKAVGVLWGIFTLCFALIVSVAFLTPEWIGIANKGRLGLWSSCEFDVNGFEECTGKFAEFMEISNAAFKISTVLCLVSVTLALVTIAVMLLFFFMQPTSVYMVAAWLQIISEEFPMFESLKLTIERTLPYWNNVIVPQLKEGKKILIAAHGNSLRGIVKHLDNMSDEAIMGLNLPTGIPFVYELDENLKPVVSMKFLGDEETVKKAMEA****G******
MGSKVEYVETSQIYATNYVRNSKAVGVLWGIFTLCFALIVSVAFLTPEWIGIANKGRLGLWSSCEFDVNGFEECTGKFAEFMEISNAAFKISTVLCLVSVTLALVTIAVMLLFFFMQPTSVYMVAAWLQIISEEFPMFESLKLTIERTLPYWNNVIVPQLKEGKKILIAAHGNSLRGIVKHLDNMSDEAIMGLNLPTGIPFVYELDENLKPVVSMKFLGDEETVKKAMEAVA*********
****VEYVETSQIYATNYVRNSKAVGVLWGIFTLCFALIVSVAFLTPEWIGIANKGRLGLWSSCEFDVNGFEECTGKFAEFMEISNAAFKISTVLCLVSVTLALVTIAVMLLFFFMQPTSVYMVAAWLQIISEEFPMFESLKLTIERTLPYWNNVIVPQLKEGKKILIAAHGNSLRGIVKHLDNMSDEAIMGLNLPTGIPFVYELDENLKPVVSMKFLGDEETVKKAMEAVANQ*******
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSKVEYVETSQIYATNYVRNSKAVGVLWGIFTLCFALIVSVAFLTPEWIGIANKGRLGLWSSCEFDVNGFEECTGKFAEFMEISNAAFKISTVLCLVSVTLALVTIAVMLLFFFMQPTSVYMVAAWLQIISEEFPMFESLKLTIERTLPYWNNVIVPQLKEGKKILIAAHGNSLRGIVKHLDNMSDEAIMGLNLPTGIPFVYELDENLKPVVSMKFLGDEETVKKAMEAVANQGKANTRH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query241 2.2.26 [Sep-21-2011]
Q3SZ62254 Phosphoglycerate mutase 1 yes N/A 0.456 0.433 0.709 4e-41
P18669254 Phosphoglycerate mutase 1 yes N/A 0.456 0.433 0.709 4e-41
Q5ZLN1254 Phosphoglycerate mutase 1 yes N/A 0.448 0.425 0.722 6e-41
P25113254 Phosphoglycerate mutase 1 yes N/A 0.448 0.425 0.712 1e-40
Q9DBJ1254 Phosphoglycerate mutase 1 yes N/A 0.448 0.425 0.712 1e-40
O70250253 Phosphoglycerate mutase 2 no N/A 0.497 0.474 0.658 1e-40
Q5RFB8254 Phosphoglycerate mutase 1 yes N/A 0.456 0.433 0.7 2e-40
Q32KV0253 Phosphoglycerate mutase 2 no N/A 0.435 0.415 0.733 7e-40
P16290253 Phosphoglycerate mutase 2 yes N/A 0.439 0.418 0.716 2e-39
P15259253 Phosphoglycerate mutase 2 no N/A 0.435 0.415 0.733 3e-39
>sp|Q3SZ62|PGAM1_BOVIN Phosphoglycerate mutase 1 OS=Bos taurus GN=PGAM1 PE=2 SV=3 Back     alignment and function desciption
 Score =  168 bits (425), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 78/110 (70%), Positives = 92/110 (83%)

Query: 129 QIISEEFPMFESLKLTIERTLPYWNNVIVPQLKEGKKILIAAHGNSLRGIVKHLDNMSDE 188
            +  ++ P  ESLK TI R LP+WN  IVPQ+KEGK++LIAAHGNSLRGIVKHL+ +S+E
Sbjct: 144 DLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEE 203

Query: 189 AIMGLNLPTGIPFVYELDENLKPVVSMKFLGDEETVKKAMEAVANQGKAN 238
           AIM LNLPTGIP VYELD+NLKP+  M+FLGDEETV+KAMEAVA QGKA 
Sbjct: 204 AIMELNLPTGIPMVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAK 253
Interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. Can also catalyze the reaction of EC 5.4.2.4 (synthase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.
Bos taurus (taxid: 9913)
EC: 5EC: .EC: 4EC: .EC: 2EC: .EC: 4
>sp|P18669|PGAM1_HUMAN Phosphoglycerate mutase 1 OS=Homo sapiens GN=PGAM1 PE=1 SV=2 Back     alignment and function description
>sp|Q5ZLN1|PGAM1_CHICK Phosphoglycerate mutase 1 OS=Gallus gallus GN=PGAM1 PE=1 SV=3 Back     alignment and function description
>sp|P25113|PGAM1_RAT Phosphoglycerate mutase 1 OS=Rattus norvegicus GN=Pgam1 PE=1 SV=4 Back     alignment and function description
>sp|Q9DBJ1|PGAM1_MOUSE Phosphoglycerate mutase 1 OS=Mus musculus GN=Pgam1 PE=1 SV=3 Back     alignment and function description
>sp|O70250|PGAM2_MOUSE Phosphoglycerate mutase 2 OS=Mus musculus GN=Pgam2 PE=1 SV=3 Back     alignment and function description
>sp|Q5RFB8|PGAM1_PONAB Phosphoglycerate mutase 1 OS=Pongo abelii GN=PGAM1 PE=2 SV=3 Back     alignment and function description
>sp|Q32KV0|PGAM2_BOVIN Phosphoglycerate mutase 2 OS=Bos taurus GN=PGAM2 PE=2 SV=1 Back     alignment and function description
>sp|P16290|PGAM2_RAT Phosphoglycerate mutase 2 OS=Rattus norvegicus GN=Pgam2 PE=2 SV=2 Back     alignment and function description
>sp|P15259|PGAM2_HUMAN Phosphoglycerate mutase 2 OS=Homo sapiens GN=PGAM2 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query241
321475241253 hypothetical protein DAPPUDRAFT_222210 [ 0.435 0.415 0.904 4e-51
224924386255 phosphoglycerate mutase [Stomoxys calcit 0.439 0.415 0.877 2e-49
195109266255 GI23192 [Drosophila mojavensis] gi|19391 0.435 0.411 0.885 3e-49
195399960255 GJ14508 [Drosophila virilis] gi|19414214 0.435 0.411 0.885 3e-49
10334685220 phosphoglycerate mutase [Drosophila mela 0.439 0.481 0.867 5e-49
195503363255 Pglym78 [Drosophila yakuba] gi|111145293 0.435 0.411 0.876 1e-48
289739687255 phosphoglycerate mutase [Glossina morsit 0.439 0.415 0.886 1e-48
1092224254 phosphoglyceromutase 0.435 0.413 0.876 1e-48
195341135255 GM12771 [Drosophila sechellia] gi|111145 0.435 0.411 0.876 1e-48
111145313255 phosphoglyceromutase [Drosophila melanog 0.435 0.411 0.876 1e-48
>gi|321475241|gb|EFX86204.1| hypothetical protein DAPPUDRAFT_222210 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  207 bits (526), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 104/105 (99%)

Query: 133 EEFPMFESLKLTIERTLPYWNNVIVPQLKEGKKILIAAHGNSLRGIVKHLDNMSDEAIMG 192
           EEFPMFESLKLTIERTLPYWN+VIVPQ+KEGK+ILIAAHGNSLRGIVKHLDNMS++AIMG
Sbjct: 148 EEFPMFESLKLTIERTLPYWNDVIVPQIKEGKRILIAAHGNSLRGIVKHLDNMSEDAIMG 207

Query: 193 LNLPTGIPFVYELDENLKPVVSMKFLGDEETVKKAMEAVANQGKA 237
           LNLPTGIPFVYELDEN+KP+ SM+FLGDEETV+KAMEAVANQGKA
Sbjct: 208 LNLPTGIPFVYELDENMKPITSMQFLGDEETVRKAMEAVANQGKA 252

Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|224924386|gb|ACN69143.1| phosphoglycerate mutase [Stomoxys calcitrans] Back     alignment and taxonomy information
>gi|195109266|ref|XP_001999208.1| GI23192 [Drosophila mojavensis] gi|193915802|gb|EDW14669.1| GI23192 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195399960|ref|XP_002058587.1| GJ14508 [Drosophila virilis] gi|194142147|gb|EDW58555.1| GJ14508 [Drosophila virilis] Back     alignment and taxonomy information
>gi|10334685|gb|AAG16725.1| phosphoglycerate mutase [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195503363|ref|XP_002098620.1| Pglym78 [Drosophila yakuba] gi|111145293|gb|ABH06862.1| phosphoglyceromutase [Drosophila yakuba] gi|194184721|gb|EDW98332.1| Pglym78 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|289739687|gb|ADD18591.1| phosphoglycerate mutase [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|1092224|prf||2023203A phosphoglyceromutase Back     alignment and taxonomy information
>gi|195341135|ref|XP_002037167.1| GM12771 [Drosophila sechellia] gi|111145307|gb|ABH06869.1| phosphoglyceromutase [Drosophila melanogaster] gi|111145327|gb|ABH06879.1| phosphoglyceromutase [Drosophila simulans] gi|111145329|gb|ABH06880.1| phosphoglyceromutase [Drosophila simulans] gi|111145331|gb|ABH06881.1| phosphoglyceromutase [Drosophila simulans] gi|111145333|gb|ABH06882.1| phosphoglyceromutase [Drosophila simulans] gi|111145335|gb|ABH06883.1| phosphoglyceromutase [Drosophila simulans] gi|111145337|gb|ABH06884.1| phosphoglyceromutase [Drosophila simulans] gi|111145339|gb|ABH06885.1| phosphoglyceromutase [Drosophila simulans] gi|111145341|gb|ABH06886.1| phosphoglyceromutase [Drosophila simulans] gi|111145343|gb|ABH06887.1| phosphoglyceromutase [Drosophila simulans] gi|111145345|gb|ABH06888.1| phosphoglyceromutase [Drosophila simulans] gi|111145349|gb|ABH06890.1| phosphoglyceromutase [Drosophila simulans] gi|194131283|gb|EDW53326.1| GM12771 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|111145313|gb|ABH06872.1| phosphoglyceromutase [Drosophila melanogaster] gi|111145321|gb|ABH06876.1| phosphoglyceromutase [Drosophila melanogaster] gi|111145323|gb|ABH06877.1| phosphoglyceromutase [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query241
FB|FBgn0014869255 Pglym78 "Phosphoglyceromutase" 0.435 0.411 0.876 3e-46
FB|FBgn0011270309 Pglym87 "Pglym87" [Drosophila 0.452 0.352 0.770 6.6e-42
UNIPROTKB|Q3SZ62254 PGAM1 "Phosphoglycerate mutase 0.460 0.437 0.702 2.6e-38
UNIPROTKB|E2RT65254 PGAM1 "Uncharacterized protein 0.460 0.437 0.702 2.6e-38
UNIPROTKB|P18669254 PGAM1 "Phosphoglycerate mutase 0.460 0.437 0.702 2.6e-38
UNIPROTKB|F1S8Y5258 LOC100524527 "Uncharacterized 0.460 0.430 0.702 2.6e-38
ZFIN|ZDB-GENE-030131-1827254 pgam1a "phosphoglycerate mutas 0.448 0.425 0.722 2.6e-38
ZFIN|ZDB-GENE-030131-5376254 pgam1b "phosphoglycerate mutas 0.448 0.425 0.731 2.6e-38
UNIPROTKB|F1NHM9210 PGAM1 "Phosphoglycerate mutase 0.456 0.523 0.709 3.4e-38
UNIPROTKB|F1NQ41208 PGAM1 "Phosphoglycerate mutase 0.456 0.528 0.709 3.4e-38
FB|FBgn0014869 Pglym78 "Phosphoglyceromutase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 485 (175.8 bits), Expect = 3.0e-46, P = 3.0e-46
 Identities = 92/105 (87%), Positives = 101/105 (96%)

Query:   133 EEFPMFESLKLTIERTLPYWNNVIVPQLKEGKKILIAAHGNSLRGIVKHLDNMSDEAIMG 192
             EEFP FESLKLTIERTLPYWN+VI+PQ+KEGK+ILIAAHGNSLRGIVKHLDN+S++AIM 
Sbjct:   150 EEFPQFESLKLTIERTLPYWNDVIIPQMKEGKRILIAAHGNSLRGIVKHLDNLSEDAIMA 209

Query:   193 LNLPTGIPFVYELDENLKPVVSMKFLGDEETVKKAMEAVANQGKA 237
             LNLPTGIPFVYELDEN KPVVSM+FLGDEETVKKA+EAVA QGKA
Sbjct:   210 LNLPTGIPFVYELDENFKPVVSMQFLGDEETVKKAIEAVAAQGKA 254
GO:0004619 "phosphoglycerate mutase activity" evidence=ISS;NAS
GO:0031430 "M band" evidence=IDA
GO:0030018 "Z disc" evidence=IDA
GO:0006096 "glycolysis" evidence=IEA
FB|FBgn0011270 Pglym87 "Pglym87" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZ62 PGAM1 "Phosphoglycerate mutase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RT65 PGAM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P18669 PGAM1 "Phosphoglycerate mutase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S8Y5 LOC100524527 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-1827 pgam1a "phosphoglycerate mutase 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5376 pgam1b "phosphoglycerate mutase 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHM9 PGAM1 "Phosphoglycerate mutase 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NQ41 PGAM1 "Phosphoglycerate mutase 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B7J2L3GPMA_BORBZ5, ., 4, ., 2, ., 10.53700.44390.4314yesN/A
B5RQ00GPMA_BORRA5, ., 4, ., 2, ., 10.55170.47710.46yesN/A
Q8MKE8PGAM4_PANTR5, ., 4, ., 2, ., 40.67270.45640.4330yesN/A
O51602GPMA_BORBU5, ., 4, ., 2, ., 10.53700.44390.4314yesN/A
A4SDM0GPMA_PROVI5, ., 4, ., 2, ., 10.54160.48130.4696yesN/A
P16290PGAM2_RAT5, ., 4, ., 2, ., 40.71690.43980.4189yesN/A
A7MIX7GPMA_CROS85, ., 4, ., 2, ., 10.55040.44810.432yesN/A
B3EN99GPMA_CHLPB5, ., 4, ., 2, ., 10.57400.44390.4331yesN/A
P18669PGAM1_HUMAN5, ., 4, ., 2, ., 40.70900.45640.4330yesN/A
A8AJ40GPMA_CITK85, ., 4, ., 2, ., 10.55960.44810.432yesN/A
C0PWW0GPMA_SALPC5, ., 4, ., 2, ., 10.53210.44810.432yesN/A
B4RZM6GPMA_ALTMD5, ., 4, ., 2, ., 10.63100.42320.4112yesN/A
B3QPN8GPMA_CHLP85, ., 4, ., 2, ., 10.57020.48540.4736yesN/A
Q54NE6PGAM_DICDI5, ., 4, ., 2, ., 40.54120.44810.4337yesN/A
C0QV47GPMA_BRAHW5, ., 4, ., 2, ., 10.63460.42730.4153yesN/A
A1BE55GPMA_CHLPD5, ., 4, ., 2, ., 10.59610.42730.4170yesN/A
Q3AU60GPMA_CHLCH5, ., 4, ., 2, ., 10.52210.46470.4534yesN/A
P25113PGAM1_RAT5, ., 4, ., 2, ., 40.71290.44810.4251yesN/A
B2RHB7GPMA_PORG35, ., 4, ., 2, ., 10.53330.49370.4798yesN/A
B4TQR7GPMA_SALSV5, ., 4, ., 2, ., 10.53210.44810.432yesN/A
B2VBS6GPMA_ERWT95, ., 4, ., 2, ., 10.57400.44390.428yesN/A
Q57RI5GPMA_SALCH5, ., 4, ., 2, ., 10.53210.44810.432yesN/A
A6L9K8GPMA_PARD85, ., 4, ., 2, ., 10.54160.49370.4798yesN/A
B1GZZ1GPMA_UNCTG5, ., 4, ., 2, ., 10.58920.46050.4457yesN/A
Q82TU0GPMA2_NITEU5, ., 4, ., 2, ., 10.58490.43560.4216yesN/A
B8GFF8GPMA_METPE5, ., 4, ., 2, ., 10.54360.42320.4096yesN/A
B5FP39GPMA_SALDC5, ., 4, ., 2, ., 10.53210.44810.432yesN/A
B3EFK8GPMA_CHLL25, ., 4, ., 2, ., 10.58650.42730.4170yesN/A
Q32IH0GPMA_SHIDS5, ., 4, ., 2, ., 10.54120.44810.432yesN/A
Q5RFB8PGAM1_PONAB5, ., 4, ., 2, ., 40.70.45640.4330yesN/A
A1R083GPMA_BORT95, ., 4, ., 2, ., 10.57940.43980.4274yesN/A
B4SZH5GPMA_SALNS5, ., 4, ., 2, ., 10.53210.44810.432yesN/A
B2S101GPMA_BORHD5, ., 4, ., 2, ., 10.57000.43980.4274yesN/A
B3QVL0GPMA_CHLT35, ., 4, ., 2, ., 10.60570.42730.4136yesN/A
B5RMK4GPMA_BORDL5, ., 4, ., 2, ., 10.55170.47710.46yesN/A
Q5ZLN1PGAM1_CHICK5, ., 4, ., 2, ., 40.72220.44810.4251yesN/A
Q8R7C8GPMA_THETN5, ., 4, ., 2, ., 10.58870.43980.4257yesN/A
Q3SZ62PGAM1_BOVIN5, ., 4, ., 2, ., 40.70900.45640.4330yesN/A
C5BJ25GPMA_TERTT5, ., 4, ., 2, ., 10.57280.42320.4112yesN/A
Q9DBJ1PGAM1_MOUSE5, ., 4, ., 2, ., 40.71290.44810.4251yesN/A
B2KBU4GPMA_ELUMP5, ., 4, ., 2, ., 10.50830.49370.4798yesN/A
B4SEI0GPMA_PELPB5, ., 4, ., 2, ., 10.54540.45220.4377yesN/A
Q7MXP1GPMA_PORGI5, ., 4, ., 2, ., 10.53330.49370.4798yesN/A
Q0SMJ5GPMA_BORAP5, ., 4, ., 2, ., 10.56070.43980.4274yesN/A
Q8N0Y7PGAM4_HUMAN5, ., 4, ., 2, ., 40.66360.45640.4330yesN/A
Q2FTH0GPMA_METHJ5, ., 4, ., 2, ., 10.63300.44810.4354yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer5.4.2.10.824
3rd Layer5.4.20.766

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query241
PRK14115247 PRK14115, gpmA, phosphoglyceromutase; Provisional 2e-63
TIGR01258245 TIGR01258, pgm_1, phosphoglycerate mutase, BPG-dep 6e-58
PTZ00123236 PTZ00123, PTZ00123, phosphoglycerate mutase like-p 2e-55
PRK14120249 PRK14120, gpmA, phosphoglyceromutase; Provisional 7e-46
COG0588230 COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohyd 2e-43
PRK14118227 PRK14118, gpmA, phosphoglyceromutase; Provisional 1e-28
PRK14119228 PRK14119, gpmA, phosphoglyceromutase; Provisional 7e-27
PRK01112228 PRK01112, PRK01112, phosphoglyceromutase; Provisio 2e-25
PRK14116228 PRK14116, gpmA, phosphoglyceromutase; Provisional 6e-25
PRK14117230 PRK14117, gpmA, phosphoglyceromutase; Provisional 1e-24
pfam10242181 pfam10242, L_HGMIC_fpl, Lipoma HMGIC fusion partne 6e-23
PRK01295206 PRK01295, PRK01295, phosphoglyceromutase; Provisio 3e-21
cd07040153 cd07040, HP, Histidine phosphatase domain found in 1e-17
cd07067153 cd07067, HP_PGM_like, Histidine phosphatase domain 7e-17
smart00855158 smart00855, PGAM, Phosphoglycerate mutase family 5e-06
pfam00300154 pfam00300, His_Phos_1, Histidine phosphatase super 0.004
>gnl|CDD|184516 PRK14115, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information 
 Score =  197 bits (504), Expect = 2e-63
 Identities = 69/106 (65%), Positives = 82/106 (77%), Gaps = 1/106 (0%)

Query: 133 EEFPMFESLKLTIERTLPYWNNVIVPQLKEGKKILIAAHGNSLRGIVKHLDNMSDEAIMG 192
           EE P+ ESLK TI R LPYWN  I PQLK GK++LIAAHGNSLR +VK+LDN+SDE I+ 
Sbjct: 143 EELPLTESLKDTIARVLPYWNETIAPQLKSGKRVLIAAHGNSLRALVKYLDNISDEEILE 202

Query: 193 LNLPTGIPFVYELDENLKPVVSMKFLGDEETVKKAMEAVANQGKAN 238
           LN+PTG+P VYELDENLKP +   +LGD + +  A  AVANQGKA 
Sbjct: 203 LNIPTGVPLVYELDENLKP-IKHYYLGDADEIAAAAAAVANQGKAK 247

Length = 247
>gnl|CDD|213596 TIGR01258, pgm_1, phosphoglycerate mutase, BPG-dependent, family 1 Back     alignment and domain information
>gnl|CDD|240280 PTZ00123, PTZ00123, phosphoglycerate mutase like-protein; Provisional Back     alignment and domain information
>gnl|CDD|184519 PRK14120, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|223661 COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|172608 PRK14118, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|184518 PRK14119, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|234902 PRK01112, PRK01112, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|172606 PRK14116, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|184517 PRK14117, gpmA, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|220647 pfam10242, L_HGMIC_fpl, Lipoma HMGIC fusion partner-like protein Back     alignment and domain information
>gnl|CDD|167205 PRK01295, PRK01295, phosphoglyceromutase; Provisional Back     alignment and domain information
>gnl|CDD|132716 cd07040, HP, Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>gnl|CDD|132718 cd07067, HP_PGM_like, Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>gnl|CDD|214859 smart00855, PGAM, Phosphoglycerate mutase family Back     alignment and domain information
>gnl|CDD|215845 pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 241
KOG4026|consensus207 100.0
PF10242181 L_HGMIC_fpl: Lipoma HMGIC fusion partner-like prot 99.93
TIGR01258245 pgm_1 phosphoglycerate mutase, BPG-dependent, fami 99.74
PRK14115247 gpmA phosphoglyceromutase; Provisional 99.73
PTZ00123236 phosphoglycerate mutase like-protein; Provisional 99.71
PRK14120249 gpmA phosphoglyceromutase; Provisional 99.69
PRK13463203 phosphatase PhoE; Provisional 99.65
PRK14117230 gpmA phosphoglyceromutase; Provisional 99.61
PRK14116228 gpmA phosphoglyceromutase; Provisional 99.61
PRK15004199 alpha-ribazole phosphatase; Provisional 99.61
PRK01112228 phosphoglyceromutase; Provisional 99.6
PRK14119228 gpmA phosphoglyceromutase; Provisional 99.6
COG0588230 GpmA Phosphoglycerate mutase 1 [Carbohydrate trans 99.58
PRK03482215 phosphoglycerate mutase; Provisional 99.57
PRK14118227 gpmA phosphoglyceromutase; Provisional 99.57
PRK13462203 acid phosphatase; Provisional 99.55
TIGR03848204 MSMEG_4193 probable phosphomutase, MSMEG_4193 fami 99.54
PRK07238372 bifunctional RNase H/acid phosphatase; Provisional 99.54
PRK01295206 phosphoglyceromutase; Provisional 99.48
COG0406208 phoE Broad specificity phosphatase PhoE and relate 99.46
TIGR03162177 ribazole_cobC alpha-ribazole phosphatase. Members 99.44
KOG0235|consensus214 99.31
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.19
PTZ00122299 phosphoglycerate mutase; Provisional 99.19
PF00300158 His_Phos_1: Histidine phosphatase superfamily (bra 98.54
KOG0234|consensus438 98.53
smart00855155 PGAM Phosphoglycerate mutase family. Phosphoglycer 98.47
cd07067153 HP_PGM_like Histidine phosphatase domain found in 98.42
cd07040153 HP Histidine phosphatase domain found in a functio 98.08
PF00822166 PMP22_Claudin: PMP-22/EMP/MP20/Claudin family; Int 97.72
KOG4609|consensus284 97.52
KOG3734|consensus272 96.25
PF07062211 Clc-like: Clc-like; InterPro: IPR010761 Clc protei 95.02
PF13903172 Claudin_2: PMP-22/EMP/MP20/Claudin tight junction 94.18
PRK06193206 hypothetical protein; Provisional 92.32
TIGR00249152 sixA phosphohistidine phosphatase SixA. 92.11
PF06687212 SUR7: SUR7/PalI family; InterPro: IPR009571 This f 85.24
PF06653163 Claudin_3: Tight junction protein, Claudin-like; I 82.97
PRK15416201 lipopolysaccharide core heptose(II)-phosphate phos 81.56
>KOG4026|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.6e-37  Score=262.92  Aligned_cols=167  Identities=29%  Similarity=0.541  Sum_probs=145.5

Q ss_pred             hhhccccchhHHHHHHHHHHHHHHHhhhccceeeccC---CcceeecccccccccCC-ccccccccCcceeccchhhHHH
Q psy11844         17 NYVRNSKAVGVLWGIFTLCFALIVSVAFLTPEWIGIA---NKGRLGLWSSCEFDVNG-FEECTGKFAEFMEISNAAFKIS   92 (241)
Q Consensus        17 ~y~rn~r~igvlW~~~t~~~ai~~~v~f~~p~Wi~~~---~~~~fgl~~~C~~~~~~-~~~C~g~~~~f~~ips~a~~~~   92 (241)
                      +|+|||||+||+|++||||+|++++|+|||||||||+   ++||||||+||.+++.. ..+|+|++++|++|||.+||++
T Consensus         1 ~y~rn~~~~gviW~l~t~c~a~l~~v~fi~P~Wig~~~~~~~g~fGl~~~C~~~~~~~~~~~~~~~~~~~~ips~~~~~a   80 (207)
T KOG4026|consen    1 MYYRNSRAVGVIWALCTICFAVLFMVAFIQPYWIGDSVNGKPGSFGLFTYCVGPVLPGSLECRGRLASFSSIPSNEFKLA   80 (207)
T ss_pred             CeeehhhHHHHHHHHHHHHHHHHHHHHhccceeccCCcCCCCccccceeeccCCCCCCcccccCCccccccCCcHHHHHH
Confidence            6999999999999999999999999999999999996   57899999999988653 3478899999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhcccCCHHHHHHHhhhccCCCCCCCCHHHHHHhHHH-HHHhhccccccCC---CeEEE
Q psy11844         93 TVLCLVSVTLALVTIAVMLLFFFMQPTSVYMVAAWLQIISEEFPMFESLKLTIERTLP-YWNNVIVPQLKEG---KKILI  168 (241)
Q Consensus        93 ~~~~~~~~~l~~~~~~~~~l~~~i~~r~Pe~~~aW~dp~a~~~pgGESl~~~~~Rv~~-~~~~~i~~~~~~g---~~VLV  168 (241)
                      ++||++|+.|++++++++.+..+|+++...+.++|++..++....-.++      ++| +|++..++++...   +-.+ 
T Consensus        81 ~f~vlla~~Lill~i~~~~l~~~c~~~si~~~cg~~q~~a~l~milGc~------lyP~GW~s~~vr~~CG~~a~ky~l-  153 (207)
T KOG4026|consen   81 AFFVLLAFVLILLLIVFLALLGCCRSKSIFNMCGWMQGIAGLCMILGCA------LYPDGWDSPEVRRMCGAKAGKYYL-  153 (207)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhchhhhhhhhHHHHHHHHHHHHHHHH------hcCCccCCHHHHHHhccccCCccC-
Confidence            9999999999999999999999999999999999999776533333344      788 8988778776543   3455 


Q ss_pred             EecchhHHHHHHHhhCCChhhhh
Q psy11844        169 AAHGNSLRGIVKHLDNMSDEAIM  191 (241)
Q Consensus       169 VsHGgvIrall~~llg~~~e~~~  191 (241)
                       +|+.+-++.++.+.|.-+..+.
T Consensus       154 -G~CsIgWaY~lAIig~~daliL  175 (207)
T KOG4026|consen  154 -GDCSIGWAYYLAIIGILDALIL  175 (207)
T ss_pred             -ccccccHHHHHHHHHHHHHHHH
Confidence             9999999999999988777654

>PF10242 L_HGMIC_fpl: Lipoma HMGIC fusion partner-like protein; InterPro: IPR019372 This is a group of proteins expressed from a series of genes referred to as Lipoma HGMIC fusion partner-like Back     alignment and domain information
>TIGR01258 pgm_1 phosphoglycerate mutase, BPG-dependent, family 1 Back     alignment and domain information
>PRK14115 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PTZ00123 phosphoglycerate mutase like-protein; Provisional Back     alignment and domain information
>PRK14120 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK13463 phosphatase PhoE; Provisional Back     alignment and domain information
>PRK14117 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14116 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK15004 alpha-ribazole phosphatase; Provisional Back     alignment and domain information
>PRK01112 phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14119 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>COG0588 GpmA Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK03482 phosphoglycerate mutase; Provisional Back     alignment and domain information
>PRK14118 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK13462 acid phosphatase; Provisional Back     alignment and domain information
>TIGR03848 MSMEG_4193 probable phosphomutase, MSMEG_4193 family Back     alignment and domain information
>PRK07238 bifunctional RNase H/acid phosphatase; Provisional Back     alignment and domain information
>PRK01295 phosphoglyceromutase; Provisional Back     alignment and domain information
>COG0406 phoE Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] Back     alignment and domain information
>TIGR03162 ribazole_cobC alpha-ribazole phosphatase Back     alignment and domain information
>KOG0235|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PTZ00122 phosphoglycerate mutase; Provisional Back     alignment and domain information
>PF00300 His_Phos_1: Histidine phosphatase superfamily (branch 1); InterPro: IPR013078 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle Back     alignment and domain information
>KOG0234|consensus Back     alignment and domain information
>smart00855 PGAM Phosphoglycerate mutase family Back     alignment and domain information
>cd07067 HP_PGM_like Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>cd07040 HP Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>PF00822 PMP22_Claudin: PMP-22/EMP/MP20/Claudin family; InterPro: IPR004031 Several vertebrate small integral membrane glycoproteins are evolutionary related [, , ], including eye lens specific membrane protein 20 (MP20 or MP19); epithelial membrane protein-1 (EMP-1), which is also known as tumor-associated membrane protein (TMP) or as squamous cell-specific protein Cl-20; epithelial membrane protein-2 (EMP-2), which is also known as XMP; epithelial membrane protein-3 (EMP-3), also known as YMP; and peripheral myelin protein 22 (PMP-22), which is expressed in many tissues but mainly by Schwann cells as a component of myelin of the peripheral nervous system (PNS) Back     alignment and domain information
>KOG4609|consensus Back     alignment and domain information
>KOG3734|consensus Back     alignment and domain information
>PF07062 Clc-like: Clc-like; InterPro: IPR010761 Clc proteins are a nine-member gene family of chloride channels that have diverse roles in the plasma membrane and in intracellular organelles, especially membrane excitability and the maintenance of osmotic balance [, ] Back     alignment and domain information
>PF13903 Claudin_2: PMP-22/EMP/MP20/Claudin tight junction Back     alignment and domain information
>PRK06193 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00249 sixA phosphohistidine phosphatase SixA Back     alignment and domain information
>PF06687 SUR7: SUR7/PalI family; InterPro: IPR009571 This family consists of several fungal-specific SUR7 proteins Back     alignment and domain information
>PF06653 Claudin_3: Tight junction protein, Claudin-like; InterPro: IPR009545 This family consists of several Caenorhabditis elegans specific proteins of unknown function Back     alignment and domain information
>PRK15416 lipopolysaccharide core heptose(II)-phosphate phosphatase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query241
1yfk_A262 Crystal Structure Of Human B Type Phosphoglycerate 4e-42
1xq9_A258 Structure Of Phosphoglycerate Mutase From Plasmodiu 3e-30
1e58_A249 E.Coli Cofactor-Dependent Phosphoglycerate Mutase L 3e-30
1e59_A249 E.Coli Cofactor-Dependent Phosphoglycerate Mutase C 3e-30
3kkk_A258 Y92c Catalytic Residue Mutant Of Phosphoglycerate M 4e-30
4emb_A274 Crystal Structure Of A Phosphoglycerate Mutase Gpma 1e-29
1t8p_A267 Crystal Structure Of Human Erythrocyte 2,3- Bisphos 5e-28
2hhj_A267 Human Bisphosphoglycerate Mutase Complexed With 2,3 5e-28
3fdz_B257 Crystal Structure Of Phosphoglyceromutase From Burk 2e-26
3ezn_A257 Crystal Structure Of Phosphoglyceromutase From Burk 2e-26
3lnt_A250 Crystal Structure Of Phosphoglyceromutase From Burk 2e-26
4pgm_A246 Saccharomyces Cerevisiae Phosphoglycerate Mutase Le 5e-25
1qhf_A240 Yeast Phosphoglycerate Mutase-3pg Complex Structure 6e-24
4eo9_A268 Crystal Structure Of A Phosphoglycerate Mutase Gpm1 3e-23
3d8h_A267 Crystal Structure Of Phosphoglycerate Mutase From C 1e-21
1rii_A265 Crystal Structure Of Phosphoglycerate Mutase From M 3e-21
3pgm_A244 The Structure Of Yeast Phosphoglycerate Mutase At 0 3e-20
1fzt_A211 Solution Structure And Dynamics Of An Open B-Sheet, 6e-16
>pdb|1YFK|A Chain A, Crystal Structure Of Human B Type Phosphoglycerate Mutase Length = 262 Back     alignment and structure 
Iteration: 1

 Score =  167 bits (424), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 78/110 (70%), Positives = 92/110 (83%)
Query: 129 QIISEEFPMFESLKLTIERTLPYWNNVIVPQLKEGKKILIAAHGNSLRGIVKHLDNMSDE 188
            +  ++ P  ESLK TI R LP+WN  IVPQ+KEGK++LIAAHGNSLRGIVKHL+ +S+E
Sbjct: 144 DLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEE 203
Query: 189 AIMGLNLPTGIPFVYELDENLKPVVSMKFLGDEETVKKAMEAVANQGKAN 238
           AIM LNLPTGIP VYELD+NLKP+  M+FLGDEETV+KAMEAVA QGKA 
Sbjct: 204 AIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAK 253
>pdb|1XQ9|A Chain A, Structure Of Phosphoglycerate Mutase From Plasmodium Falciparum At 2.6 Resolution Length = 258 Back     alignment and structure
>pdb|1E58|A Chain A, E.Coli Cofactor-Dependent Phosphoglycerate Mutase Length = 249 Back     alignment and structure
>pdb|1E59|A Chain A, E.Coli Cofactor-Dependent Phosphoglycerate Mutase Complexed With Vanadate Length = 249 Back     alignment and structure
>pdb|3KKK|A Chain A, Y92c Catalytic Residue Mutant Of Phosphoglycerate Mutase From Plasmodium Falciparum Length = 258 Back     alignment and structure
>pdb|4EMB|A Chain A, Crystal Structure Of A Phosphoglycerate Mutase Gpma From Borrelia Burgdorferi B31 Length = 274 Back     alignment and structure
>pdb|1T8P|A Chain A, Crystal Structure Of Human Erythrocyte 2,3- Bisphosphoglycerate Mutase Length = 267 Back     alignment and structure
>pdb|2HHJ|A Chain A, Human Bisphosphoglycerate Mutase Complexed With 2,3- Bisphosphoglycerate (15 Days) Length = 267 Back     alignment and structure
>pdb|3FDZ|B Chain B, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b With Bound 2,3-Diphosphoglyceric Acid And 3- Phosphoglyceric Acid Length = 257 Back     alignment and structure
>pdb|3EZN|A Chain A, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b Length = 257 Back     alignment and structure
>pdb|3LNT|A Chain A, Crystal Structure Of Phosphoglyceromutase From Burkholderia Pseudomallei 1710b With Bound Malonic Acid Length = 250 Back     alignment and structure
>pdb|4PGM|A Chain A, Saccharomyces Cerevisiae Phosphoglycerate Mutase Length = 246 Back     alignment and structure
>pdb|1QHF|A Chain A, Yeast Phosphoglycerate Mutase-3pg Complex Structure To 1.7 A Length = 240 Back     alignment and structure
>pdb|4EO9|A Chain A, Crystal Structure Of A Phosphoglycerate Mutase Gpm1 From Mycobacterium Leprae Length = 268 Back     alignment and structure
>pdb|3D8H|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From Cryptosporidium Parvum, Cgd7_4270 Length = 267 Back     alignment and structure
>pdb|1RII|A Chain A, Crystal Structure Of Phosphoglycerate Mutase From M. Tuberculosis Length = 265 Back     alignment and structure
>pdb|3PGM|A Chain A, The Structure Of Yeast Phosphoglycerate Mutase At 0.28 Nm Resolution Length = 244 Back     alignment and structure
>pdb|1FZT|A Chain A, Solution Structure And Dynamics Of An Open B-Sheet, Glycolytic Enzyme-Monomeric 23.7 Kda Phosphoglycerate Mutase From Schizosaccharomyces Pombe Length = 211 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query241
2hhj_A267 Bisphosphoglycerate mutase; isomerase; HET: NEP DG 1e-70
1yfk_A262 Phosphoglycerate mutase 1; alpha/beta, isomerase, 5e-70
1rii_A265 2,3-bisphosphoglycerate-dependent phosphoglycerat; 6e-69
1e58_A249 Phosphoglycerate mutase; phosphohistidine, glycoly 7e-68
3d8h_A267 Glycolytic phosphoglycerate mutase; structural gen 1e-67
3gp3_A257 2,3-bisphosphoglycerate-dependent phosphoglycerat; 1e-67
4emb_A274 2,3-bisphosphoglycerate-dependent phosphoglycerat; 2e-67
3kkk_A258 Phosphoglycerate mutase; PGAM, glycolysis, malaria 5e-67
4eo9_A268 2,3-bisphosphoglycerate-dependent phosphoglycerat; 1e-62
1qhf_A240 Protein (phosphoglycerate mutase); transferase (ph 1e-61
1fzt_A211 Phosphoglycerate mutase; open B-sheet-helices, iso 1e-51
3dcy_A275 Regulator protein; OMIM 610775, C12ORF5, tigar, TP 4e-40
3r7a_A237 Phosphoglycerate mutase, putative; structural geno 2e-23
3mbk_A264 Ubiquitin-associated and SH3 domain-containing PR; 1e-20
3f3k_A265 Uncharacterized protein YKR043C; structural genomi 3e-20
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 1e-09
2a6p_A208 Possible phosphoglycerate mutase GPM2; predicted p 2e-09
1v37_A177 Phosphoglycerate mutase; riken structu genomics/pr 1e-08
3c7t_A263 Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph 4e-08
3d4i_A273 STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai 5e-08
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 8e-08
1h2e_A207 Phosphatase, YHFR; hydrolase, broad specificity ph 1e-05
3e9c_A265 ZGC:56074; histidine phosphatase, hydrolase; 2.00A 9e-05
>2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A Length = 267 Back     alignment and structure
 Score =  216 bits (553), Expect = 1e-70
 Identities = 54/112 (48%), Positives = 77/112 (68%)

Query: 126 AWLQIISEEFPMFESLKLTIERTLPYWNNVIVPQLKEGKKILIAAHGNSLRGIVKHLDNM 185
               +  ++ P  ESLK  +ER LPYWN  I P++  GK ILI+AHGNS R ++KHL+ +
Sbjct: 143 KVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGI 202

Query: 186 SDEAIMGLNLPTGIPFVYELDENLKPVVSMKFLGDEETVKKAMEAVANQGKA 237
           SDE I+ + LPTG+P + ELDENL+ V   +FLGD+E ++ A++ V +QGK 
Sbjct: 203 SDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKV 254
>1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* Length = 262 Back     alignment and structure
>1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 Length = 265 Back     alignment and structure
>1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* Length = 249 Back     alignment and structure
>3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} Length = 267 Back     alignment and structure
>3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A Length = 257 Back     alignment and structure
>4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} Length = 274 Back     alignment and structure
>3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A Length = 258 Back     alignment and structure
>4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} Length = 268 Back     alignment and structure
>1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* Length = 240 Back     alignment and structure
>1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 Length = 211 Back     alignment and structure
>3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Length = 275 Back     alignment and structure
>3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} Length = 237 Back     alignment and structure
>3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A Length = 264 Back     alignment and structure
>3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* Length = 265 Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Length = 520 Back     alignment and structure
>2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} Length = 208 Back     alignment and structure
>1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Length = 177 Back     alignment and structure
>3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Length = 263 Back     alignment and structure
>3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Length = 273 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Length = 469 Back     alignment and structure
>1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Length = 207 Back     alignment and structure
>3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A Length = 265 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query241
3kkk_A258 Phosphoglycerate mutase; PGAM, glycolysis, malaria 99.75
4emb_A274 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.74
3gp3_A257 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.74
2hhj_A267 Bisphosphoglycerate mutase; isomerase; HET: NEP DG 99.73
3d8h_A267 Glycolytic phosphoglycerate mutase; structural gen 99.71
1e58_A249 Phosphoglycerate mutase; phosphohistidine, glycoly 99.71
1yfk_A262 Phosphoglycerate mutase 1; alpha/beta, isomerase, 99.69
1rii_A265 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.69
1h2e_A207 Phosphatase, YHFR; hydrolase, broad specificity ph 99.61
4eo9_A268 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.59
1fzt_A211 Phosphoglycerate mutase; open B-sheet-helices, iso 99.55
2a6p_A208 Possible phosphoglycerate mutase GPM2; predicted p 99.51
1qhf_A240 Protein (phosphoglycerate mutase); transferase (ph 99.47
3r7a_A237 Phosphoglycerate mutase, putative; structural geno 99.46
3mxo_A202 Serine/threonine-protein phosphatase PGAM5, mitoc; 99.45
3hjg_A213 Putative alpha-ribazole-5'-phosphate phosphatase C 99.45
3eoz_A214 Putative phosphoglycerate mutase; PGAM, malaria, s 99.44
2qni_A219 AGR_C_517P, uncharacterized protein ATU0299; MCSG, 99.35
3dcy_A275 Regulator protein; OMIM 610775, C12ORF5, tigar, TP 99.29
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 99.2
3e9c_A265 ZGC:56074; histidine phosphatase, hydrolase; 2.00A 99.18
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 99.16
3d4i_A273 STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai 99.15
1v37_A177 Phosphoglycerate mutase; riken structu genomics/pr 99.13
3mbk_A264 Ubiquitin-associated and SH3 domain-containing PR; 99.12
3c7t_A263 Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph 99.08
1ujc_A161 Phosphohistidine phosphatase SIXA; alpha-beta fold 98.82
3f3k_A265 Uncharacterized protein YKR043C; structural genomi 98.82
2rfl_A173 Putative phosphohistidine phosphatase SIXA; alpha- 97.83
3fjy_A364 Probable MUTT1 protein; dimer, protein structure i 97.23
3f2i_A172 ALR0221 protein; alpha-beta protein, structural ge 93.38
>3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A Back     alignment and structure
Probab=99.75  E-value=1.4e-18  Score=151.38  Aligned_cols=104  Identities=57%  Similarity=0.974  Sum_probs=76.4

Q ss_pred             CCCCCCCHHHHHHhHHHHHHhhccccccCCCeEEEEecchhHHHHHHHhhCCChhhhhcccCCCcccEEEEEcCCCCeee
Q psy11844        134 EFPMFESLKLTIERTLPYWNNVIVPQLKEGKKILIAAHGNSLRGIVKHLDNMSDEAIMGLNLPTGIPFVYELDENLKPVV  213 (241)
Q Consensus       134 ~~pgGESl~~~~~Rv~~~~~~~i~~~~~~g~~VLVVsHGgvIrall~~llg~~~e~~~~~~i~n~s~s~ie~~~~~~~l~  213 (241)
                      .+|+|||+.++.+|+.+++++++.+...++++|||||||++|+++++++++++.+.++++.++||+++++++++++..+.
T Consensus       155 ~~p~gEs~~~~~~Rv~~~l~~l~~~~~~~~~~vlvVsHg~~i~~l~~~l~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~  234 (258)
T 3kkk_A          155 ALPFTECLKDTVERVLPFWFDHIAPDILANKKVMVAAHGNSLRGLVKHLDNLSEADVLELNIPTGVPLVYELDENLKPIK  234 (258)
T ss_dssp             GSCSCCCHHHHHHHHHHHHHHTHHHHHHTTCCEEEEECHHHHHHHHHHHTTCCHHHHHHCCCCTTCCEEEEECTTCCEEE
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHhhhccCCCEEEEEcCHHHHHHHHHHHhCCCHHHHhhccCCCCceEEEEECCCCceee
Confidence            57899999999999999999955432247889999999999999999999999999999999999999999998878777


Q ss_pred             eecccCCHHHHHHHHHHHhcccccc
Q psy11844        214 SMKFLGDEETVKKAMEAVANQGKAN  238 (241)
Q Consensus       214 ~~~~~~d~~~l~~~~~~~~~~~~~~  238 (241)
                      . .++||++||++++.++..+|+++
T Consensus       235 ~-~~~~d~~hl~~~~~~~~~~~~~~  258 (258)
T 3kkk_A          235 H-YYLLDSEELKKKMDEVANQGKAK  258 (258)
T ss_dssp             E-EECC-------------------
T ss_pred             e-cccCCHHHHHhhhhHHHhhcccC
Confidence            6 59999999999999999999864
>4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} Back     alignment and structure
>3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} SCOP: c.60.1.1 PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A Back     alignment and structure
>2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A Back     alignment and structure
>3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} Back     alignment and structure
>1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* Back     alignment and structure
>1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* Back     alignment and structure
>1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 Back     alignment and structure
>1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Back     alignment and structure
>4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} Back     alignment and structure
>1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 Back     alignment and structure
>2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* Back     alignment and structure
>3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} Back     alignment and structure
>3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A Back     alignment and structure
>3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} Back     alignment and structure
>3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} Back     alignment and structure
>2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Back     alignment and structure
>1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Back     alignment and structure
>3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A Back     alignment and structure
>3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Back     alignment and structure
>1ujc_A Phosphohistidine phosphatase SIXA; alpha-beta fold, hydrolase; 1.90A {Escherichia coli} PDB: 1ujb_A Back     alignment and structure
>3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* Back     alignment and structure
>2rfl_A Putative phosphohistidine phosphatase SIXA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>3f2i_A ALR0221 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG, function; 2.00A {Nostoc SP} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 241
d2hhja1248 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human 1e-38
d1e58a_247 c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia 6e-35
d1xq9a_241 c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium 3e-30
d1qhfa_240 c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yea 4e-29
d1riia_243 c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacteri 1e-27
d1fzta_211 c.60.1.1 (A:) Phosphoglycerate mutase {Fission yea 2e-20
d1bifa2219 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fruc 9e-09
d1v37a_171 c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphat 8e-08
>d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Phosphoglycerate mutase-like
superfamily: Phosphoglycerate mutase-like
family: Cofactor-dependent phosphoglycerate mutase
domain: Phosphoglycerate mutase
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  132 bits (333), Expect = 1e-38
 Identities = 51/107 (47%), Positives = 74/107 (69%)

Query: 127 WLQIISEEFPMFESLKLTIERTLPYWNNVIVPQLKEGKKILIAAHGNSLRGIVKHLDNMS 186
              +  ++ P  ESLK  +ER LPYWN  I P++  GK ILI+AHGNS R ++KHL+ +S
Sbjct: 142 VCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGIS 201

Query: 187 DEAIMGLNLPTGIPFVYELDENLKPVVSMKFLGDEETVKKAMEAVAN 233
           DE I+ + LPTG+P + ELDENL+ V   +FLGD+E ++ A++ V +
Sbjct: 202 DEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVED 248
>d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Length = 247 Back     information, alignment and structure
>d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 240 Back     information, alignment and structure
>d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 243 Back     information, alignment and structure
>d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 211 Back     information, alignment and structure
>d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 219 Back     information, alignment and structure
>d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} Length = 171 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query241
d1e58a_247 Phosphoglycerate mutase {Escherichia coli [TaxId: 99.8
d2hhja1248 Phosphoglycerate mutase {Human (Homo sapiens) [Tax 99.71
d1xq9a_241 Phosphoglycerate mutase {Plasmodium falciparum [Ta 99.7
d1h2ea_207 Broad specificity phosphatase PhoE (YhfR) {Bacillu 99.67
d1riia_243 Phosphoglycerate mutase {Mycobacterium tuberculosi 99.64
d1fzta_211 Phosphoglycerate mutase {Fission yeast (Schizosacc 99.62
d1qhfa_240 Phosphoglycerate mutase {Baker's yeast (Saccharomy 99.51
d1bifa2219 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 99.35
d1v37a_171 Alpha-ribazole-5'-phosphate phosphatase {Thermus t 99.2
>d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphoglycerate mutase-like
superfamily: Phosphoglycerate mutase-like
family: Cofactor-dependent phosphoglycerate mutase
domain: Phosphoglycerate mutase
species: Escherichia coli [TaxId: 562]

Probab=99.80  E-value=2.7e-20  Score=160.53  Aligned_cols=102  Identities=57%  Similarity=1.033  Sum_probs=93.6

Q ss_pred             CCCCCCCHHHHHHhHHHHHHhhccccccCCCeEEEEecchhHHHHHHHhhCCChhhhhcccCCCcccEEEEEcCCCCeee
Q psy11844        134 EFPMFESLKLTIERTLPYWNNVIVPQLKEGKKILIAAHGNSLRGIVKHLDNMSDEAIMGLNLPTGIPFVYELDENLKPVV  213 (241)
Q Consensus       134 ~~pgGESl~~~~~Rv~~~~~~~i~~~~~~g~~VLVVsHGgvIrall~~llg~~~e~~~~~~i~n~s~s~ie~~~~~~~l~  213 (241)
                      ..|+|||+.++.+|+.+++.+.+.+...++++|||||||++||++++++++++++++|++.++||++++++++++++.+.
T Consensus       146 ~~p~gEs~~~~~~Rv~~~~~~~i~~~~~~~~~ilvVtHg~~ir~ll~~~l~~~~~~~~~l~i~n~s~~i~~~~~~~~~~~  225 (247)
T d1e58a_         146 ELPLTESLALTIDRVIPYWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLK  225 (247)
T ss_dssp             TSCSCCCHHHHHHHHHHHHHHTHHHHHHTTCCEEEEECHHHHHHHHHHHTTCCHHHHHHCCCCTTCCEEEEECTTCCEEE
T ss_pred             cCCcchhHHHHHHHHHhhhhhhhhHhhcCCCCEEEECcHHHHHHHHHHHcCCCHHHHhhccCCCCeEEEEEECCCCCEEe
Confidence            45889999999999999999866654457899999999999999999999999999999999999999999998888888


Q ss_pred             eecccCCHHHHHHHHHHHhcccc
Q psy11844        214 SMKFLGDEETVKKAMEAVANQGK  236 (241)
Q Consensus       214 ~~~~~~d~~~l~~~~~~~~~~~~  236 (241)
                      . .|+||++|+.+++.+++.+||
T Consensus       226 ~-~yL~d~~~~~~~~~~v~~~g~  247 (247)
T d1e58a_         226 R-YYLGNADEIAAKAAAVANQGK  247 (247)
T ss_dssp             E-EECSCHHHHHHHTSCCCTTCC
T ss_pred             e-EeCCCHHHHHHHHHHHHhcCC
Confidence            7 499999999999999999996
>d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure