Psyllid ID: psy11929


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430---
MDGNGDGKIDEDTLITMRCLFHSSVNVNEISCLIGPGGCIVRRLRKESGAKISITDGACPDRIVTVSGSVDNSSTSSVETGYPGHTLWVTSVDNVCTAYNFMCRSLEDYHINRNRMENCSPQPLQLKLVIPATHCGSLIGKGGCKIKDIRDLSGANVQVASDMLPMSTERIVTVHGNPDTISQAIYQICLVLIECTLQVVKGAVIPYEPKTMNAGPVILSGGQAYTLHGEYAVPVQEVAGKKQPHPLAGLAVLGIEGIGSTSLTPAALAALSGSRVKSGGKDTGDDFVETEIVLTDDIAGCVIGKAGSRLLEIRQISGAQINIHTGTESHKKMFHIQGCQEAVSLAQYLINMCIELQKNNTTNTSDNPEPADLDAAISAFMTASVNSSLIEKPTPHPGSMVTLGGLSELLANIAASNVKSTVQTTGAYRRDVE
ccccccccccccccEEEEEEEEEccccccEEEEEccccHHHHHHHHHHccEEEEccccccccEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccEEEEEEEEcccccEEEccccccHHHHHHHcccEEEEcccccccccccEEEEEccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccEEEEEEEccccccEEEEcccccHHHHHHHcccEEEEcccccccEEEEEEEEcHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccc
cccccccccccccEEEEEEEEEEEEccccEEEEEcccccEHHHHHHHcccEEEEcccccccEEEEEEccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccHHHccccccccccccccEEEEEEEcccccEEEEccccccHHHHHHHcccEEEEccccccccccEEEEEEccHHHHHHHHHHHHHHHccccccccccccccccccccccccEEcccccccccccccccccHHHccccccccccccccccccccccccccccccHHccccccccccccccccccEEEEEEccccEEEEEcccccHHHHHHHHcccEEEEccccccccEEEEEEccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEccccHHHHHHHcccHccccccccccccccccc
mdgngdgkidedtLITMRCLFHssvnvneiscligpggciVRRLRkesgakisitdgacpdrivtvsgsvdnsstssvetgypghtLWVTSVDNVCTAYNFMCRSLEDYHinrnrmencspqplqlklvipathcgsligkggckikdirdlsganvqvasdmlpmstERIVtvhgnpdtiSQAIYQICLVLIECTLQVVkgavipyepktmnagpvilsggqaytlhgeyavpvqevagkkqphplaglavlgiegigstsltPAALAALSgsrvksggkdtgddfveteivltddiagcvigKAGSRLLEIRQISGaqinihtgteshKKMFHIQGCQEAVSLAQYLINMCIELqknnttntsdnpepadLDAAISAFMTASVnssliekptphpgsmvtlGGLSELLANIAAsnvkstvqttgayrrdve
mdgngdgkidedtLITMRCLFHSSVNVNEISCLIGPGGCIVRRLRKESGakisitdgacpdrivtvsgsvdnsstssvetgypghtLWVTSVDNVCTAYNFMCRSLEDYHINRNRMENCSPQPLQLKLVIPATHCGSLIGKGGCKIKDIRDLSGANVQVASDMLPMSTERIVTVHGNPDTISQAIYQICLVLIECTLQVVKGAVIPYEPKTMNAGPVILSGGQAYTLHGEYAVPVQEVAGKKQPHPLAGLAVLGIEGIGSTSLTPAALAALSgsrvksggkdtGDDFVETEivltddiagCVIGKAGSRLLEIRQISGAQINIHTGTESHKKMFHIQGCQEAVSLAQYLINMCIELQKNNTTNTSDNPEPADLDAAISAFMTASVNSSLIEKPTPHPGSMVTLGGLSELLANIAasnvkstvqttgayrrdve
MDGNGDGKIDEDTLITMRCLFHSSVNVNEISCLIGPGGCIVRRLRKESGAKISITDGACPDRIvtvsgsvdnsstssvetGYPGHTLWVTSVDNVCTAYNFMCRSLEDYHINRNRMENCSPQPLQLKLVIPATHCGSLIGKGGCKIKDIRDLSGANVQVASDMLPMSTERIVTVHGNPDTISQAIYQICLVLIECTLQVVKGAVIPYEPKTMNAGPVILSGGQAYTLHGEYAVPVQEVAGKKQPHPLAGLAVLGIEGIgstsltpaalaalsgsRVKSGGKDTGDDFVETEIVLTDDIAGCVIGKAGSRLLEIRQISGAQINIHTGTESHKKMFHIQGCQEAVSLAQYLINMCIELQKNNTTNTSDNPEPADLDAAISAFMTASVNSSLIEKPTPHPGSMVTLGGLSELLANIAASNVKSTVQTTGAYRRDVE
***********DTLITMRCLFHSSVNVNEISCLIGPGGCIVRRLRKESGAKISITDGACPDRIVT****************YPGHTLWVTSVDNVCTAYNFMCRSLEDYHINRNRMENCSPQPLQLKLVIPATHCGSLIGKGGCKIKDIRDLSGANVQVASDMLPMSTERIVTVHGNPDTISQAIYQICLVLIECTLQVVKGAVIPYEPKTMNAGPVILSGGQAYTLHGEYAVPVQEVAGKKQPHPLAGLAVLGIEGIGSTSL***********************FVETEIVLTDDIAGCVIGKAGSRLLEIRQISGAQINIHTGTESHKKMFHIQGCQEAVSLAQYLINMCIELQ********************************************TLGGLSELLANIAA******************
****************MRCLFHSSVNVNEISCLIGPGGCIVRRLRKESGAKISITDGACPDRIVTVSGSVDNSSTSSVETGYPGHTLWVTSVDNVCTAYNFM**********************QLKLVIPATHCGSLIGKGGCKIKD*RDL*GA*VQVASDMLPMSTERIVTVHGNPDTISQAIYQICLVLIECT*******************PVILSGGQ************************AGLAVLGIEGIGSTSLTPAALAALSGSRVK*******DDFVETEIVLTDDIAGCVIGKAGSRLLEIRQISGAQ*********HKKMFHIQGCQEAVSLAQYLINM***********************************************MVTLGGLSELLA**********************
MDGNGDGKIDEDTLITMRCLFHSSVNVNEISCLIGPGGCIVRRLRKESGAKISITDGACPDRIVTVSGSV*********TGYPGHTLWVTSVDNVCTAYNFMCRSLEDYHINRNRMENCSPQPLQLKLVIPATHCGSLIGKGGCKIKDIRDLSGANVQVASDMLPMSTERIVTVHGNPDTISQAIYQICLVLIECTLQVVKGAVIPYEPKTMNAGPVILSGGQAYTLHGEYAVPVQEVAGKKQPHPLAGLAVLGIEGIGSTSLTPAALAAL**********DTGDDFVETEIVLTDDIAGCVIGKAGSRLLEIRQISGAQINIHTGTESHKKMFHIQGCQEAVSLAQYLINMCIELQKNNTTNTSDNPEPADLDAAISAFMTASVNSSLIEKPTPHPGSMVTLGGLSELLANIAASNVKSTVQTTGAYRRDVE
**********EDTLITMRCLFHSSVNVNEISCLIGPGGCIVRRLRKESGAKISITDGACPDRIVTVSGSVDNSSTSSVETGYPGHTLWVTSVDNVCTAYNFMCRSLEDYHINRN***NCSPQPLQLKLVIPATHCGSLIGKGGCKIKDIRDLSGANVQVASDMLPMSTERIVTVHGNPDTISQAIYQICLVLIECTLQVVKGAVIPYEPKTMNAGPVILSGGQAYTLHGEYAVPVQEVAGKKQPHPLAGLAVLGIEGIGSTSLTPAALAALSGS********TGDDFVETEIVLTDDIAGCVIGKAGSRLLEIRQISGAQINIHTGTESHKKMFHIQGCQEAVSLAQYLINMCIELQ*****************AAISAFMTASVNSSLIEKPTPHPGSMVTLGGLSELLANIAASNVKST************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGNGDGKIDEDTLITMRCLFHSSVNVNEISCLIGPGGCIVRRLRKESGAKISITDGACPDRIVTVSGSVDNSSTSSVETGYPGHTLWVTSVDNVCTAYNFMCRSLEDYHINRNRMENCSPQPLQLKLVIPATHCGSLIGKGGCKIKDIRDLSGANVQVASDMLPMSTERIVTVHGNPDTISQAIYQICLVLIECTLQVVKGAVIPYEPKTMNAGPVILSGGQAYTLHGEYAVPVQEVAGKKQPHPLAGLAVLGIEGIGSTSLTPAALAALSGSRVKSGGKDTGDDFVETEIVLTDDIAGCVIGKAGSRLLEIRQISGAQINIHTGTESHKKMFHIQGCQEAVSLAQYLINMCIELQKNNTTNTSDNPEPADLDAAISAFMTASVNSSLIEKPTPHPGSMVTLGGLSELLANIAASNVKSTVQTTGAYRRDVE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query433 2.2.26 [Sep-21-2011]
P57722371 Poly(rC)-binding protein yes N/A 0.725 0.846 0.393 2e-59
P57721371 Poly(rC)-binding protein yes N/A 0.718 0.838 0.394 2e-59
P57723403 Poly(rC)-binding protein no N/A 0.752 0.808 0.368 2e-53
Q0VCU0403 Poly(rC)-binding protein no N/A 0.752 0.808 0.365 1e-52
P57724403 Poly(rC)-binding protein no N/A 0.720 0.774 0.368 4e-52
Q15366365 Poly(rC)-binding protein no N/A 0.690 0.819 0.350 3e-50
Q61990362 Poly(rC)-binding protein no N/A 0.688 0.823 0.347 4e-50
O19048356 Poly(rC)-binding protein no N/A 0.704 0.856 0.350 4e-48
P60335356 Poly(rC)-binding protein no N/A 0.704 0.856 0.350 4e-48
Q15365356 Poly(rC)-binding protein no N/A 0.704 0.856 0.350 4e-48
>sp|P57722|PCBP3_MOUSE Poly(rC)-binding protein 3 OS=Mus musculus GN=Pcbp3 PE=2 SV=3 Back     alignment and function desciption
 Score =  230 bits (586), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 143/363 (39%), Positives = 201/363 (55%), Gaps = 49/363 (13%)

Query: 3   GNGDGKIDEDTL---ITMRCLFHSSVNVNEISCLIGPGGCIVRRLRKESGAKISITDGAC 59
           G  + K+ E  L   +T+R L H      E+  +IG  G  V+++R+ESGA+I+I++G C
Sbjct: 31  GKMESKVSEGGLNVTLTIRLLMHG----KEVGSIIGKKGETVKKMREESGARINISEGNC 86

Query: 60  PDRIVTVSGSVDNSSTSSVETGYPGHTLWVTSVDNVCTAYNFMCRSLEDYHINRNRMENC 119
           P+RIVT++G  D                       +  A+  +    E+  IN   M N 
Sbjct: 87  PERIVTITGPTDA----------------------IFKAFAMIAYKFEEDIINS--MSNS 122

Query: 120 ---SPQPLQLKLVIPATHCGSLIGKGGCKIKDIRDLSGANVQVASDMLPMSTERIVTVHG 176
              S  P+ L+LV+PA+ CGSLIGKGG KIK+IR+ +GA VQVA DMLP STER VT+ G
Sbjct: 123 PATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTISG 182

Query: 177 NPDTISQAIYQICLVLIECTLQVVKGAVIPYEPKTMNAGPVILSGGQAYTLHGEYAVP-- 234
            PD I Q + QIC+V++E      KGA IPY PK  +  PVI +GGQAYT+ G+YA+P  
Sbjct: 183 TPDAIIQCVKQICVVMLESP---PKGATIPYRPKPAST-PVIFAGGQAYTIQGQYAIPHP 238

Query: 235 -----VQEVAGKKQPHPLAGLAVLGIEGIGSTSLTPAALAALSGSRVKSGGKDTGDDFVE 289
                + ++A ++ P P  G       G      +      L G   +S G D       
Sbjct: 239 DQLTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMG---QSSGLDASPPAST 295

Query: 290 TEIVLTDDIAGCVIGKAGSRLLEIRQISGAQINIHTGTE-SHKKMFHIQGCQEAVSLAQY 348
            E+ + +D+ GC+IG+ G+++ EIRQ+SGAQI I   TE S ++   I G    +SLAQY
Sbjct: 296 HELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQITITGTPANISLAQY 355

Query: 349 LIN 351
           LIN
Sbjct: 356 LIN 358




Single-stranded nucleic acid binding protein that binds preferentially to oligo dC.
Mus musculus (taxid: 10090)
>sp|P57721|PCBP3_HUMAN Poly(rC)-binding protein 3 OS=Homo sapiens GN=PCBP3 PE=2 SV=2 Back     alignment and function description
>sp|P57723|PCBP4_HUMAN Poly(rC)-binding protein 4 OS=Homo sapiens GN=PCBP4 PE=2 SV=1 Back     alignment and function description
>sp|Q0VCU0|PCBP4_BOVIN Poly(rC)-binding protein 4 OS=Bos taurus GN=PCBP4 PE=2 SV=1 Back     alignment and function description
>sp|P57724|PCBP4_MOUSE Poly(rC)-binding protein 4 OS=Mus musculus GN=Pcbp4 PE=2 SV=1 Back     alignment and function description
>sp|Q15366|PCBP2_HUMAN Poly(rC)-binding protein 2 OS=Homo sapiens GN=PCBP2 PE=1 SV=1 Back     alignment and function description
>sp|Q61990|PCBP2_MOUSE Poly(rC)-binding protein 2 OS=Mus musculus GN=Pcbp2 PE=1 SV=1 Back     alignment and function description
>sp|O19048|PCBP1_RABIT Poly(rC)-binding protein 1 OS=Oryctolagus cuniculus GN=PCBP1 PE=2 SV=1 Back     alignment and function description
>sp|P60335|PCBP1_MOUSE Poly(rC)-binding protein 1 OS=Mus musculus GN=Pcbp1 PE=1 SV=1 Back     alignment and function description
>sp|Q15365|PCBP1_HUMAN Poly(rC)-binding protein 1 OS=Homo sapiens GN=PCBP1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query433
116007842 539 mushroom-body expressed, isoform D [Dros 0.739 0.593 0.408 7e-65
195377361 589 GJ11921 [Drosophila virilis] gi|19415461 0.736 0.541 0.407 2e-64
189234912446 PREDICTED: similar to AGAP004942-PA [Tri 0.914 0.887 0.386 1e-63
328720738436 PREDICTED: poly(rC)-binding protein 3-li 0.859 0.853 0.348 5e-63
328778258466 PREDICTED: poly(rC)-binding protein 3-li 0.743 0.690 0.427 3e-62
307199010469 Poly(rC)-binding protein 3 [Harpegnathos 0.759 0.701 0.435 4e-62
350405177466 PREDICTED: poly(rC)-binding protein 3-li 0.743 0.690 0.424 7e-62
340726176466 PREDICTED: poly(rC)-binding protein 3-li 0.741 0.688 0.426 7e-62
345486914476 PREDICTED: poly(rC)-binding protein 3-li 0.780 0.710 0.432 1e-61
45553235364 mushroom-body expressed, isoform C [Dros 0.732 0.870 0.401 1e-61
>gi|116007842|ref|NP_001036619.1| mushroom-body expressed, isoform D [Drosophila melanogaster] gi|113194920|gb|ABI31266.1| mushroom-body expressed, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
 Score =  254 bits (649), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 146/357 (40%), Positives = 207/357 (57%), Gaps = 37/357 (10%)

Query: 10  DEDTLITMRCLFHSSVNVNEISCLIGPGGCIVRRLRKESGAKISITDGACPDRIVTVSGS 69
           D    +T+R +        E+  +IG  G IV R R+ESGAKI+I+DG+CP+RIVTVSG+
Sbjct: 19  DPSVTLTIRLIMQGK----EVGSIIGKKGEIVNRFREESGAKINISDGSCPERIVTVSGT 74

Query: 70  VDNSSTSSVETGYPGHTLWVTSVDNVCTAYNFMCRSLEDYHINRNRMENCSPQPLQLKLV 129
            +                       + +A+  + +  E++    N +       + ++L+
Sbjct: 75  TNA----------------------IFSAFTLITKKFEEWCSQFNDVGKVGKTQIPIRLI 112

Query: 130 IPATHCGSLIGKGGCKIKDIRDLSGANVQVASDMLPMSTERIVTVHGNPDTISQAIYQIC 189
           +PA+ CGSLIGK G KIK+IR  +G ++QVAS+MLP STER VT+ G+ + I+Q IYQIC
Sbjct: 113 VPASQCGSLIGKSGSKIKEIRQTTGCSIQVASEMLPNSTERAVTLSGSAEQITQCIYQIC 172

Query: 190 LVLIECTLQVVKGAVIPYEPKTMNAGPVILSGGQAYTLHGEYAVPVQEVAGKKQPHPLAG 249
           LV++E      +GA IPY PK    GPVIL+ GQA+T+ G YAVP QEVA  K P     
Sbjct: 173 LVMLESP---PRGATIPYRPKPQVTGPVILANGQAFTIQGNYAVPTQEVA--KNPLASLA 227

Query: 250 LAVLGIEGIGSTSLT--PAALAALSGSRVKSGGKDTGDDFVETEIVLTDDIAGCVIGKAG 307
              L      ST      AALAAL+GS++++          + E+ +++D+ GC+IGK G
Sbjct: 228 ALGLAGMNPASTGGINHTAALAALAGSQLRTANPANRAQQQQHEMTVSNDLIGCIIGKGG 287

Query: 308 SRLLEIRQISGAQINIHTGTESH----KKMFHIQGCQEAVSLAQYLINMCIELQKNN 360
           +++ EIRQISGA I I    E       +   I G  ++V+LAQYLINM +ELQK N
Sbjct: 288 TKIAEIRQISGAMIRISNCEEREGGNTDRTITISGNPDSVALAQYLINMSVELQKAN 344




Source: Drosophila melanogaster

Species: Drosophila melanogaster

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195377361|ref|XP_002047459.1| GJ11921 [Drosophila virilis] gi|194154617|gb|EDW69801.1| GJ11921 [Drosophila virilis] Back     alignment and taxonomy information
>gi|189234912|ref|XP_969611.2| PREDICTED: similar to AGAP004942-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328720738|ref|XP_001949210.2| PREDICTED: poly(rC)-binding protein 3-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328778258|ref|XP_391921.3| PREDICTED: poly(rC)-binding protein 3-like [Apis mellifera] Back     alignment and taxonomy information
>gi|307199010|gb|EFN79734.1| Poly(rC)-binding protein 3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350405177|ref|XP_003487350.1| PREDICTED: poly(rC)-binding protein 3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340726176|ref|XP_003401437.1| PREDICTED: poly(rC)-binding protein 3-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|345486914|ref|XP_001607400.2| PREDICTED: poly(rC)-binding protein 3-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|45553235|ref|NP_996145.1| mushroom-body expressed, isoform C [Drosophila melanogaster] gi|194876029|ref|XP_001973701.1| GG16232 [Drosophila erecta] gi|195496648|ref|XP_002095782.1| GE22592 [Drosophila yakuba] gi|16648354|gb|AAL25442.1| LD32520p [Drosophila melanogaster] gi|45446078|gb|AAS65095.1| mushroom-body expressed, isoform C [Drosophila melanogaster] gi|190655484|gb|EDV52727.1| GG16232 [Drosophila erecta] gi|194181883|gb|EDW95494.1| GE22592 [Drosophila yakuba] gi|220951950|gb|ACL88518.1| mub-PC [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query433
UNIPROTKB|F1NPL2319 PCBP3 "Uncharacterized protein 0.341 0.463 0.474 3.1e-57
RGD|1307430319 Pcbp3 "poly(rC) binding protei 0.341 0.463 0.487 1.7e-56
UNIPROTKB|B4DXP5322 PCBP2 "Poly(rC)-binding protei 0.293 0.394 0.527 1.5e-55
MGI|MGI:1890470371 Pcbp3 "poly(rC) binding protei 0.605 0.706 0.405 3.3e-55
UNIPROTKB|D4A1P3371 Pcbp3 "Protein Pcbp3" [Rattus 0.605 0.706 0.405 3.3e-55
UNIPROTKB|G3V0E8318 PCBP2 "Poly(RC) binding protei 0.286 0.389 0.523 4.9e-55
UNIPROTKB|E2QUE1371 PCBP3 "Uncharacterized protein 0.605 0.706 0.405 6.9e-55
UNIPROTKB|P57721371 PCBP3 "Poly(rC)-binding protei 0.605 0.706 0.405 6.9e-55
UNIPROTKB|P57723403 PCBP4 "Poly(rC)-binding protei 0.281 0.302 0.519 1e-54
UNIPROTKB|E2RCH9370 PCBP3 "Uncharacterized protein 0.602 0.705 0.401 1.4e-54
UNIPROTKB|F1NPL2 PCBP3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 353 (129.3 bits), Expect = 3.1e-57, Sum P(3) = 3.1e-57
 Identities = 73/154 (47%), Positives = 100/154 (64%)

Query:    83 PGHTLWVTS-VDNVCTAYNFMCRSLE-DYHINRNRMENCSPQPLQLKLVIPATHCGSLIG 140
             P   + +T   D +  A++ +    E D + +       S  P+ L+LV+PA+ CGSLIG
Sbjct:    55 PERIVTITGPTDAIFKAFSMIALKFEEDINASMTNSTVTSKPPVTLRLVVPASQCGSLIG 114

Query:   141 KGGCKIKDIRDLSGANVQVASDMLPMSTERIVTVHGNPDTISQAIYQICLVLIECTLQVV 200
             KGG KIK+IR+ +GA VQVA DMLP STER VT+ G PD I Q + QIC+V++E      
Sbjct:   115 KGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESP---P 171

Query:   201 KGAVIPYEPKTMNAGPVILSGGQAYTLHGEYAVP 234
             KGA IPY PK  +A P+I +GGQA+T+ G+YA+P
Sbjct:   172 KGATIPYRPKPASA-PIIFAGGQAFTIQGQYAIP 204


GO:0003723 "RNA binding" evidence=IEA
RGD|1307430 Pcbp3 "poly(rC) binding protein 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|B4DXP5 PCBP2 "Poly(rC)-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1890470 Pcbp3 "poly(rC) binding protein 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|D4A1P3 Pcbp3 "Protein Pcbp3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V0E8 PCBP2 "Poly(RC) binding protein 2, isoform CRA_f" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUE1 PCBP3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P57721 PCBP3 "Poly(rC)-binding protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P57723 PCBP4 "Poly(rC)-binding protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RCH9 PCBP3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P57722PCBP3_MOUSENo assigned EC number0.39390.72510.8463yesN/A
P57721PCBP3_HUMANNo assigned EC number0.39440.71820.8382yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query433
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 5e-21
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 2e-13
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 1e-11
smart0032268 smart00322, KH, K homology RNA-binding domain 1e-10
pfam0001359 pfam00013, KH_1, KH domain 1e-10
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 1e-08
pfam1301442 pfam13014, KH_3, KH domain 2e-08
smart0032268 smart00322, KH, K homology RNA-binding domain 4e-08
pfam0001359 pfam00013, KH_1, KH domain 2e-07
pfam0001359 pfam00013, KH_1, KH domain 2e-07
smart0032268 smart00322, KH, K homology RNA-binding domain 7e-07
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 1e-06
pfam1301442 pfam13014, KH_3, KH domain 1e-06
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 6e-05
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 3e-04
pfam1301442 pfam13014, KH_3, KH domain 0.001
cd0239361 cd02393, PNPase_KH, Polynucleotide phosphorylase ( 0.001
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 0.002
cd02395120 cd02395, SF1_like-KH, Splicing factor 1 (SF1) K ho 0.002
COG1185692 COG1185, Pnp, Polyribonucleotide nucleotidyltransf 0.003
TIGR03591684 TIGR03591, polynuc_phos, polyribonucleotide nucleo 0.003
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information
 Score = 86.0 bits (214), Expect = 5e-21
 Identities = 29/65 (44%), Positives = 47/65 (72%)

Query: 125 QLKLVIPATHCGSLIGKGGCKIKDIRDLSGANVQVASDMLPMSTERIVTVHGNPDTISQA 184
            L+L++P++  GS+IGKGG  IK+IR+ +GA ++V+  +LP STER+VT+ G P  + +A
Sbjct: 1   TLRLLVPSSQAGSIIGKGGSTIKEIREETGAKIRVSKSVLPGSTERVVTISGKPSAVQKA 60

Query: 185 IYQIC 189
           +  I 
Sbjct: 61  LLLIL 65


Members of this group possess KH domains in a tandem arrangement. Most members, similar to the poly(C) binding proteins (PCBPs) and Nova, containing three KH domains, with the first and second domains, which are represented here, in tandem arrangement, followed by a large spacer region, with the third domain near the C-terminal end of the protein. The poly(C) binding proteins (PCBPs) can be divided into two groups, hnRNPs K/J and the alphaCPs, which share a triple KH domain configuration and poly(C) binding specificity. They play roles in mRNA stabilization, translational activation, and translational silencing. Nova-1 and Nova-2 are nuclear RNA-binding proteins that regulate splicing. This group also contains plant proteins that seem to have two tandem repeat arrrangements, like Hen4, a protein that plays a role in AGAMOUS (AG) pre-mRNA processing and important step in plant development. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. Length = 65

>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>gnl|CDD|239088 cd02395, SF1_like-KH, Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 433
KOG2193|consensus584 100.0
KOG2192|consensus390 100.0
KOG1676|consensus 600 100.0
KOG2190|consensus485 100.0
KOG1676|consensus 600 100.0
KOG2193|consensus584 99.97
KOG2191|consensus402 99.97
KOG2191|consensus 402 99.93
KOG2190|consensus485 99.93
KOG2192|consensus390 99.76
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 99.67
PRK13763180 putative RNA-processing protein; Provisional 99.64
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 99.64
PRK13763180 putative RNA-processing protein; Provisional 99.6
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 99.47
KOG2279|consensus 608 99.43
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 99.41
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 99.33
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 99.31
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 99.25
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 99.24
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 99.22
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 99.21
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 99.1
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 99.06
PF1301443 KH_3: KH domain 99.01
smart0032269 KH K homology RNA-binding domain. 98.95
PF1301443 KH_3: KH domain 98.94
KOG2208|consensus 753 98.89
smart0032269 KH K homology RNA-binding domain. 98.85
KOG2208|consensus 753 98.84
COG1094194 Predicted RNA-binding protein (contains KH domains 98.81
KOG2279|consensus 608 98.69
COG1094194 Predicted RNA-binding protein (contains KH domains 98.5
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 98.39
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 98.33
KOG2113|consensus 394 98.26
KOG2113|consensus394 98.12
PRK08406140 transcription elongation factor NusA-like protein; 98.06
PRK08406140 transcription elongation factor NusA-like protein; 98.05
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 97.96
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 97.79
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 97.59
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 97.5
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 97.49
KOG0119|consensus554 97.46
KOG0336|consensus 629 97.46
KOG1588|consensus259 97.39
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 97.29
KOG0119|consensus554 97.16
KOG2814|consensus345 97.11
COG0195190 NusA Transcription elongation factor [Transcriptio 97.09
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 97.06
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 97.01
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 96.9
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 96.85
KOG2814|consensus 345 96.83
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 96.76
KOG0336|consensus 629 96.7
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 96.69
PF14611210 SLS: Mitochondrial inner-membrane-bound regulator 96.5
PRK00106535 hypothetical protein; Provisional 96.27
PRK0046875 hypothetical protein; Provisional 96.25
TIGR03319514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 96.22
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 96.15
COG0195190 NusA Transcription elongation factor [Transcriptio 96.13
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 96.1
PRK12704520 phosphodiesterase; Provisional 96.06
PRK12328374 nusA transcription elongation factor NusA; Provisi 96.06
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 96.02
TIGR01953341 NusA transcription termination factor NusA. This m 96.02
PRK00106 535 hypothetical protein; Provisional 95.99
PRK12327362 nusA transcription elongation factor NusA; Provisi 95.95
PRK12704 520 phosphodiesterase; Provisional 95.94
KOG1588|consensus259 95.92
PRK0282177 hypothetical protein; Provisional 95.84
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 95.8
PRK12329449 nusA transcription elongation factor NusA; Provisi 95.79
COG183776 Predicted RNA-binding protein (contains KH domain) 95.79
PRK12328374 nusA transcription elongation factor NusA; Provisi 95.68
PF14611210 SLS: Mitochondrial inner-membrane-bound regulator 95.63
PRK09202470 nusA transcription elongation factor NusA; Validat 95.54
COG5176269 MSL5 Splicing factor (branch point binding protein 95.39
TIGR01953341 NusA transcription termination factor NusA. This m 95.38
PRK0106478 hypothetical protein; Provisional 95.33
PRK0282177 hypothetical protein; Provisional 95.3
PRK12327362 nusA transcription elongation factor NusA; Provisi 95.26
PRK0046875 hypothetical protein; Provisional 95.25
PRK09202470 nusA transcription elongation factor NusA; Validat 95.11
COG183776 Predicted RNA-binding protein (contains KH domain) 94.99
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 94.97
PRK12329449 nusA transcription elongation factor NusA; Provisi 94.61
COG5176269 MSL5 Splicing factor (branch point binding protein 94.53
KOG4369|consensus 2131 94.21
PRK12705508 hypothetical protein; Provisional 94.04
PRK0106478 hypothetical protein; Provisional 94.01
KOG1067|consensus760 93.6
PRK12705 508 hypothetical protein; Provisional 93.39
KOG4369|consensus 2131 92.0
PF1308373 KH_4: KH domain; PDB: 3GKU_B. 91.97
cd0240968 KH-II KH-II (K homology RNA-binding domain, type I 91.49
PF1318469 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW 90.95
PF1318469 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW 90.27
KOG1067|consensus760 89.92
KOG3273|consensus252 89.36
PF1308373 KH_4: KH domain; PDB: 3GKU_B. 89.33
cd0240968 KH-II KH-II (K homology RNA-binding domain, type I 89.3
PF0765078 KH_2: KH domain syndrome, contains KH motifs.; Int 88.25
COG1855604 ATPase (PilT family) [General function prediction 87.38
cd0241477 jag_KH jag_K homology RNA-binding domain. The KH d 87.25
KOG3273|consensus252 86.88
COG1097239 RRP4 RNA-binding protein Rrp4 and related proteins 86.5
cd0241381 40S_S3_KH K homology RNA-binding (KH) domain of th 85.87
cd02410145 archeal_CPSF_KH The archaeal cleavage and polyaden 85.44
COG5166657 Uncharacterized conserved protein [Function unknow 84.54
cd02410145 archeal_CPSF_KH The archaeal cleavage and polyaden 84.04
PRK13764602 ATPase; Provisional 83.84
cd0241477 jag_KH jag_K homology RNA-binding domain. The KH d 83.36
PF0765078 KH_2: KH domain syndrome, contains KH motifs.; Int 82.6
COG1855604 ATPase (PilT family) [General function prediction 82.45
COG1097239 RRP4 RNA-binding protein Rrp4 and related proteins 81.57
PRK06418166 transcription elongation factor NusA-like protein; 80.83
KOG2874|consensus356 80.79
>KOG2193|consensus Back     alignment and domain information
Probab=100.00  E-value=5.1e-53  Score=404.28  Aligned_cols=329  Identities=20%  Similarity=0.309  Sum_probs=257.6

Q ss_pred             CceEEEEEEeccCCcccccceeeecCchHHHHHHHHhCCeEEEeC---CCCCcceEEEecccCCCCCCccccCCCCCccc
Q psy11929         12 DTLITMRCLFHSSVNVNEISCLIGPGGCIVRRLRKESGAKISITD---GACPDRIVTVSGSVDNSSTSSVETGYPGHTLW   88 (433)
Q Consensus        12 ~~~~~~rilvp~~~~~~~vg~IIGk~G~~Ik~I~~~tga~I~v~~---~~~~eRvv~I~G~~~~~~~~~v~~~~~~~~~~   88 (433)
                      ..++++|+|||.    .+||.||||.|.|||.|...|.|+|+|..   .|..||+|+|.|+++                 
T Consensus       196 ~~D~PlR~lVpt----qyvgaIIGkeG~TIknItkqTqsriD~hrken~Gaaek~itvh~tpE-----------------  254 (584)
T KOG2193|consen  196 LKDWPLRLLVPT----QYVGAIIGKEGATIKNITKQTQSRIDVHRKENAGAAEKIITVHSTPE-----------------  254 (584)
T ss_pred             ccCcceeeeecc----ceeEEEecCCCccccCcchhhhheeeeeecccCCcccCceEEecCcc-----------------
Confidence            357999999999    99999999999999999999999999986   378999999999999                 


Q ss_pred             cchHHHHHHHHHHHHhhhhhhcccccCCCCCCCCCeEEEEEeccCcccceecCCchhHHHHHHhhCceEEecc--CCCCC
Q psy11929         89 VTSVDNVCTAYNFMCRSLEDYHINRNRMENCSPQPLQLKLVIPATHCGSLIGKGGCKIKDIRDLSGANVQVAS--DMLPM  166 (433)
Q Consensus        89 ~~a~~~v~~A~~~I~~~~~~~~~~~~~~~~~~~~~~~~~l~ip~~~vg~iIGk~G~~Ik~I~~~sga~I~i~~--~~~~~  166 (433)
                           ...+|+++|++++......     +.-...+.++++.++.+||+||||.|++||+|+.+||++|.|++  +....
T Consensus       255 -----g~s~Ac~~ILeimqkEA~~-----~k~~~e~pLk~lAHN~lvGRLIGKeGrnlKkIeq~TgTkITis~lqels~y  324 (584)
T KOG2193|consen  255 -----GTSKACKMILEIMQKEAVD-----DKVAEEIPLKILAHNNLVGRLIGKEGRNLKKIEQDTGTKITISKLQELSLY  324 (584)
T ss_pred             -----chHHHHHHHHHHHHHhhhc-----cchhhhcchhhhhhcchhhhhhhhccccHHHHHhhcCCceeeeehhhhccc
Confidence                 8999999999998764321     12246788999999999999999999999999999999999986  43335


Q ss_pred             CCccEEEEEccHHHHHHHHHHHHHHHHhhccccCCCcccccCCCCCCCCCccccCCcccccCCCCCCCcccccCCCCCCC
Q psy11929        167 STERIVTVHGNPDTISQAIYQICLVLIECTLQVVKGAVIPYEPKTMNAGPVILSGGQAYTLHGEYAVPVQEVAGKKQPHP  246 (433)
Q Consensus       167 ~~er~v~I~G~~~~v~~A~~~I~~~l~e~~~~~~~~~~~~~~p~~~~~~p~~~~g~~~~~~~g~~~~P~~~~~~~~~~~p  246 (433)
                      ..||+|++.|+.++|.+|..+|+.+|++|++++...  ..++.+..   |.+..  ..+   |.+  |.           
T Consensus       325 npERTItVkGsiEac~~AE~eImkKlre~yEnDl~a--~s~q~~l~---P~l~~--~~l---~~f--~s-----------  381 (584)
T KOG2193|consen  325 NPERTITVKGSIEACVQAEAEIMKKLRECYENDLAA--MSLQCHLP---PGLNL--PAL---GLF--PS-----------  381 (584)
T ss_pred             CccceEEecccHHHHHHHHHHHHHHHHHHHhhhHHH--hhccCCCC---cccCc--ccc---CCC--Cc-----------
Confidence            679999999999999999999999999999866432  11111100   00000  000   000  00           


Q ss_pred             CccccccCcCCCCCCCC---CccccccccCCCcccCCCCCCCCceEEEEEeCcccccccccCCCchHHHHHhHhCCeEEE
Q psy11929        247 LAGLAVLGIEGIGSTSL---TPAALAALSGSRVKSGGKDTGDDFVETEIVLTDDIAGCVIGKAGSRLLEIRQISGAQINI  323 (433)
Q Consensus       247 ~~~~~~~~~~~~~~p~~---~~~~~~~~~~~~~~~~~~~~~~~~~t~~i~VP~~~vG~IIGkgG~~Ik~I~~~sGA~I~I  323 (433)
                           ..++.+++||-.   ..++|+          ......+...++|+||...||+||||+|.+||+|.+++||+|+|
T Consensus       382 -----sS~~~~Ph~~Ps~v~~a~p~~----------~~hq~pe~e~V~~fiP~~~vGAiIGkkG~hIKql~RfagASiKI  446 (584)
T KOG2193|consen  382 -----SSAVSPPHFPPSPVTFASPYP----------LFHQNPEQEQVRMFIPAQAVGAIIGKKGQHIKQLSRFAGASIKI  446 (584)
T ss_pred             -----ccccCCCCCCCCccccCCCch----------hhhcCcchhheeeeccHHHHHHHHhhcchhHHHHHHhccceeee
Confidence                 001111111100   000111          01123367788999999999999999999999999999999999


Q ss_pred             ccCCC--CCceEEEEEeCHHHHHHHHHHHHHHHHhccccCCCCCCCCCccccccccccchhccccccccccCCCCCccee
Q psy11929        324 HTGTE--SHKKMFHIQGCQEAVSLAQYLINMCIELQKNNTTNTSDNPEPADLDAAISAFMTASVNSSLIEKPTPHPGSMV  401 (433)
Q Consensus       324 ~~~~~--~~er~V~IsGt~e~v~~A~~lI~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vP~~~~G~ii  401 (433)
                      .+++.  ..+|+|+|+|.+++..+|+..|+.+|.++..-.  .   .+.++++.             ++.||++.+||||
T Consensus       447 appE~pdvseRMViItGppeaqfKAQgrifgKikEenf~~--P---keevklet-------------hirVPs~~aGRvI  508 (584)
T KOG2193|consen  447 APPEIPDVSERMVIITGPPEAQFKAQGRIFGKIKEENFFL--P---KEEVKLET-------------HIRVPSSAAGRVI  508 (584)
T ss_pred             cCCCCCCcceeEEEecCChHHHHhhhhhhhhhhhhhccCC--c---hhhheeee-------------eeeccchhhhhhh
Confidence            98876  889999999999999999999999999874322  2   24566664             4669999999999


Q ss_pred             cccc--HHHHHHhhhccccccceeecccc
Q psy11929        402 TLGG--LSELLANIAASNVKSTVQTTGAY  428 (433)
Q Consensus       402 GkgG--~~e~~~~~~~~~~~~~~~~~~~~  428 (433)
                      ||||  ++|| ||||+|+|++|++-|+-.
T Consensus       509 GKGGktVnEL-Qnlt~AeV~vPrdqtpdE  536 (584)
T KOG2193|consen  509 GKGGKTVNEL-QNLTSAEVVVPRDQTPDE  536 (584)
T ss_pred             ccccccHHHH-hccccceEEccccCCCCc
Confidence            9999  7999 999999999999987643



>KOG2192|consensus Back     alignment and domain information
>KOG1676|consensus Back     alignment and domain information
>KOG2190|consensus Back     alignment and domain information
>KOG1676|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG2191|consensus Back     alignment and domain information
>KOG2191|consensus Back     alignment and domain information
>KOG2190|consensus Back     alignment and domain information
>KOG2192|consensus Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>KOG2279|consensus Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>KOG2208|consensus Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>KOG2208|consensus Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>KOG2279|consensus Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG2113|consensus Back     alignment and domain information
>KOG2113|consensus Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>KOG0119|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG1588|consensus Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>KOG0119|consensus Back     alignment and domain information
>KOG2814|consensus Back     alignment and domain information
>COG0195 NusA Transcription elongation factor [Transcription] Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2814|consensus Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>PF14611 SLS: Mitochondrial inner-membrane-bound regulator Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PRK00468 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>COG0195 NusA Transcription elongation factor [Transcription] Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PRK12328 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>TIGR01953 NusA transcription termination factor NusA Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PRK12327 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>KOG1588|consensus Back     alignment and domain information
>PRK02821 hypothetical protein; Provisional Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>PRK12329 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] Back     alignment and domain information
>PRK12328 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PF14611 SLS: Mitochondrial inner-membrane-bound regulator Back     alignment and domain information
>PRK09202 nusA transcription elongation factor NusA; Validated Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>TIGR01953 NusA transcription termination factor NusA Back     alignment and domain information
>PRK01064 hypothetical protein; Provisional Back     alignment and domain information
>PRK02821 hypothetical protein; Provisional Back     alignment and domain information
>PRK12327 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PRK00468 hypothetical protein; Provisional Back     alignment and domain information
>PRK09202 nusA transcription elongation factor NusA; Validated Back     alignment and domain information
>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>PRK12329 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>PRK01064 hypothetical protein; Provisional Back     alignment and domain information
>KOG1067|consensus Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PF13083 KH_4: KH domain; PDB: 3GKU_B Back     alignment and domain information
>cd02409 KH-II KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information
>PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A Back     alignment and domain information
>PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A Back     alignment and domain information
>KOG1067|consensus Back     alignment and domain information
>KOG3273|consensus Back     alignment and domain information
>PF13083 KH_4: KH domain; PDB: 3GKU_B Back     alignment and domain information
>cd02409 KH-II KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information
>PF07650 KH_2: KH domain syndrome, contains KH motifs Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>cd02414 jag_KH jag_K homology RNA-binding domain Back     alignment and domain information
>KOG3273|consensus Back     alignment and domain information
>COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3 Back     alignment and domain information
>cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) Back     alignment and domain information
>COG5166 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>cd02414 jag_KH jag_K homology RNA-binding domain Back     alignment and domain information
>PF07650 KH_2: KH domain syndrome, contains KH motifs Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06418 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>KOG2874|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query433
2jzx_A160 Pcbp2 Kh1-Kh2 Domains Length = 160 2e-29
2p2r_A76 Crystal Structure Of The Third Kh Domain Of Human P 1e-08
1wvn_A82 Crsytal Structure Of Domain 3 Of Human Alpha Polyc 5e-08
2anr_A178 Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TAND 1e-07
2anr_A178 Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TAND 5e-04
2ann_A178 Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDE 1e-07
2ann_A178 Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDE 5e-04
1j5k_A89 Complex Of The Kh3 Domain Of Hnrnp K With A Single_ 1e-06
1zzi_A82 Crystal Structure Analysis Of The Third Kh Domain O 4e-06
1zzi_A82 Crystal Structure Analysis Of The Third Kh Domain O 6e-06
1khm_A89 C-Terminal Kh Domain Of Hnrnp K (Kh3) Length = 89 5e-06
1ztg_A74 Human Alpha Polyc Binding Protein Kh1 Length = 74 1e-05
3vke_A76 Contribution Of The First K-Homology Domain Of Poly 1e-04
2axy_A73 Crystal Structure Of Kh1 Domain Of Human Poly(C)-Bi 2e-04
1dtj_A76 Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Bind 6e-04
1ec6_A87 Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Bind 8e-04
>pdb|2JZX|A Chain A, Pcbp2 Kh1-Kh2 Domains Length = 160 Back     alignment and structure

Iteration: 1

Score = 126 bits (317), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 71/185 (38%), Positives = 107/185 (57%), Gaps = 27/185 (14%) Query: 11 EDTLITMRCLFHSSVNVNEISCLIGPGGCIVRRLRKESGAKISITDGACPDRIXXXXXXX 70 ++ +T+R L H E+ +IG G V+++R+ESGA+I+I++G CP+RI Sbjct: 1 KNVTLTIRLLMHG----KEVGSIIGKKGESVKKMREESGARINISEGNCPERIITL---- 52 Query: 71 XXXXXXXXXXGYPGHTLWVTSVDNVCTAYNFMCRSLE-DYHINRNRMENCSPQPLQLKLV 129 P + ++ A+ + LE D + S P+ L+LV Sbjct: 53 ----------AGPTNAIF--------KAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLV 94 Query: 130 IPATHCGSLIGKGGCKIKDIRDLSGANVQVASDMLPMSTERIVTVHGNPDTISQAIYQIC 189 +PA+ CGSLIGKGGCKIK+IR+ +GA VQVA DMLP STER +T+ G P +I + + QIC Sbjct: 95 VPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSIIECVKQIC 154 Query: 190 LVLIE 194 +V++E Sbjct: 155 VVMLE 159
>pdb|2P2R|A Chain A, Crystal Structure Of The Third Kh Domain Of Human Poly(C)- Binding Protein-2 In Complex With C-Rich Strand Of Human Telomeric Dna Length = 76 Back     alignment and structure
>pdb|1WVN|A Chain A, Crsytal Structure Of Domain 3 Of Human Alpha Polyc Binding Protein Length = 82 Back     alignment and structure
>pdb|2ANR|A Chain A, Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25NT RNA Hairpin Length = 178 Back     alignment and structure
>pdb|2ANR|A Chain A, Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25NT RNA Hairpin Length = 178 Back     alignment and structure
>pdb|2ANN|A Chain A, Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25 NT RNA Hairpin Length = 178 Back     alignment and structure
>pdb|2ANN|A Chain A, Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25 NT RNA Hairpin Length = 178 Back     alignment and structure
>pdb|1J5K|A Chain A, Complex Of The Kh3 Domain Of Hnrnp K With A Single_stranded 10mer Dna Oligonucleotide Length = 89 Back     alignment and structure
>pdb|1ZZI|A Chain A, Crystal Structure Analysis Of The Third Kh Domain Of Hnrnp K In Complex With Ssdna Length = 82 Back     alignment and structure
>pdb|1ZZI|A Chain A, Crystal Structure Analysis Of The Third Kh Domain Of Hnrnp K In Complex With Ssdna Length = 82 Back     alignment and structure
>pdb|1KHM|A Chain A, C-Terminal Kh Domain Of Hnrnp K (Kh3) Length = 89 Back     alignment and structure
>pdb|1ZTG|A Chain A, Human Alpha Polyc Binding Protein Kh1 Length = 74 Back     alignment and structure
>pdb|3VKE|A Chain A, Contribution Of The First K-Homology Domain Of Poly(C)-Binding Protein 1 To Its Affinity And Specificity For C-Rich Oligonucleotides Length = 76 Back     alignment and structure
>pdb|2AXY|A Chain A, Crystal Structure Of Kh1 Domain Of Human Poly(C)-Binding Protein-2 With C-Rich Strand Of Human Telomeric Dna Length = 73 Back     alignment and structure
>pdb|1DTJ|A Chain A, Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Binding Domain Length = 76 Back     alignment and structure
>pdb|1EC6|A Chain A, Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Binding Domain Bound To 20-Mer Rna Hairpin Length = 87 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query433
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 6e-41
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 3e-14
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 2e-09
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 1e-06
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 2e-34
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 4e-16
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 9e-11
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 2e-06
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 2e-33
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 3e-16
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 7e-10
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 7e-06
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 1e-30
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 3e-14
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 3e-09
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 8e-06
1j4w_A174 FUSE binding protein; single-stranded DNA binding 2e-30
1j4w_A174 FUSE binding protein; single-stranded DNA binding 2e-16
1j4w_A174 FUSE binding protein; single-stranded DNA binding 5e-10
1j4w_A174 FUSE binding protein; single-stranded DNA binding 3e-06
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 3e-18
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 3e-14
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 9e-07
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 4e-18
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 1e-14
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 6e-07
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 1e-17
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 4e-14
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 1e-07
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 3e-17
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 5e-14
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 4e-07
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 3e-17
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 7e-12
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 1e-06
1x4m_A94 FAR upstream element binding protein 1; KH domain, 3e-17
1x4m_A94 FAR upstream element binding protein 1; KH domain, 6e-12
1x4m_A94 FAR upstream element binding protein 1; KH domain, 6e-06
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 5e-17
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 7e-15
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 1e-07
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 5e-17
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 1e-14
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 2e-07
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 6e-17
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 2e-15
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 2e-08
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 8e-17
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 1e-10
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 7e-07
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 1e-16
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 5e-12
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 4e-05
1we8_A104 Tudor and KH domain containing protein; structural 3e-15
1we8_A104 Tudor and KH domain containing protein; structural 6e-12
1we8_A104 Tudor and KH domain containing protein; structural 2e-06
1x4n_A92 FAR upstream element binding protein 1; KH domain, 1e-14
1x4n_A92 FAR upstream element binding protein 1; KH domain, 2e-14
1x4n_A92 FAR upstream element binding protein 1; KH domain, 3e-07
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 4e-10
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 4e-07
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 2e-05
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 2e-09
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 4e-05
2dgr_A83 Ring finger and KH domain-containing protein 1; st 2e-09
2dgr_A83 Ring finger and KH domain-containing protein 1; st 1e-06
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 8e-09
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 7e-05
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 4e-08
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 2e-05
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 5e-08
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 2e-07
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 4e-07
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 1e-04
1tua_A191 Hypothetical protein APE0754; structural genomics, 2e-06
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 5e-05
3n89_A376 Defective in GERM LINE development protein 3, ISO; 7e-05
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 9e-04
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
 Score =  142 bits (359), Expect = 6e-41
 Identities = 71/185 (38%), Positives = 110/185 (59%), Gaps = 27/185 (14%)

Query: 11  EDTLITMRCLFHSSVNVNEISCLIGPGGCIVRRLRKESGAKISITDGACPDRIVTVSGSV 70
           ++  +T+R L H      E+  +IG  G  V+++R+ESGA+I+I++G CP+RI+T++G  
Sbjct: 1   KNVTLTIRLLMHGK----EVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPT 56

Query: 71  DNSSTSSVETGYPGHTLWVTSVDNVCTAYNFMCRSLEDYHINR-NRMENCSPQPLQLKLV 129
           +                       +  A+  +   LE+   +        S  P+ L+LV
Sbjct: 57  NA----------------------IFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLV 94

Query: 130 IPATHCGSLIGKGGCKIKDIRDLSGANVQVASDMLPMSTERIVTVHGNPDTISQAIYQIC 189
           +PA+ CGSLIGKGGCKIK+IR+ +GA VQVA DMLP STER +T+ G P +I + + QIC
Sbjct: 95  VPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSIIECVKQIC 154

Query: 190 LVLIE 194
           +V++E
Sbjct: 155 VVMLE 159


>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Length = 376 Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Length = 630 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query433
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 99.95
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 99.94
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 99.94
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 99.94
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 99.94
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 99.93
1j4w_A174 FUSE binding protein; single-stranded DNA binding 99.93
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 99.93
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 99.93
1j4w_A174 FUSE binding protein; single-stranded DNA binding 99.92
3n89_A376 Defective in GERM LINE development protein 3, ISO; 99.92
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 99.78
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 99.77
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 99.71
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 99.67
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 99.62
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 99.61
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 99.6
1tua_A191 Hypothetical protein APE0754; structural genomics, 99.6
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 99.58
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 99.58
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 99.58
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 99.57
1x4n_A92 FAR upstream element binding protein 1; KH domain, 99.56
1tua_A191 Hypothetical protein APE0754; structural genomics, 99.56
2dgr_A83 Ring finger and KH domain-containing protein 1; st 99.56
3n89_A 376 Defective in GERM LINE development protein 3, ISO; 99.55
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 99.53
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 99.52
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 99.51
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 99.51
1x4m_A94 FAR upstream element binding protein 1; KH domain, 99.51
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 99.47
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 99.46
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 99.46
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 99.46
1we8_A104 Tudor and KH domain containing protein; structural 99.46
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 99.45
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 99.45
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 99.45
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 99.44
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 99.43
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.43
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 99.42
1x4n_A92 FAR upstream element binding protein 1; KH domain, 99.42
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 99.41
1x4m_A94 FAR upstream element binding protein 1; KH domain, 99.41
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 99.38
2dgr_A83 Ring finger and KH domain-containing protein 1; st 99.36
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 99.35
1we8_A104 Tudor and KH domain containing protein; structural 99.35
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 99.33
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 99.32
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 99.32
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.29
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.27
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 99.21
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 99.21
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 99.18
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.13
2cpq_A91 FragIle X mental retardation syndrome related prot 98.96
2cpq_A91 FragIle X mental retardation syndrome related prot 98.68
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 98.63
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 98.63
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 98.58
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 98.58
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 98.3
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 98.09
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 98.08
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 97.95
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 97.87
2cxc_A144 NUSA; transcription termination, RNA binding prote 97.64
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 97.49
2cxc_A144 NUSA; transcription termination, RNA binding prote 97.29
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 97.22
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 97.13
1k0r_A366 NUSA; two component arrangement, S1 domain, two K- 95.79
2asb_A251 Transcription elongation protein NUSA; protein-RNA 95.6
2asb_A251 Transcription elongation protein NUSA; protein-RNA 95.34
1k0r_A366 NUSA; two component arrangement, S1 domain, two K- 95.31
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 94.71
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 94.17
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 93.9
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 93.88
1hh2_P344 NUSA, N utilization substance protein A; transcrip 93.82
1hh2_P344 NUSA, N utilization substance protein A; transcrip 93.49
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
Probab=99.95  E-value=4.1e-28  Score=215.17  Aligned_cols=157  Identities=45%  Similarity=0.853  Sum_probs=139.2

Q ss_pred             CceEEEEEEeccCCcccccceeeecCchHHHHHHHHhCCeEEEeCCCCCcceEEEecccCCCCCCccccCCCCCccccch
Q psy11929         12 DTLITMRCLFHSSVNVNEISCLIGPGGCIVRRLRKESGAKISITDGACPDRIVTVSGSVDNSSTSSVETGYPGHTLWVTS   91 (433)
Q Consensus        12 ~~~~~~rilvp~~~~~~~vg~IIGk~G~~Ik~I~~~tga~I~v~~~~~~eRvv~I~G~~~~~~~~~v~~~~~~~~~~~~a   91 (433)
                      +.+++++|+||.    +++|.||||+|++||+|+++|||+|+|++.++++|+|+|+|+.+                    
T Consensus         2 ~~~~~~~~~vp~----~~~g~iIGkgG~~Ik~i~~~tg~~I~i~~~~~~~r~v~I~G~~~--------------------   57 (160)
T 2jzx_A            2 NVTLTIRLLMHG----KEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTN--------------------   57 (160)
T ss_dssp             CCEEEEEEEEEH----HHHHHHHCGGGHHHHHHHHHHCSEEEEECCTTTEEEEEEEEEHH--------------------
T ss_pred             CccEEEEEEEch----hheeeeECCCcHHHHHHHHHHCCEEEEcCCCCCceEEEEEeCHH--------------------
Confidence            467899999999    99999999999999999999999999999888999999999988                    


Q ss_pred             HHHHHHHHHHHHhhhhhhc-ccccCCCCCCCCCeEEEEEeccCcccceecCCchhHHHHHHhhCceEEeccCCCCCCCcc
Q psy11929         92 VDNVCTAYNFMCRSLEDYH-INRNRMENCSPQPLQLKLVIPATHCGSLIGKGGCKIKDIRDLSGANVQVASDMLPMSTER  170 (433)
Q Consensus        92 ~~~v~~A~~~I~~~~~~~~-~~~~~~~~~~~~~~~~~l~ip~~~vg~iIGk~G~~Ik~I~~~sga~I~i~~~~~~~~~er  170 (433)
                        ++.+|+.+|.+.+.+.. ..+.+.........+++++||.+++|+||||+|++|++|+++|||+|.+.++..|.+.++
T Consensus        58 --~v~~A~~~I~~~i~e~~~~~~~~~~~~~~~~~~~~i~vp~~~~g~iIGkgG~~Ik~i~~~tga~I~i~~~~~~~~~~~  135 (160)
T 2jzx_A           58 --AIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTER  135 (160)
T ss_dssp             --HHHHHHHHHHHHHHHHHTSCCCSSSCCCCCSEEEEEEEEHHHHHHHHCGGGHHHHHHHHHHSSEECCCCCCSTTCCEE
T ss_pred             --HHHHHHHHHHHHHHhhccccCCCCccCCCCCEEEEEEEChhheeeEECCCCHHHHHHHHHhCCeEEECCCCCCCCCce
Confidence              99999999998876632 111111112345689999999999999999999999999999999999998777888999


Q ss_pred             EEEEEccHHHHHHHHHHHHHHHHh
Q psy11929        171 IVTVHGNPDTISQAIYQICLVLIE  194 (433)
Q Consensus       171 ~v~I~G~~~~v~~A~~~I~~~l~e  194 (433)
                      .|+|+|+++++.+|+.+|.+++.|
T Consensus       136 ~v~I~G~~~~v~~A~~~I~~~i~e  159 (160)
T 2jzx_A          136 AITIAGIPQSIIECVKQICVVMLE  159 (160)
T ss_dssp             EEEEEECHHHHHHHHHHHHHHHHH
T ss_pred             EEEEEcCHHHHHHHHHHHHHHHhc
Confidence            999999999999999999999876



>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 Back     alignment and structure
>2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A Back     alignment and structure
>2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A Back     alignment and structure
>1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A Back     alignment and structure
>1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 433
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 6e-15
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 4e-09
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 8e-07
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 9e-15
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 3e-11
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 5e-09
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 2e-14
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 6e-10
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 1e-08
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 1e-13
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 2e-06
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 5e-06
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 3e-13
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 3e-08
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 3e-06
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 3e-13
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 4e-09
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 7e-07
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 4e-13
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 2e-08
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 7e-06
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 9e-13
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 4e-08
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 4e-07
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 1e-12
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 9e-10
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 2e-06
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 3e-12
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 3e-07
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 3e-05
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 3e-12
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 4e-08
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 1e-07
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 2e-11
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 1e-07
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 3e-07
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 2e-10
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 3e-07
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 9e-06
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 2e-09
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 1e-07
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 3e-04
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 3e-08
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 8e-06
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 3e-04
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 4e-08
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 1e-05
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 3e-05
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 4e-07
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 4e-04
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 3e-05
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 4e-04
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 1e-04
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 2e-04
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 0.001
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 2e-04
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 8e-04
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 7e-04
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 8e-04
d2ctfa190 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T 0.002
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Neuro-oncological ventral antigen 2, nova-2, KH3
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 67.2 bits (164), Expect = 6e-15
 Identities = 20/65 (30%), Positives = 38/65 (58%), Gaps = 2/65 (3%)

Query: 126 LKLVIPATHCGSLIGKGGCKIKDIRDLSGANVQV--ASDMLPMSTERIVTVHGNPDTISQ 183
           +++ +P    G+++GKGG  + + ++L+GA +Q+    + LP +  R VT+ G+P     
Sbjct: 5   VEMAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFLPGTRNRRVTITGSPAATQA 64

Query: 184 AIYQI 188
           A Y I
Sbjct: 65  AQYLI 69


>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query433
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 99.66
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 99.64
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 99.63
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 99.63
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 99.62
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 99.61
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 99.61
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 99.59
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 99.55
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 99.52
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 99.51
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 99.51
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.51
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.5
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 99.49
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 99.48
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.47
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 99.44
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 99.44
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.42
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.39
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.36
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.36
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.35
d2cpqa178 Fragile X mental retardation syndrome related prot 99.28
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.26
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.26
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 99.24
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.23
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 99.1
d2cpqa178 Fragile X mental retardation syndrome related prot 99.06
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.95
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 98.85
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 98.79
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.77
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 98.74
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 98.61
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 98.61
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.55
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 98.49
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.39
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 98.1
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 98.01
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 97.98
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 97.57
d1hh2p368 Transcription factor NusA, C-terminal domains {The 95.33
d2asba367 Transcription factor NusA, C-terminal domains {Myc 95.31
d2asba367 Transcription factor NusA, C-terminal domains {Myc 94.7
d1hh2p368 Transcription factor NusA, C-terminal domains {The 94.64
d1wh9a_92 Ribosomal protein S3 N-terminal domain {Mouse (Mus 87.15
d2ja9a285 Ribosomal RNA-processing protein 40, RRP40 {Saccha 84.46
d1egaa2113 GTPase Era C-terminal domain {Escherichia coli [Ta 84.11
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Poly(RC)-binding protein 1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.66  E-value=5.8e-17  Score=120.97  Aligned_cols=68  Identities=41%  Similarity=0.709  Sum_probs=64.1

Q ss_pred             ceEEEEEeCcccccccccCCCchHHHHHhHhCCeEEEccCCC-CCceEEEEEeCHHHHHHHHHHHHHHH
Q psy11929        287 FVETEIVLTDDIAGCVIGKAGSRLLEIRQISGAQINIHTGTE-SHKKMFHIQGCQEAVSLAQYLINMCI  354 (433)
Q Consensus       287 ~~t~~i~VP~~~vG~IIGkgG~~Ik~I~~~sGA~I~I~~~~~-~~er~V~IsGt~e~v~~A~~lI~~~i  354 (433)
                      +.|.+|.||..++|+||||+|.+|++|++.|||+|.|+++.+ +++|.|+|+|+++++++|+.+|+++|
T Consensus         1 q~T~~i~VP~~~vg~iIGk~G~~I~~I~~~tga~I~i~~~~~~~~~r~v~I~G~~~~v~~A~~~I~~~i   69 (70)
T d1wvna1           1 QTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARL   69 (70)
T ss_dssp             CEEEEEEEEGGGHHHHHCGGGHHHHHHHHHHCCEEEECCCCTTCSEEEEEEEECHHHHHHHHHHHHHHT
T ss_pred             CeEEEEEEChHhcceeECCCChHHHHHHHHcCcEEEEcCCCCCCCcEEEEEEeCHHHHHHHHHHHHHHc
Confidence            357899999999999999999999999999999999988776 88999999999999999999999886



>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure