Psyllid ID: psy11929
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 433 | ||||||
| 116007842 | 539 | mushroom-body expressed, isoform D [Dros | 0.739 | 0.593 | 0.408 | 7e-65 | |
| 195377361 | 589 | GJ11921 [Drosophila virilis] gi|19415461 | 0.736 | 0.541 | 0.407 | 2e-64 | |
| 189234912 | 446 | PREDICTED: similar to AGAP004942-PA [Tri | 0.914 | 0.887 | 0.386 | 1e-63 | |
| 328720738 | 436 | PREDICTED: poly(rC)-binding protein 3-li | 0.859 | 0.853 | 0.348 | 5e-63 | |
| 328778258 | 466 | PREDICTED: poly(rC)-binding protein 3-li | 0.743 | 0.690 | 0.427 | 3e-62 | |
| 307199010 | 469 | Poly(rC)-binding protein 3 [Harpegnathos | 0.759 | 0.701 | 0.435 | 4e-62 | |
| 350405177 | 466 | PREDICTED: poly(rC)-binding protein 3-li | 0.743 | 0.690 | 0.424 | 7e-62 | |
| 340726176 | 466 | PREDICTED: poly(rC)-binding protein 3-li | 0.741 | 0.688 | 0.426 | 7e-62 | |
| 345486914 | 476 | PREDICTED: poly(rC)-binding protein 3-li | 0.780 | 0.710 | 0.432 | 1e-61 | |
| 45553235 | 364 | mushroom-body expressed, isoform C [Dros | 0.732 | 0.870 | 0.401 | 1e-61 |
| >gi|116007842|ref|NP_001036619.1| mushroom-body expressed, isoform D [Drosophila melanogaster] gi|113194920|gb|ABI31266.1| mushroom-body expressed, isoform D [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Score = 254 bits (649), Expect = 7e-65, Method: Compositional matrix adjust.
Identities = 146/357 (40%), Positives = 207/357 (57%), Gaps = 37/357 (10%)
Query: 10 DEDTLITMRCLFHSSVNVNEISCLIGPGGCIVRRLRKESGAKISITDGACPDRIVTVSGS 69
D +T+R + E+ +IG G IV R R+ESGAKI+I+DG+CP+RIVTVSG+
Sbjct: 19 DPSVTLTIRLIMQGK----EVGSIIGKKGEIVNRFREESGAKINISDGSCPERIVTVSGT 74
Query: 70 VDNSSTSSVETGYPGHTLWVTSVDNVCTAYNFMCRSLEDYHINRNRMENCSPQPLQLKLV 129
+ + +A+ + + E++ N + + ++L+
Sbjct: 75 TNA----------------------IFSAFTLITKKFEEWCSQFNDVGKVGKTQIPIRLI 112
Query: 130 IPATHCGSLIGKGGCKIKDIRDLSGANVQVASDMLPMSTERIVTVHGNPDTISQAIYQIC 189
+PA+ CGSLIGK G KIK+IR +G ++QVAS+MLP STER VT+ G+ + I+Q IYQIC
Sbjct: 113 VPASQCGSLIGKSGSKIKEIRQTTGCSIQVASEMLPNSTERAVTLSGSAEQITQCIYQIC 172
Query: 190 LVLIECTLQVVKGAVIPYEPKTMNAGPVILSGGQAYTLHGEYAVPVQEVAGKKQPHPLAG 249
LV++E +GA IPY PK GPVIL+ GQA+T+ G YAVP QEVA K P
Sbjct: 173 LVMLESP---PRGATIPYRPKPQVTGPVILANGQAFTIQGNYAVPTQEVA--KNPLASLA 227
Query: 250 LAVLGIEGIGSTSLT--PAALAALSGSRVKSGGKDTGDDFVETEIVLTDDIAGCVIGKAG 307
L ST AALAAL+GS++++ + E+ +++D+ GC+IGK G
Sbjct: 228 ALGLAGMNPASTGGINHTAALAALAGSQLRTANPANRAQQQQHEMTVSNDLIGCIIGKGG 287
Query: 308 SRLLEIRQISGAQINIHTGTESH----KKMFHIQGCQEAVSLAQYLINMCIELQKNN 360
+++ EIRQISGA I I E + I G ++V+LAQYLINM +ELQK N
Sbjct: 288 TKIAEIRQISGAMIRISNCEEREGGNTDRTITISGNPDSVALAQYLINMSVELQKAN 344
|
Source: Drosophila melanogaster Species: Drosophila melanogaster Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195377361|ref|XP_002047459.1| GJ11921 [Drosophila virilis] gi|194154617|gb|EDW69801.1| GJ11921 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|189234912|ref|XP_969611.2| PREDICTED: similar to AGAP004942-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|328720738|ref|XP_001949210.2| PREDICTED: poly(rC)-binding protein 3-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328778258|ref|XP_391921.3| PREDICTED: poly(rC)-binding protein 3-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|307199010|gb|EFN79734.1| Poly(rC)-binding protein 3 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|350405177|ref|XP_003487350.1| PREDICTED: poly(rC)-binding protein 3-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340726176|ref|XP_003401437.1| PREDICTED: poly(rC)-binding protein 3-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|345486914|ref|XP_001607400.2| PREDICTED: poly(rC)-binding protein 3-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|45553235|ref|NP_996145.1| mushroom-body expressed, isoform C [Drosophila melanogaster] gi|194876029|ref|XP_001973701.1| GG16232 [Drosophila erecta] gi|195496648|ref|XP_002095782.1| GE22592 [Drosophila yakuba] gi|16648354|gb|AAL25442.1| LD32520p [Drosophila melanogaster] gi|45446078|gb|AAS65095.1| mushroom-body expressed, isoform C [Drosophila melanogaster] gi|190655484|gb|EDV52727.1| GG16232 [Drosophila erecta] gi|194181883|gb|EDW95494.1| GE22592 [Drosophila yakuba] gi|220951950|gb|ACL88518.1| mub-PC [synthetic construct] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 433 | ||||||
| UNIPROTKB|F1NPL2 | 319 | PCBP3 "Uncharacterized protein | 0.341 | 0.463 | 0.474 | 3.1e-57 | |
| RGD|1307430 | 319 | Pcbp3 "poly(rC) binding protei | 0.341 | 0.463 | 0.487 | 1.7e-56 | |
| UNIPROTKB|B4DXP5 | 322 | PCBP2 "Poly(rC)-binding protei | 0.293 | 0.394 | 0.527 | 1.5e-55 | |
| MGI|MGI:1890470 | 371 | Pcbp3 "poly(rC) binding protei | 0.605 | 0.706 | 0.405 | 3.3e-55 | |
| UNIPROTKB|D4A1P3 | 371 | Pcbp3 "Protein Pcbp3" [Rattus | 0.605 | 0.706 | 0.405 | 3.3e-55 | |
| UNIPROTKB|G3V0E8 | 318 | PCBP2 "Poly(RC) binding protei | 0.286 | 0.389 | 0.523 | 4.9e-55 | |
| UNIPROTKB|E2QUE1 | 371 | PCBP3 "Uncharacterized protein | 0.605 | 0.706 | 0.405 | 6.9e-55 | |
| UNIPROTKB|P57721 | 371 | PCBP3 "Poly(rC)-binding protei | 0.605 | 0.706 | 0.405 | 6.9e-55 | |
| UNIPROTKB|P57723 | 403 | PCBP4 "Poly(rC)-binding protei | 0.281 | 0.302 | 0.519 | 1e-54 | |
| UNIPROTKB|E2RCH9 | 370 | PCBP3 "Uncharacterized protein | 0.602 | 0.705 | 0.401 | 1.4e-54 |
| UNIPROTKB|F1NPL2 PCBP3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 353 (129.3 bits), Expect = 3.1e-57, Sum P(3) = 3.1e-57
Identities = 73/154 (47%), Positives = 100/154 (64%)
Query: 83 PGHTLWVTS-VDNVCTAYNFMCRSLE-DYHINRNRMENCSPQPLQLKLVIPATHCGSLIG 140
P + +T D + A++ + E D + + S P+ L+LV+PA+ CGSLIG
Sbjct: 55 PERIVTITGPTDAIFKAFSMIALKFEEDINASMTNSTVTSKPPVTLRLVVPASQCGSLIG 114
Query: 141 KGGCKIKDIRDLSGANVQVASDMLPMSTERIVTVHGNPDTISQAIYQICLVLIECTLQVV 200
KGG KIK+IR+ +GA VQVA DMLP STER VT+ G PD I Q + QIC+V++E
Sbjct: 115 KGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESP---P 171
Query: 201 KGAVIPYEPKTMNAGPVILSGGQAYTLHGEYAVP 234
KGA IPY PK +A P+I +GGQA+T+ G+YA+P
Sbjct: 172 KGATIPYRPKPASA-PIIFAGGQAFTIQGQYAIP 204
|
|
| RGD|1307430 Pcbp3 "poly(rC) binding protein 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4DXP5 PCBP2 "Poly(rC)-binding protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1890470 Pcbp3 "poly(rC) binding protein 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A1P3 Pcbp3 "Protein Pcbp3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V0E8 PCBP2 "Poly(RC) binding protein 2, isoform CRA_f" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QUE1 PCBP3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P57721 PCBP3 "Poly(rC)-binding protein 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P57723 PCBP4 "Poly(rC)-binding protein 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RCH9 PCBP3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 433 | |||
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 5e-21 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 2e-13 | |
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 1e-11 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 1e-10 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 1e-10 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 1e-08 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 2e-08 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 4e-08 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 2e-07 | |
| pfam00013 | 59 | pfam00013, KH_1, KH domain | 2e-07 | |
| smart00322 | 68 | smart00322, KH, K homology RNA-binding domain | 7e-07 | |
| cd00105 | 64 | cd00105, KH-I, K homology RNA-binding domain, type | 1e-06 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 1e-06 | |
| cd02394 | 62 | cd02394, vigilin_like_KH, K homology RNA-binding d | 6e-05 | |
| cd02394 | 62 | cd02394, vigilin_like_KH, K homology RNA-binding d | 3e-04 | |
| pfam13014 | 42 | pfam13014, KH_3, KH domain | 0.001 | |
| cd02393 | 61 | cd02393, PNPase_KH, Polynucleotide phosphorylase ( | 0.001 | |
| cd02396 | 65 | cd02396, PCBP_like_KH, K homology RNA-binding doma | 0.002 | |
| cd02395 | 120 | cd02395, SF1_like-KH, Splicing factor 1 (SF1) K ho | 0.002 | |
| COG1185 | 692 | COG1185, Pnp, Polyribonucleotide nucleotidyltransf | 0.003 | |
| TIGR03591 | 684 | TIGR03591, polynuc_phos, polyribonucleotide nucleo | 0.003 |
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
Score = 86.0 bits (214), Expect = 5e-21
Identities = 29/65 (44%), Positives = 47/65 (72%)
Query: 125 QLKLVIPATHCGSLIGKGGCKIKDIRDLSGANVQVASDMLPMSTERIVTVHGNPDTISQA 184
L+L++P++ GS+IGKGG IK+IR+ +GA ++V+ +LP STER+VT+ G P + +A
Sbjct: 1 TLRLLVPSSQAGSIIGKGGSTIKEIREETGAKIRVSKSVLPGSTERVVTISGKPSAVQKA 60
Query: 185 IYQIC 189
+ I
Sbjct: 61 LLLIL 65
|
Members of this group possess KH domains in a tandem arrangement. Most members, similar to the poly(C) binding proteins (PCBPs) and Nova, containing three KH domains, with the first and second domains, which are represented here, in tandem arrangement, followed by a large spacer region, with the third domain near the C-terminal end of the protein. The poly(C) binding proteins (PCBPs) can be divided into two groups, hnRNPs K/J and the alphaCPs, which share a triple KH domain configuration and poly(C) binding specificity. They play roles in mRNA stabilization, translational activation, and translational silencing. Nova-1 and Nova-2 are nuclear RNA-binding proteins that regulate splicing. This group also contains plant proteins that seem to have two tandem repeat arrrangements, like Hen4, a protein that plays a role in AGAMOUS (AG) pre-mRNA processing and important step in plant development. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. Length = 65 |
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|215657 pfam00013, KH_1, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >gnl|CDD|221895 pfam13014, KH_3, KH domain | Back alignment and domain information |
|---|
| >gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >gnl|CDD|239088 cd02395, SF1_like-KH, Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 433 | |||
| KOG2193|consensus | 584 | 100.0 | ||
| KOG2192|consensus | 390 | 100.0 | ||
| KOG1676|consensus | 600 | 100.0 | ||
| KOG2190|consensus | 485 | 100.0 | ||
| KOG1676|consensus | 600 | 100.0 | ||
| KOG2193|consensus | 584 | 99.97 | ||
| KOG2191|consensus | 402 | 99.97 | ||
| KOG2191|consensus | 402 | 99.93 | ||
| KOG2190|consensus | 485 | 99.93 | ||
| KOG2192|consensus | 390 | 99.76 | ||
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 99.67 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 99.64 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 99.64 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 99.6 | |
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 99.47 | |
| KOG2279|consensus | 608 | 99.43 | ||
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 99.41 | |
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 99.33 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 99.31 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 99.25 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 99.24 | |
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 99.22 | |
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 99.21 | |
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 99.1 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 99.06 | |
| PF13014 | 43 | KH_3: KH domain | 99.01 | |
| smart00322 | 69 | KH K homology RNA-binding domain. | 98.95 | |
| PF13014 | 43 | KH_3: KH domain | 98.94 | |
| KOG2208|consensus | 753 | 98.89 | ||
| smart00322 | 69 | KH K homology RNA-binding domain. | 98.85 | |
| KOG2208|consensus | 753 | 98.84 | ||
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 98.81 | |
| KOG2279|consensus | 608 | 98.69 | ||
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 98.5 | |
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 98.39 | |
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 98.33 | |
| KOG2113|consensus | 394 | 98.26 | ||
| KOG2113|consensus | 394 | 98.12 | ||
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 98.06 | |
| PRK08406 | 140 | transcription elongation factor NusA-like protein; | 98.05 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 97.96 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 97.79 | |
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 97.59 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 97.5 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 97.49 | |
| KOG0119|consensus | 554 | 97.46 | ||
| KOG0336|consensus | 629 | 97.46 | ||
| KOG1588|consensus | 259 | 97.39 | ||
| TIGR01952 | 141 | nusA_arch NusA family KH domain protein, archaeal. | 97.29 | |
| KOG0119|consensus | 554 | 97.16 | ||
| KOG2814|consensus | 345 | 97.11 | ||
| COG0195 | 190 | NusA Transcription elongation factor [Transcriptio | 97.09 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 97.06 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 97.01 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 96.9 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 96.85 | |
| KOG2814|consensus | 345 | 96.83 | ||
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 96.76 | |
| KOG0336|consensus | 629 | 96.7 | ||
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 96.69 | |
| PF14611 | 210 | SLS: Mitochondrial inner-membrane-bound regulator | 96.5 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 96.27 | |
| PRK00468 | 75 | hypothetical protein; Provisional | 96.25 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 96.22 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 96.15 | |
| COG0195 | 190 | NusA Transcription elongation factor [Transcriptio | 96.13 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 96.1 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 96.06 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 96.06 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 96.02 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 96.02 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 95.99 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 95.95 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 95.94 | |
| KOG1588|consensus | 259 | 95.92 | ||
| PRK02821 | 77 | hypothetical protein; Provisional | 95.84 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 95.8 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 95.79 | |
| COG1837 | 76 | Predicted RNA-binding protein (contains KH domain) | 95.79 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 95.68 | |
| PF14611 | 210 | SLS: Mitochondrial inner-membrane-bound regulator | 95.63 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 95.54 | |
| COG5176 | 269 | MSL5 Splicing factor (branch point binding protein | 95.39 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 95.38 | |
| PRK01064 | 78 | hypothetical protein; Provisional | 95.33 | |
| PRK02821 | 77 | hypothetical protein; Provisional | 95.3 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 95.26 | |
| PRK00468 | 75 | hypothetical protein; Provisional | 95.25 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 95.11 | |
| COG1837 | 76 | Predicted RNA-binding protein (contains KH domain) | 94.99 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 94.97 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 94.61 | |
| COG5176 | 269 | MSL5 Splicing factor (branch point binding protein | 94.53 | |
| KOG4369|consensus | 2131 | 94.21 | ||
| PRK12705 | 508 | hypothetical protein; Provisional | 94.04 | |
| PRK01064 | 78 | hypothetical protein; Provisional | 94.01 | |
| KOG1067|consensus | 760 | 93.6 | ||
| PRK12705 | 508 | hypothetical protein; Provisional | 93.39 | |
| KOG4369|consensus | 2131 | 92.0 | ||
| PF13083 | 73 | KH_4: KH domain; PDB: 3GKU_B. | 91.97 | |
| cd02409 | 68 | KH-II KH-II (K homology RNA-binding domain, type I | 91.49 | |
| PF13184 | 69 | KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW | 90.95 | |
| PF13184 | 69 | KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW | 90.27 | |
| KOG1067|consensus | 760 | 89.92 | ||
| KOG3273|consensus | 252 | 89.36 | ||
| PF13083 | 73 | KH_4: KH domain; PDB: 3GKU_B. | 89.33 | |
| cd02409 | 68 | KH-II KH-II (K homology RNA-binding domain, type I | 89.3 | |
| PF07650 | 78 | KH_2: KH domain syndrome, contains KH motifs.; Int | 88.25 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 87.38 | |
| cd02414 | 77 | jag_KH jag_K homology RNA-binding domain. The KH d | 87.25 | |
| KOG3273|consensus | 252 | 86.88 | ||
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 86.5 | |
| cd02413 | 81 | 40S_S3_KH K homology RNA-binding (KH) domain of th | 85.87 | |
| cd02410 | 145 | archeal_CPSF_KH The archaeal cleavage and polyaden | 85.44 | |
| COG5166 | 657 | Uncharacterized conserved protein [Function unknow | 84.54 | |
| cd02410 | 145 | archeal_CPSF_KH The archaeal cleavage and polyaden | 84.04 | |
| PRK13764 | 602 | ATPase; Provisional | 83.84 | |
| cd02414 | 77 | jag_KH jag_K homology RNA-binding domain. The KH d | 83.36 | |
| PF07650 | 78 | KH_2: KH domain syndrome, contains KH motifs.; Int | 82.6 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 82.45 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 81.57 | |
| PRK06418 | 166 | transcription elongation factor NusA-like protein; | 80.83 | |
| KOG2874|consensus | 356 | 80.79 |
| >KOG2193|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.1e-53 Score=404.28 Aligned_cols=329 Identities=20% Similarity=0.309 Sum_probs=257.6
Q ss_pred CceEEEEEEeccCCcccccceeeecCchHHHHHHHHhCCeEEEeC---CCCCcceEEEecccCCCCCCccccCCCCCccc
Q psy11929 12 DTLITMRCLFHSSVNVNEISCLIGPGGCIVRRLRKESGAKISITD---GACPDRIVTVSGSVDNSSTSSVETGYPGHTLW 88 (433)
Q Consensus 12 ~~~~~~rilvp~~~~~~~vg~IIGk~G~~Ik~I~~~tga~I~v~~---~~~~eRvv~I~G~~~~~~~~~v~~~~~~~~~~ 88 (433)
..++++|+|||. .+||.||||.|.|||.|...|.|+|+|.. .|..||+|+|.|+++
T Consensus 196 ~~D~PlR~lVpt----qyvgaIIGkeG~TIknItkqTqsriD~hrken~Gaaek~itvh~tpE----------------- 254 (584)
T KOG2193|consen 196 LKDWPLRLLVPT----QYVGAIIGKEGATIKNITKQTQSRIDVHRKENAGAAEKIITVHSTPE----------------- 254 (584)
T ss_pred ccCcceeeeecc----ceeEEEecCCCccccCcchhhhheeeeeecccCCcccCceEEecCcc-----------------
Confidence 357999999999 99999999999999999999999999986 378999999999999
Q ss_pred cchHHHHHHHHHHHHhhhhhhcccccCCCCCCCCCeEEEEEeccCcccceecCCchhHHHHHHhhCceEEecc--CCCCC
Q psy11929 89 VTSVDNVCTAYNFMCRSLEDYHINRNRMENCSPQPLQLKLVIPATHCGSLIGKGGCKIKDIRDLSGANVQVAS--DMLPM 166 (433)
Q Consensus 89 ~~a~~~v~~A~~~I~~~~~~~~~~~~~~~~~~~~~~~~~l~ip~~~vg~iIGk~G~~Ik~I~~~sga~I~i~~--~~~~~ 166 (433)
...+|+++|++++...... +.-...+.++++.++.+||+||||.|++||+|+.+||++|.|++ +....
T Consensus 255 -----g~s~Ac~~ILeimqkEA~~-----~k~~~e~pLk~lAHN~lvGRLIGKeGrnlKkIeq~TgTkITis~lqels~y 324 (584)
T KOG2193|consen 255 -----GTSKACKMILEIMQKEAVD-----DKVAEEIPLKILAHNNLVGRLIGKEGRNLKKIEQDTGTKITISKLQELSLY 324 (584)
T ss_pred -----chHHHHHHHHHHHHHhhhc-----cchhhhcchhhhhhcchhhhhhhhccccHHHHHhhcCCceeeeehhhhccc
Confidence 8999999999998764321 12246788999999999999999999999999999999999986 43335
Q ss_pred CCccEEEEEccHHHHHHHHHHHHHHHHhhccccCCCcccccCCCCCCCCCccccCCcccccCCCCCCCcccccCCCCCCC
Q psy11929 167 STERIVTVHGNPDTISQAIYQICLVLIECTLQVVKGAVIPYEPKTMNAGPVILSGGQAYTLHGEYAVPVQEVAGKKQPHP 246 (433)
Q Consensus 167 ~~er~v~I~G~~~~v~~A~~~I~~~l~e~~~~~~~~~~~~~~p~~~~~~p~~~~g~~~~~~~g~~~~P~~~~~~~~~~~p 246 (433)
..||+|++.|+.++|.+|..+|+.+|++|++++... ..++.+.. |.+.. ..+ |.+ |.
T Consensus 325 npERTItVkGsiEac~~AE~eImkKlre~yEnDl~a--~s~q~~l~---P~l~~--~~l---~~f--~s----------- 381 (584)
T KOG2193|consen 325 NPERTITVKGSIEACVQAEAEIMKKLRECYENDLAA--MSLQCHLP---PGLNL--PAL---GLF--PS----------- 381 (584)
T ss_pred CccceEEecccHHHHHHHHHHHHHHHHHHHhhhHHH--hhccCCCC---cccCc--ccc---CCC--Cc-----------
Confidence 679999999999999999999999999999866432 11111100 00000 000 000 00
Q ss_pred CccccccCcCCCCCCCC---CccccccccCCCcccCCCCCCCCceEEEEEeCcccccccccCCCchHHHHHhHhCCeEEE
Q psy11929 247 LAGLAVLGIEGIGSTSL---TPAALAALSGSRVKSGGKDTGDDFVETEIVLTDDIAGCVIGKAGSRLLEIRQISGAQINI 323 (433)
Q Consensus 247 ~~~~~~~~~~~~~~p~~---~~~~~~~~~~~~~~~~~~~~~~~~~t~~i~VP~~~vG~IIGkgG~~Ik~I~~~sGA~I~I 323 (433)
..++.+++||-. ..++|+ ......+...++|+||...||+||||+|.+||+|.+++||+|+|
T Consensus 382 -----sS~~~~Ph~~Ps~v~~a~p~~----------~~hq~pe~e~V~~fiP~~~vGAiIGkkG~hIKql~RfagASiKI 446 (584)
T KOG2193|consen 382 -----SSAVSPPHFPPSPVTFASPYP----------LFHQNPEQEQVRMFIPAQAVGAIIGKKGQHIKQLSRFAGASIKI 446 (584)
T ss_pred -----ccccCCCCCCCCccccCCCch----------hhhcCcchhheeeeccHHHHHHHHhhcchhHHHHHHhccceeee
Confidence 001111111100 000111 01123367788999999999999999999999999999999999
Q ss_pred ccCCC--CCceEEEEEeCHHHHHHHHHHHHHHHHhccccCCCCCCCCCccccccccccchhccccccccccCCCCCccee
Q psy11929 324 HTGTE--SHKKMFHIQGCQEAVSLAQYLINMCIELQKNNTTNTSDNPEPADLDAAISAFMTASVNSSLIEKPTPHPGSMV 401 (433)
Q Consensus 324 ~~~~~--~~er~V~IsGt~e~v~~A~~lI~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vP~~~~G~ii 401 (433)
.+++. ..+|+|+|+|.+++..+|+..|+.+|.++..-. . .+.++++. ++.||++.+||||
T Consensus 447 appE~pdvseRMViItGppeaqfKAQgrifgKikEenf~~--P---keevklet-------------hirVPs~~aGRvI 508 (584)
T KOG2193|consen 447 APPEIPDVSERMVIITGPPEAQFKAQGRIFGKIKEENFFL--P---KEEVKLET-------------HIRVPSSAAGRVI 508 (584)
T ss_pred cCCCCCCcceeEEEecCChHHHHhhhhhhhhhhhhhccCC--c---hhhheeee-------------eeeccchhhhhhh
Confidence 98876 889999999999999999999999999874322 2 24566664 4669999999999
Q ss_pred cccc--HHHHHHhhhccccccceeecccc
Q psy11929 402 TLGG--LSELLANIAASNVKSTVQTTGAY 428 (433)
Q Consensus 402 GkgG--~~e~~~~~~~~~~~~~~~~~~~~ 428 (433)
|||| ++|| ||||+|+|++|++-|+-.
T Consensus 509 GKGGktVnEL-Qnlt~AeV~vPrdqtpdE 536 (584)
T KOG2193|consen 509 GKGGKTVNEL-QNLTSAEVVVPRDQTPDE 536 (584)
T ss_pred ccccccHHHH-hccccceEEccccCCCCc
Confidence 9999 7999 999999999999987643
|
|
| >KOG2192|consensus | Back alignment and domain information |
|---|
| >KOG1676|consensus | Back alignment and domain information |
|---|
| >KOG2190|consensus | Back alignment and domain information |
|---|
| >KOG1676|consensus | Back alignment and domain information |
|---|
| >KOG2193|consensus | Back alignment and domain information |
|---|
| >KOG2191|consensus | Back alignment and domain information |
|---|
| >KOG2191|consensus | Back alignment and domain information |
|---|
| >KOG2190|consensus | Back alignment and domain information |
|---|
| >KOG2192|consensus | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >KOG2279|consensus | Back alignment and domain information |
|---|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >KOG2208|consensus | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >KOG2208|consensus | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2279|consensus | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG2113|consensus | Back alignment and domain information |
|---|
| >KOG2113|consensus | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >PRK08406 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >KOG0119|consensus | Back alignment and domain information |
|---|
| >KOG0336|consensus | Back alignment and domain information |
|---|
| >KOG1588|consensus | Back alignment and domain information |
|---|
| >TIGR01952 nusA_arch NusA family KH domain protein, archaeal | Back alignment and domain information |
|---|
| >KOG0119|consensus | Back alignment and domain information |
|---|
| >KOG2814|consensus | Back alignment and domain information |
|---|
| >COG0195 NusA Transcription elongation factor [Transcription] | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2814|consensus | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG0336|consensus | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PF14611 SLS: Mitochondrial inner-membrane-bound regulator | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00468 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >COG0195 NusA Transcription elongation factor [Transcription] | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >KOG1588|consensus | Back alignment and domain information |
|---|
| >PRK02821 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PF14611 SLS: Mitochondrial inner-membrane-bound regulator | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >PRK01064 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02821 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK00468 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4369|consensus | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK01064 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1067|consensus | Back alignment and domain information |
|---|
| >PRK12705 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4369|consensus | Back alignment and domain information |
|---|
| >PF13083 KH_4: KH domain; PDB: 3GKU_B | Back alignment and domain information |
|---|
| >cd02409 KH-II KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A | Back alignment and domain information |
|---|
| >PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A | Back alignment and domain information |
|---|
| >KOG1067|consensus | Back alignment and domain information |
|---|
| >KOG3273|consensus | Back alignment and domain information |
|---|
| >PF13083 KH_4: KH domain; PDB: 3GKU_B | Back alignment and domain information |
|---|
| >cd02409 KH-II KH-II (K homology RNA-binding domain, type II) | Back alignment and domain information |
|---|
| >PF07650 KH_2: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >cd02414 jag_KH jag_K homology RNA-binding domain | Back alignment and domain information |
|---|
| >KOG3273|consensus | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3 | Back alignment and domain information |
|---|
| >cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >COG5166 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >cd02414 jag_KH jag_K homology RNA-binding domain | Back alignment and domain information |
|---|
| >PF07650 KH_2: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK06418 transcription elongation factor NusA-like protein; Validated | Back alignment and domain information |
|---|
| >KOG2874|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 433 | ||||
| 2jzx_A | 160 | Pcbp2 Kh1-Kh2 Domains Length = 160 | 2e-29 | ||
| 2p2r_A | 76 | Crystal Structure Of The Third Kh Domain Of Human P | 1e-08 | ||
| 1wvn_A | 82 | Crsytal Structure Of Domain 3 Of Human Alpha Polyc | 5e-08 | ||
| 2anr_A | 178 | Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TAND | 1e-07 | ||
| 2anr_A | 178 | Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TAND | 5e-04 | ||
| 2ann_A | 178 | Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDE | 1e-07 | ||
| 2ann_A | 178 | Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDE | 5e-04 | ||
| 1j5k_A | 89 | Complex Of The Kh3 Domain Of Hnrnp K With A Single_ | 1e-06 | ||
| 1zzi_A | 82 | Crystal Structure Analysis Of The Third Kh Domain O | 4e-06 | ||
| 1zzi_A | 82 | Crystal Structure Analysis Of The Third Kh Domain O | 6e-06 | ||
| 1khm_A | 89 | C-Terminal Kh Domain Of Hnrnp K (Kh3) Length = 89 | 5e-06 | ||
| 1ztg_A | 74 | Human Alpha Polyc Binding Protein Kh1 Length = 74 | 1e-05 | ||
| 3vke_A | 76 | Contribution Of The First K-Homology Domain Of Poly | 1e-04 | ||
| 2axy_A | 73 | Crystal Structure Of Kh1 Domain Of Human Poly(C)-Bi | 2e-04 | ||
| 1dtj_A | 76 | Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Bind | 6e-04 | ||
| 1ec6_A | 87 | Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Bind | 8e-04 |
| >pdb|2JZX|A Chain A, Pcbp2 Kh1-Kh2 Domains Length = 160 | Back alignment and structure |
|
| >pdb|2P2R|A Chain A, Crystal Structure Of The Third Kh Domain Of Human Poly(C)- Binding Protein-2 In Complex With C-Rich Strand Of Human Telomeric Dna Length = 76 | Back alignment and structure |
| >pdb|1WVN|A Chain A, Crsytal Structure Of Domain 3 Of Human Alpha Polyc Binding Protein Length = 82 | Back alignment and structure |
| >pdb|2ANR|A Chain A, Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25NT RNA Hairpin Length = 178 | Back alignment and structure |
| >pdb|2ANR|A Chain A, Crystal Structure (Ii) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25NT RNA Hairpin Length = 178 | Back alignment and structure |
| >pdb|2ANN|A Chain A, Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25 NT RNA Hairpin Length = 178 | Back alignment and structure |
| >pdb|2ANN|A Chain A, Crystal Structure (I) Of Nova-1 Kh1KH2 DOMAIN TANDEM WITH 25 NT RNA Hairpin Length = 178 | Back alignment and structure |
| >pdb|1J5K|A Chain A, Complex Of The Kh3 Domain Of Hnrnp K With A Single_stranded 10mer Dna Oligonucleotide Length = 89 | Back alignment and structure |
| >pdb|1ZZI|A Chain A, Crystal Structure Analysis Of The Third Kh Domain Of Hnrnp K In Complex With Ssdna Length = 82 | Back alignment and structure |
| >pdb|1ZZI|A Chain A, Crystal Structure Analysis Of The Third Kh Domain Of Hnrnp K In Complex With Ssdna Length = 82 | Back alignment and structure |
| >pdb|1KHM|A Chain A, C-Terminal Kh Domain Of Hnrnp K (Kh3) Length = 89 | Back alignment and structure |
| >pdb|1ZTG|A Chain A, Human Alpha Polyc Binding Protein Kh1 Length = 74 | Back alignment and structure |
| >pdb|3VKE|A Chain A, Contribution Of The First K-Homology Domain Of Poly(C)-Binding Protein 1 To Its Affinity And Specificity For C-Rich Oligonucleotides Length = 76 | Back alignment and structure |
| >pdb|2AXY|A Chain A, Crystal Structure Of Kh1 Domain Of Human Poly(C)-Binding Protein-2 With C-Rich Strand Of Human Telomeric Dna Length = 73 | Back alignment and structure |
| >pdb|1DTJ|A Chain A, Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Binding Domain Length = 76 | Back alignment and structure |
| >pdb|1EC6|A Chain A, Crystal Structure Of Nova-2 Kh3 K-Homology Rna-Binding Domain Bound To 20-Mer Rna Hairpin Length = 87 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 433 | |||
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 6e-41 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 3e-14 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 2e-09 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 1e-06 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 2e-34 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 4e-16 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 9e-11 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 2e-06 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 2e-33 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 3e-16 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 7e-10 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 7e-06 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 1e-30 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 3e-14 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 3e-09 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 8e-06 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 2e-30 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 2e-16 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 5e-10 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 3e-06 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 3e-18 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 3e-14 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 9e-07 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 4e-18 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 1e-14 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 6e-07 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 1e-17 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 4e-14 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 1e-07 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 3e-17 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 5e-14 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 4e-07 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 3e-17 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 7e-12 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 1e-06 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 3e-17 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 6e-12 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 6e-06 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 5e-17 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 7e-15 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 1e-07 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 5e-17 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 1e-14 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 2e-07 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 6e-17 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 2e-15 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 2e-08 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 8e-17 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 1e-10 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 7e-07 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 1e-16 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 5e-12 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 4e-05 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 3e-15 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 6e-12 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 2e-06 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 1e-14 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 2e-14 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 3e-07 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 4e-10 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 4e-07 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-05 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 2e-09 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 4e-05 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 2e-09 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 1e-06 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 8e-09 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 7e-05 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 4e-08 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 2e-05 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 5e-08 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 2e-07 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-06 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 4e-07 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 1e-04 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 2e-06 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 5e-05 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 7e-05 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 9e-04 |
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
Score = 142 bits (359), Expect = 6e-41
Identities = 71/185 (38%), Positives = 110/185 (59%), Gaps = 27/185 (14%)
Query: 11 EDTLITMRCLFHSSVNVNEISCLIGPGGCIVRRLRKESGAKISITDGACPDRIVTVSGSV 70
++ +T+R L H E+ +IG G V+++R+ESGA+I+I++G CP+RI+T++G
Sbjct: 1 KNVTLTIRLLMHGK----EVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPT 56
Query: 71 DNSSTSSVETGYPGHTLWVTSVDNVCTAYNFMCRSLEDYHINR-NRMENCSPQPLQLKLV 129
+ + A+ + LE+ + S P+ L+LV
Sbjct: 57 NA----------------------IFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLV 94
Query: 130 IPATHCGSLIGKGGCKIKDIRDLSGANVQVASDMLPMSTERIVTVHGNPDTISQAIYQIC 189
+PA+ CGSLIGKGGCKIK+IR+ +GA VQVA DMLP STER +T+ G P +I + + QIC
Sbjct: 95 VPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSIIECVKQIC 154
Query: 190 LVLIE 194
+V++E
Sbjct: 155 VVMLE 159
|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Length = 376 | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Length = 630 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 433 | |||
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 99.95 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 99.94 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 99.94 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 99.94 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 99.94 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 99.93 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 99.93 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 99.93 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 99.93 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 99.92 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 99.92 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 99.78 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 99.77 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 99.71 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 99.67 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 99.62 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 99.61 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 99.6 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 99.6 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 99.58 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 99.58 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 99.58 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 99.57 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 99.56 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 99.56 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 99.56 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 99.55 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 99.53 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 99.52 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 99.51 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 99.51 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 99.51 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 99.47 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 99.46 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 99.46 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 99.46 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 99.46 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 99.45 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 99.45 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 99.45 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 99.44 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 99.43 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.43 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 99.42 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 99.42 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 99.41 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 99.41 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 99.38 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 99.36 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 99.35 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 99.35 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 99.33 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 99.32 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 99.32 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.29 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.27 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 99.21 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 99.21 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 99.18 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 99.13 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 98.96 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 98.68 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 98.63 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 98.63 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 98.58 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 98.58 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 98.3 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 98.09 | |
| 3v69_A | 140 | Protein filia; RNA-binding, embryogenesis, KH doma | 98.08 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 97.95 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 97.87 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 97.64 | |
| 3v69_A | 140 | Protein filia; RNA-binding, embryogenesis, KH doma | 97.49 | |
| 2cxc_A | 144 | NUSA; transcription termination, RNA binding prote | 97.29 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 97.22 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 97.13 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 95.79 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 95.6 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 95.34 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 95.31 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 94.71 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 94.17 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 93.9 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 93.88 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 93.82 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 93.49 |
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.95 E-value=4.1e-28 Score=215.17 Aligned_cols=157 Identities=45% Similarity=0.853 Sum_probs=139.2
Q ss_pred CceEEEEEEeccCCcccccceeeecCchHHHHHHHHhCCeEEEeCCCCCcceEEEecccCCCCCCccccCCCCCccccch
Q psy11929 12 DTLITMRCLFHSSVNVNEISCLIGPGGCIVRRLRKESGAKISITDGACPDRIVTVSGSVDNSSTSSVETGYPGHTLWVTS 91 (433)
Q Consensus 12 ~~~~~~rilvp~~~~~~~vg~IIGk~G~~Ik~I~~~tga~I~v~~~~~~eRvv~I~G~~~~~~~~~v~~~~~~~~~~~~a 91 (433)
+.+++++|+||. +++|.||||+|++||+|+++|||+|+|++.++++|+|+|+|+.+
T Consensus 2 ~~~~~~~~~vp~----~~~g~iIGkgG~~Ik~i~~~tg~~I~i~~~~~~~r~v~I~G~~~-------------------- 57 (160)
T 2jzx_A 2 NVTLTIRLLMHG----KEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTN-------------------- 57 (160)
T ss_dssp CCEEEEEEEEEH----HHHHHHHCGGGHHHHHHHHHHCSEEEEECCTTTEEEEEEEEEHH--------------------
T ss_pred CccEEEEEEEch----hheeeeECCCcHHHHHHHHHHCCEEEEcCCCCCceEEEEEeCHH--------------------
Confidence 467899999999 99999999999999999999999999999888999999999988
Q ss_pred HHHHHHHHHHHHhhhhhhc-ccccCCCCCCCCCeEEEEEeccCcccceecCCchhHHHHHHhhCceEEeccCCCCCCCcc
Q psy11929 92 VDNVCTAYNFMCRSLEDYH-INRNRMENCSPQPLQLKLVIPATHCGSLIGKGGCKIKDIRDLSGANVQVASDMLPMSTER 170 (433)
Q Consensus 92 ~~~v~~A~~~I~~~~~~~~-~~~~~~~~~~~~~~~~~l~ip~~~vg~iIGk~G~~Ik~I~~~sga~I~i~~~~~~~~~er 170 (433)
++.+|+.+|.+.+.+.. ..+.+.........+++++||.+++|+||||+|++|++|+++|||+|.+.++..|.+.++
T Consensus 58 --~v~~A~~~I~~~i~e~~~~~~~~~~~~~~~~~~~~i~vp~~~~g~iIGkgG~~Ik~i~~~tga~I~i~~~~~~~~~~~ 135 (160)
T 2jzx_A 58 --AIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTER 135 (160)
T ss_dssp --HHHHHHHHHHHHHHHHHTSCCCSSSCCCCCSEEEEEEEEHHHHHHHHCGGGHHHHHHHHHHSSEECCCCCCSTTCCEE
T ss_pred --HHHHHHHHHHHHHHhhccccCCCCccCCCCCEEEEEEEChhheeeEECCCCHHHHHHHHHhCCeEEECCCCCCCCCce
Confidence 99999999998876632 111111112345689999999999999999999999999999999999998777888999
Q ss_pred EEEEEccHHHHHHHHHHHHHHHHh
Q psy11929 171 IVTVHGNPDTISQAIYQICLVLIE 194 (433)
Q Consensus 171 ~v~I~G~~~~v~~A~~~I~~~l~e 194 (433)
.|+|+|+++++.+|+.+|.+++.|
T Consensus 136 ~v~I~G~~~~v~~A~~~I~~~i~e 159 (160)
T 2jzx_A 136 AITIAGIPQSIIECVKQICVVMLE 159 (160)
T ss_dssp EEEEEECHHHHHHHHHHHHHHHHH
T ss_pred EEEEEcCHHHHHHHHHHHHHHHhc
Confidence 999999999999999999999876
|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A | Back alignment and structure |
|---|
| >3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 433 | ||||
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 6e-15 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 4e-09 | |
| d1dtja_ | 74 | d.51.1.1 (A:) Neuro-oncological ventral antigen 2, | 8e-07 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 9e-15 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 3e-11 | |
| d2axya1 | 71 | d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum | 5e-09 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 2e-14 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 6e-10 | |
| d1x4na1 | 79 | d.51.1.1 (A:8-86) Far upstream binding element, FB | 1e-08 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 1e-13 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 2e-06 | |
| d2ctla1 | 84 | d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T | 5e-06 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 3e-13 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 3e-08 | |
| d1j4wa2 | 71 | d.51.1.1 (A:104-174) Far upstream binding element, | 3e-06 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 3e-13 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 4e-09 | |
| d1wvna1 | 70 | d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma | 7e-07 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 4e-13 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 2e-08 | |
| d1j4wa1 | 74 | d.51.1.1 (A:1-74) Far upstream binding element, FB | 7e-06 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 9e-13 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 4e-08 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 4e-07 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 1e-12 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 9e-10 | |
| d1zzka1 | 75 | d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie | 2e-06 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 3e-12 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 3e-07 | |
| d1x4ma1 | 81 | d.51.1.1 (A:8-88) Far upstream binding element, FB | 3e-05 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 3e-12 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 4e-08 | |
| d2ctea1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 1e-07 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 2e-11 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 1e-07 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 3e-07 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 2e-10 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 3e-07 | |
| d1viga_ | 71 | d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId | 9e-06 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 2e-09 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 1e-07 | |
| d2ctma1 | 81 | d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T | 3e-04 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 3e-08 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 8e-06 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 3e-04 | |
| d2ctja1 | 82 | d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T | 4e-08 | |
| d2ctja1 | 82 | d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T | 1e-05 | |
| d2ctja1 | 82 | d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T | 3e-05 | |
| d1e3ha4 | 54 | d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ | 4e-07 | |
| d1e3ha4 | 54 | d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ | 4e-04 | |
| d1tuaa1 | 84 | d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae | 3e-05 | |
| d1tuaa1 | 84 | d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae | 4e-04 | |
| d2cpqa1 | 78 | d.51.1.1 (A:212-289) Fragile X mental retardation | 1e-04 | |
| d2cpqa1 | 78 | d.51.1.1 (A:212-289) Fragile X mental retardation | 2e-04 | |
| d2cpqa1 | 78 | d.51.1.1 (A:212-289) Fragile X mental retardation | 0.001 | |
| d2z0sa2 | 87 | d.51.1.1 (A:148-234) Exosome complex RNA-binding p | 2e-04 | |
| d2z0sa2 | 87 | d.51.1.1 (A:148-234) Exosome complex RNA-binding p | 8e-04 | |
| d2je6i3 | 69 | d.51.1.1 (I:153-221) Exosome complex RNA-binding p | 7e-04 | |
| d2je6i3 | 69 | d.51.1.1 (I:153-221) Exosome complex RNA-binding p | 8e-04 | |
| d2ctfa1 | 90 | d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T | 0.002 |
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Neuro-oncological ventral antigen 2, nova-2, KH3 species: Human (Homo sapiens) [TaxId: 9606]
Score = 67.2 bits (164), Expect = 6e-15
Identities = 20/65 (30%), Positives = 38/65 (58%), Gaps = 2/65 (3%)
Query: 126 LKLVIPATHCGSLIGKGGCKIKDIRDLSGANVQV--ASDMLPMSTERIVTVHGNPDTISQ 183
+++ +P G+++GKGG + + ++L+GA +Q+ + LP + R VT+ G+P
Sbjct: 5 VEMAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFLPGTRNRRVTITGSPAATQA 64
Query: 184 AIYQI 188
A Y I
Sbjct: 65 AQYLI 69
|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 433 | |||
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 99.66 | |
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 99.66 | |
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 99.64 | |
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 99.63 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 99.63 | |
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 99.62 | |
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 99.61 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 99.61 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 99.59 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 99.55 | |
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 99.52 | |
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 99.52 | |
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 99.51 | |
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 99.51 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.51 | |
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.5 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.49 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 99.49 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 99.48 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.47 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.46 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 99.44 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 99.44 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.42 | |
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.39 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.38 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.36 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.36 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.35 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 99.28 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.26 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.26 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 99.24 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 99.23 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 99.1 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 99.06 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.95 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 98.85 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 98.79 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.77 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 98.74 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 98.61 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 98.61 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.55 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 98.49 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.39 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 98.1 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 98.01 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 97.98 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 97.57 | |
| d1hh2p3 | 68 | Transcription factor NusA, C-terminal domains {The | 95.33 | |
| d2asba3 | 67 | Transcription factor NusA, C-terminal domains {Myc | 95.31 | |
| d2asba3 | 67 | Transcription factor NusA, C-terminal domains {Myc | 94.7 | |
| d1hh2p3 | 68 | Transcription factor NusA, C-terminal domains {The | 94.64 | |
| d1wh9a_ | 92 | Ribosomal protein S3 N-terminal domain {Mouse (Mus | 87.15 | |
| d2ja9a2 | 85 | Ribosomal RNA-processing protein 40, RRP40 {Saccha | 84.46 | |
| d1egaa2 | 113 | GTPase Era C-terminal domain {Escherichia coli [Ta | 84.11 |
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Eukaryotic type KH-domain (KH-domain type I) superfamily: Eukaryotic type KH-domain (KH-domain type I) family: Eukaryotic type KH-domain (KH-domain type I) domain: Poly(RC)-binding protein 1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.66 E-value=5.8e-17 Score=120.97 Aligned_cols=68 Identities=41% Similarity=0.709 Sum_probs=64.1
Q ss_pred ceEEEEEeCcccccccccCCCchHHHHHhHhCCeEEEccCCC-CCceEEEEEeCHHHHHHHHHHHHHHH
Q psy11929 287 FVETEIVLTDDIAGCVIGKAGSRLLEIRQISGAQINIHTGTE-SHKKMFHIQGCQEAVSLAQYLINMCI 354 (433)
Q Consensus 287 ~~t~~i~VP~~~vG~IIGkgG~~Ik~I~~~sGA~I~I~~~~~-~~er~V~IsGt~e~v~~A~~lI~~~i 354 (433)
+.|.+|.||..++|+||||+|.+|++|++.|||+|.|+++.+ +++|.|+|+|+++++++|+.+|+++|
T Consensus 1 q~T~~i~VP~~~vg~iIGk~G~~I~~I~~~tga~I~i~~~~~~~~~r~v~I~G~~~~v~~A~~~I~~~i 69 (70)
T d1wvna1 1 QTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARL 69 (70)
T ss_dssp CEEEEEEEEGGGHHHHHCGGGHHHHHHHHHHCCEEEECCCCTTCSEEEEEEEECHHHHHHHHHHHHHHT
T ss_pred CeEEEEEEChHhcceeECCCChHHHHHHHHcCcEEEEcCCCCCCCcEEEEEEeCHHHHHHHHHHHHHHc
Confidence 357899999999999999999999999999999999988776 88999999999999999999999886
|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|