Psyllid ID: psy11935
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1334 | 2.2.26 [Sep-21-2011] | |||||||
| P28331 | 727 | NADH-ubiquinone oxidoredu | yes | N/A | 0.459 | 0.843 | 0.552 | 0.0 | |
| Q0MQG2 | 727 | NADH-ubiquinone oxidoredu | yes | N/A | 0.459 | 0.843 | 0.551 | 0.0 | |
| Q0MQG1 | 727 | NADH-ubiquinone oxidoredu | N/A | N/A | 0.459 | 0.843 | 0.551 | 0.0 | |
| P0CB68 | 727 | NADH-ubiquinone oxidoredu | N/A | N/A | 0.459 | 0.843 | 0.549 | 0.0 | |
| Q4R6K9 | 727 | NADH-ubiquinone oxidoredu | N/A | N/A | 0.459 | 0.843 | 0.549 | 0.0 | |
| P15690 | 727 | NADH-ubiquinone oxidoredu | yes | N/A | 0.455 | 0.834 | 0.551 | 0.0 | |
| Q66HF1 | 727 | NADH-ubiquinone oxidoredu | yes | N/A | 0.459 | 0.843 | 0.551 | 0.0 | |
| P0CB67 | 727 | NADH-ubiquinone oxidoredu | yes | N/A | 0.459 | 0.843 | 0.547 | 0.0 | |
| Q91VD9 | 727 | NADH-ubiquinone oxidoredu | yes | N/A | 0.459 | 0.843 | 0.545 | 0.0 | |
| Q94511 | 731 | NADH-ubiquinone oxidoredu | yes | N/A | 0.460 | 0.839 | 0.532 | 0.0 |
| >sp|P28331|NDUS1_HUMAN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens GN=NDUFS1 PE=1 SV=3 | Back alignment and function desciption |
|---|
Score = 797 bits (2059), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 421/762 (55%), Positives = 498/762 (65%), Gaps = 149/762 (19%)
Query: 652 VKTLSTSAVNNEKFEVFIDDKKVMVDPGTTVLQP-------------------------- 685
V+T +T+A N EVF+D + VMV+PGTTVLQ
Sbjct: 21 VRTTATAASN--LIEVFVDGQSVMVEPGTTVLQACEKVGMQIPRFCYHERLSVAGNCRMC 78
Query: 686 ----------VAACAMPVMKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECD 735
VAACAMPVMKGW + TNSE +++AREGVMEFLL NHPLDCPICDQGGECD
Sbjct: 79 LVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGECD 138
Query: 736 LQDQSMAFGSDRSRFTDIDFSGKSGTYTRVTRQRSWGLIPSRVFLQSINRHWIGPVAACA 795
LQDQSM FG+DRSRF GK +++ IGP+
Sbjct: 139 LQDQSMMFGNDRSRF----LEGK----------------------RAVEDKNIGPL---- 168
Query: 796 MPVMKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGNDLGTT 855
VKT MTR C Q C +A +DLGTT
Sbjct: 169 --------VKTI--MTR--------------------CIQCTRCIRFASEIAGVDDLGTT 198
Query: 856 GRGSDMQVGTYVEKLFLSELSGNVIDLCPVGALTSKPYSFTARPWETRKTESVDVLDAVG 915
GRG+DMQVGTY+EK+F+SELSGN+ID+CPVGALTSKPY+FTARPWETRKTES+DV+DAVG
Sbjct: 199 GRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVG 258
Query: 916 SNIIVSTRTGEVLRVLPRLNEDINEEWLADKGRFAYDGLKRQRLLTPFVRNCDGQLVATE 975
SNI+VSTRTGEV+R+LPR++EDINEEW++DK RFAYDGLKRQRL P VRN G L T
Sbjct: 259 SNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTYTS 318
Query: 976 WEDALIAVA---QKLQTSEVAGVVGSLADAEAMVALKDLLNKLGSEDLYTEYAFPLEGAG 1032
WEDAL VA Q Q +VA + G L DAEA+VALKDLLN++ S+ L TE FP GAG
Sbjct: 319 WEDALSRVAGMLQSFQGKDVAAIAGGLVDAEALVALKDLLNRVDSDTLCTEEVFPTAGAG 378
Query: 1033 TDLRANYLLNNKIAGAEEADLILLIGTNPRFEAPLFNARIRKGYLTNELDVAYIGPKVDL 1092
TDLR+NYLLN IAG EEAD++LL+GTNPRFEAPLFNARIRK +L N+L VA IG VDL
Sbjct: 379 TDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDL 438
Query: 1093 RYDYEHLGESADLIKQLASGSHPFSKKLSAAKKPLIVVGADI---SDGAAVLALVQQLAA 1149
Y Y+HLG+S +++ +ASGSHPFS+ L AKKP++V+G+ +DGAA+LA V +A
Sbjct: 439 TYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSALQRNDGAAILAAVSSIAQ 498
Query: 1150 KVTCESDVPCDWKVLNILQKAASQVAALDIGYKPGTSAIREKPPKVLFLLGADEGSISRD 1209
K+ S V DWKV+NIL + ASQVAALD+GYKPG AIR+ PPKVLFLLGAD G I+R
Sbjct: 499 KIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKVLFLLGADGGCITRQ 558
Query: 1210 DVGKDCFIIYQGHHGDHGASIADAILPGAAYTEKQSTYVNTEGRAQQTLTAVTPPGLARE 1269
D+ KDCFIIYQGHHGD GA IAD ILPGAAYTEK +TYVNTEGRAQQT AVTPPGLARE
Sbjct: 559 DLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLARE 618
Query: 1270 DWKIIRALS-------------------EGVSSNLS------------------------ 1286
DWKIIRALS E VS NL
Sbjct: 619 DWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQ 678
Query: 1287 --SEPVDVKQKNLEDYYMTDPISRASGTMAKCIQAVHKQKQS 1326
++P+ Q ++D+YMTD ISRAS TMAKC++AV + Q+
Sbjct: 679 LLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQA 720
|
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). This is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Homo sapiens (taxid: 9606) EC: 1EC: .EC: 6EC: .EC: 9EC: 9EC: .EC: 3 |
| >sp|Q0MQG2|NDUS1_PANTR NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Pan troglodytes GN=NDUFS1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q0MQG1|NDUS1_GORGO NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P0CB68|NDUS1_PONPY NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Pongo pygmaeus GN=NDUFS1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q4R6K9|NDUS1_MACFA NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Macaca fascicularis GN=NDUFS1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P15690|NDUS1_BOVIN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Bos taurus GN=NDUFS1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q66HF1|NDUS1_RAT NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Rattus norvegicus GN=Ndufs1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P0CB67|NDUS1_PONAB NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Pongo abelii GN=NDUFS1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q91VD9|NDUS1_MOUSE NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Mus musculus GN=Ndufs1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q94511|NDUS1_DROME NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Drosophila melanogaster GN=ND75 PE=2 SV=3 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1334 | ||||||
| 321476647 | 726 | hypothetical protein DAPPUDRAFT_192333 [ | 0.474 | 0.871 | 0.569 | 0.0 | |
| 91088235 | 727 | PREDICTED: similar to NADH-ubiquinone ox | 0.464 | 0.852 | 0.562 | 0.0 | |
| 332376761 | 727 | unknown [Dendroctonus ponderosae] | 0.455 | 0.834 | 0.562 | 0.0 | |
| 72133227 | 728 | PREDICTED: NADH-ubiquinone oxidoreductas | 0.455 | 0.835 | 0.561 | 0.0 | |
| 338715920 | 690 | PREDICTED: NADH-ubiquinone oxidoreductas | 0.459 | 0.888 | 0.581 | 0.0 | |
| 410969218 | 691 | PREDICTED: NADH-ubiquinone oxidoreductas | 0.459 | 0.887 | 0.579 | 0.0 | |
| 316983154 | 691 | NADH-ubiquinone oxidoreductase 75 kDa su | 0.459 | 0.887 | 0.579 | 0.0 | |
| 395527808 | 691 | PREDICTED: NADH-ubiquinone oxidoreductas | 0.455 | 0.878 | 0.575 | 0.0 | |
| 402889161 | 691 | PREDICTED: NADH-ubiquinone oxidoreductas | 0.459 | 0.887 | 0.578 | 0.0 | |
| 348576914 | 692 | PREDICTED: NADH-ubiquinone oxidoreductas | 0.459 | 0.885 | 0.577 | 0.0 |
| >gi|321476647|gb|EFX87607.1| hypothetical protein DAPPUDRAFT_192333 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
Score = 857 bits (2214), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 442/776 (56%), Positives = 526/776 (67%), Gaps = 143/776 (18%)
Query: 640 LHVLPCVRVLSPVKTLSTSAVNNEKFEVFIDDKKVMVDPGTTVLQ--------------- 684
L +P V ++ + + S EK EVFID + V+VDPGTTVLQ
Sbjct: 7 LRSIPQVTRVASLGARTNSTGAPEKVEVFIDGQPVLVDPGTTVLQAAAMVGVEIPRFCYH 66
Query: 685 ---------------------PVAACAMPVMKGWRVKTNSEMTRRAREGVMEFLLVNHPL 723
PVAACAMPVMKGWR+KTNS++TR+AREGVMEFLLVNHPL
Sbjct: 67 ERLSVAGNCRMCLVEVEKSAKPVAACAMPVMKGWRIKTNSDLTRKAREGVMEFLLVNHPL 126
Query: 724 DCPICDQGGECDLQDQSMAFGSDRSRFTDIDFSGKSGTYTRVTRQRSWGLIPSRVFLQSI 783
DCPICDQGGECDLQDQSMAFGSDRSRFTDI FSGK +++
Sbjct: 127 DCPICDQGGECDLQDQSMAFGSDRSRFTDIAFSGK----------------------RAV 164
Query: 784 NRHWIGPVAACAMPVMKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQD 843
+GP+ +KT MTR C C
Sbjct: 165 EDKNVGPL------------IKTI--MTR--------------------CIHCTRCIRFA 190
Query: 844 QSMAFGNDLGTTGRGSDMQVGTYVEKLFLSELSGNVIDLCPVGALTSKPYSFTARPWETR 903
+A +DLGTTGRG DMQVGTYVEK+FLSELSGNVIDLCPVGALTSKPY+F ARPWETR
Sbjct: 191 SEVAGVDDLGTTGRGGDMQVGTYVEKMFLSELSGNVIDLCPVGALTSKPYAFMARPWETR 250
Query: 904 KTESVDVLDAVGSNIIVSTRTGEVLRVLPRLNEDINEEWLADKGRFAYDGLKRQRLLTPF 963
KT+S+DV+DAVGSNI V+ RTGEVLRVLPR +EDINEEWL+DK RFA DGLKRQRL++P
Sbjct: 251 KTDSIDVMDAVGSNIFVTHRTGEVLRVLPRTHEDINEEWLSDKSRFACDGLKRQRLVSPM 310
Query: 964 VRNCDGQLVATEWEDALIAVAQKLQTS---EVAGVVGSLADAEAMVALKDLLNKLGSEDL 1020
VR+ G+LV EWEDAL+AVA+ LQ++ E+A +VG ADAEA+VALKD+LN+LGSE L
Sbjct: 311 VRDSTGKLVMVEWEDALVAVARALQSAKGDELAAIVGGFADAEALVALKDMLNQLGSESL 370
Query: 1021 YTEYAFPLEGAGTDLRANYLLNNKIAGAEEADLILLIGTNPRFEAPLFNARIRKGYLTNE 1080
TE FP++GAGTDLR+NYLLN+ IAG EEAD++LLIGTN RFEAPLFNAR+RK ++ N+
Sbjct: 371 CTEEVFPMDGAGTDLRSNYLLNSTIAGVEEADVVLLIGTNTRFEAPLFNARLRKSWINND 430
Query: 1081 LDVAYIGPKVDLRYDYEHLGESADLIKQLASGSHPFSKKLSAAKKPLIVVGADI---SDG 1137
L VA +GP VDL Y+ E+LG+S +++ LA G H FSK L+ AK+P+IVVG+ DG
Sbjct: 431 LRVATVGPDVDLTYETENLGDSMQVLQDLAEGRHAFSKVLNGAKRPIIVVGSGALQREDG 490
Query: 1138 AAVLALVQQLAAKVTCESDVPCDWKVLNILQKAASQVAALDIGYKPGTSAIREKPPKVLF 1197
A VL L Q++A ++V DW+VLN+LQ+ ASQVAALD+GYK G AIR PPKVLF
Sbjct: 491 ATVLQLTQRIAQNARVAANVGHDWRVLNVLQRVASQVAALDLGYKAGIEAIRANPPKVLF 550
Query: 1198 LLGADEGSISRDDVGKDCFIIYQGHHGDHGASIADAILPGAAYTEKQSTYVNTEGRAQQT 1257
LLGADEG ISR+D+ KDCF+IYQGHHGD GAS+ADA+LPGAAYTEKQ+TYVN EGRAQQT
Sbjct: 551 LLGADEGVISREDLPKDCFVIYQGHHGDRGASMADAVLPGAAYTEKQATYVNMEGRAQQT 610
Query: 1258 LTAVTPPGLAREDWKIIRALSE-------------------GVSSNLS------------ 1286
TA+TPPGLAREDWKI+RAL E VS NL+
Sbjct: 611 YTAITPPGLAREDWKILRALGEVVGVKLPYDTLTQLRARLTEVSPNLTRYGDVESANYFA 670
Query: 1287 --------------SEPVDVKQKNLEDYYMTDPISRASGTMAKCIQAVHKQKQSKY 1328
S P+DV+QK LED+Y+TD ISRAS TMAKC+QAV KQ+QSKY
Sbjct: 671 QAVELAKLVKAQPNSAPLDVRQKTLEDFYITDSISRASPTMAKCVQAVKKQRQSKY 726
|
Source: Daphnia pulex Species: Daphnia pulex Genus: Daphnia Family: Daphniidae Order: Diplostraca Class: Branchiopoda Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|91088235|ref|XP_973797.1| PREDICTED: similar to NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial precursor (Complex I-75kD) (CI-75kD) [Tribolium castaneum] gi|270012773|gb|EFA09221.1| hypothetical protein TcasGA2_TC006252 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|332376761|gb|AEE63520.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|72133227|ref|XP_780124.1| PREDICTED: NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial-like isoform 1 [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|338715920|ref|XP_003363355.1| PREDICTED: NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial isoform 2 [Equus caballus] | Back alignment and taxonomy information |
|---|
| >gi|410969218|ref|XP_003991093.1| PREDICTED: NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial isoform 2 [Felis catus] | Back alignment and taxonomy information |
|---|
| >gi|316983154|ref|NP_001186910.1| NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial isoform 2 precursor [Homo sapiens] | Back alignment and taxonomy information |
|---|
| >gi|395527808|ref|XP_003766030.1| PREDICTED: NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial isoform 2 [Sarcophilus harrisii] | Back alignment and taxonomy information |
|---|
| >gi|402889161|ref|XP_003907896.1| PREDICTED: NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial isoform 3 [Papio anubis] | Back alignment and taxonomy information |
|---|
| >gi|348576914|ref|XP_003474230.1| PREDICTED: NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial-like isoform 2 [Cavia porcellus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1334 | ||||||
| UNIPROTKB|P28331 | 727 | NDUFS1 "NADH-ubiquinone oxidor | 0.350 | 0.642 | 0.655 | 1.6e-212 | |
| UNIPROTKB|Q0MQG2 | 727 | NDUFS1 "NADH-ubiquinone oxidor | 0.350 | 0.642 | 0.655 | 3.3e-212 | |
| UNIPROTKB|Q0MQG1 | 727 | NDUFS1 "NADH-ubiquinone oxidor | 0.350 | 0.642 | 0.653 | 6.9e-212 | |
| UNIPROTKB|P15690 | 727 | NDUFS1 "NADH-ubiquinone oxidor | 0.350 | 0.642 | 0.644 | 6.9e-212 | |
| UNIPROTKB|P0CB68 | 727 | NDUFS1 "NADH-ubiquinone oxidor | 0.350 | 0.642 | 0.651 | 8.8e-212 | |
| UNIPROTKB|Q4R6K9 | 727 | NDUFS1 "NADH-ubiquinone oxidor | 0.350 | 0.642 | 0.651 | 8.8e-212 | |
| UNIPROTKB|F1SHD7 | 742 | NDUFS1 "Uncharacterized protei | 0.350 | 0.629 | 0.651 | 1.1e-211 | |
| UNIPROTKB|E2R4F8 | 727 | NDUFS1 "Uncharacterized protei | 0.350 | 0.642 | 0.649 | 1.4e-211 | |
| UNIPROTKB|E2RD75 | 739 | NDUFS1 "Uncharacterized protei | 0.350 | 0.631 | 0.649 | 1.4e-211 | |
| UNIPROTKB|P0CB67 | 727 | NDUFS1 "NADH-ubiquinone oxidor | 0.350 | 0.642 | 0.651 | 3.8e-211 |
| UNIPROTKB|P28331 NDUFS1 "NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 1590 (564.8 bits), Expect = 1.6e-212, Sum P(4) = 1.6e-212
Identities = 310/473 (65%), Positives = 364/473 (76%)
Query: 833 CDQGGECDLQDQSMAFGNDLGTTGRGSDMQVGTYVEKLFLSELSGNVIDLCPVGALTSKP 892
C Q C +A +DLGTTGRG+DMQVGTY+EK+F+SELSGN+ID+CPVGALTSKP
Sbjct: 176 CIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKP 235
Query: 893 YSFTARPWETRKTESVDVLDAVGSNIIVSTRTGEVLRVLPRLNEDINEEWLADKGRFAYD 952
Y+FTARPWETRKTES+DV+DAVGSNI+VSTRTGEV+R+LPR++EDINEEW++DK RFAYD
Sbjct: 236 YAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYD 295
Query: 953 GLKRQRLLTPFVRNCDGQLVATEWEDALIAVA---QKLQTSEVAGVVGSLADAEAMVALK 1009
GLKRQRL P VRN G L T WEDAL VA Q Q +VA + G L DAEA+VALK
Sbjct: 296 GLKRQRLTEPMVRNEKGLLTYTSWEDALSRVAGMLQSFQGKDVAAIAGGLVDAEALVALK 355
Query: 1010 DLLNKLGSEDLYTEYAFPLEGAGTDLRANYLLNNKIAGAEEADLILLIGTNPRFEAPLFN 1069
DLLN++ S+ L TE FP GAGTDLR+NYLLN IAG EEAD++LL+GTNPRFEAPLFN
Sbjct: 356 DLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFN 415
Query: 1070 ARIRKGYLTNELDVAYIGPKVDLRYDYEHLGESADLIKQLASGSHPFSKKLSAAKKPLIV 1129
ARIRK +L N+L VA IG VDL Y Y+HLG+S +++ +ASGSHPFS+ L AKKP++V
Sbjct: 416 ARIRKSWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVV 475
Query: 1130 VGADI---SDGXXXXXXXXXXXXKVTCESDVPCDWKVLNILQKAASQVAALDIGYKPGTS 1186
+G+ +DG K+ S V DWKV+NIL + ASQVAALD+GYKPG
Sbjct: 476 LGSSALQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVE 535
Query: 1187 AIREKPPKVLFLLGADEGSISRDDVGKDCFIIYQGHHGDHGASIADAILPGAAYTEKQST 1246
AIR+ PPKVLFLLGAD G I+R D+ KDCFIIYQGHHGD GA IAD ILPGAAYTEK +T
Sbjct: 536 AIRKNPPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSAT 595
Query: 1247 YVNTEGRAQQTLTAVTPPGLAREDWKIIRALSEGVSSNLSSEPVDVKQKNLED 1299
YVNTEGRAQQT AVTPPGLAREDWKIIRALSE L + +D + LE+
Sbjct: 596 YVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEE 648
|
|
| UNIPROTKB|Q0MQG2 NDUFS1 "NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial" [Pan troglodytes (taxid:9598)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0MQG1 NDUFS1 "NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial" [Gorilla gorilla gorilla (taxid:9595)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P15690 NDUFS1 "NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0CB68 NDUFS1 "NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial" [Pongo pygmaeus (taxid:9600)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4R6K9 NDUFS1 "NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial" [Macaca fascicularis (taxid:9541)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SHD7 NDUFS1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R4F8 NDUFS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RD75 NDUFS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0CB67 NDUFS1 "NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q91VD9 | NDUS1_MOUSE | 1, ., 6, ., 9, 9, ., 3 | 0.5459 | 0.4595 | 0.8431 | yes | N/A |
| Q0MQG2 | NDUS1_PANTR | 1, ., 6, ., 9, 9, ., 3 | 0.5511 | 0.4595 | 0.8431 | yes | N/A |
| Q94511 | NDUS1_DROME | 1, ., 6, ., 9, 9, ., 3 | 0.5322 | 0.4602 | 0.8399 | yes | N/A |
| P28331 | NDUS1_HUMAN | 1, ., 6, ., 9, 9, ., 3 | 0.5524 | 0.4595 | 0.8431 | yes | N/A |
| P0CB67 | NDUS1_PONAB | 1, ., 6, ., 9, 9, ., 3 | 0.5472 | 0.4595 | 0.8431 | yes | N/A |
| P15690 | NDUS1_BOVIN | 1, ., 6, ., 9, 9, ., 3 | 0.5515 | 0.4550 | 0.8349 | yes | N/A |
| Q66HF1 | NDUS1_RAT | 1, ., 6, ., 9, 9, ., 3 | 0.5511 | 0.4595 | 0.8431 | yes | N/A |
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 1.6.5.3 | 0.824 |
| 3rd Layer | 1.6.99 | 0.766 |
| 3rd Layer | 1.6.99.3 | 0.824 |
| 3rd Layer | 1.6.5 | 0.766 |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1334 | |||
| PRK09130 | 687 | PRK09130, PRK09130, NADH dehydrogenase subunit G; | 0.0 | |
| TIGR01973 | 603 | TIGR01973, NuoG, NADH-quinone oxidoreductase, chai | 0.0 | |
| cd02773 | 375 | cd02773, MopB_Res-Cmplx1_Nad11, MopB_Res_Cmplx1_Na | 0.0 | |
| COG1034 | 693 | COG1034, NuoG, NADH dehydrogenase/NADH:ubiquinone | 1e-149 | |
| cd02768 | 386 | cd02768, MopB_NADH-Q-OR-NuoG2, MopB_NADH-Q-OR-NuoG | 1e-141 | |
| PRK09129 | 776 | PRK09129, PRK09129, NADH dehydrogenase subunit G; | 1e-116 | |
| pfam00384 | 358 | pfam00384, Molybdopterin, Molybdopterin oxidoreduc | 1e-108 | |
| cd02774 | 366 | cd02774, MopB_Res-Cmplx1_Nad11-M, MopB_Res_Cmplx1_ | 8e-76 | |
| cd00368 | 374 | cd00368, Molybdopterin-Binding, Molybdopterin-Bind | 6e-63 | |
| PRK07860 | 797 | PRK07860, PRK07860, NADH dehydrogenase subunit G; | 6e-56 | |
| cd02772 | 414 | cd02772, MopB_NDH-1_NuoG2, MopB_NDH-1_NuoG2: The s | 1e-50 | |
| PRK08166 | 791 | PRK08166, PRK08166, NADH dehydrogenase subunit G; | 1e-46 | |
| PRK09130 | 687 | PRK09130, PRK09130, NADH dehydrogenase subunit G; | 3e-41 | |
| cd02771 | 472 | cd02771, MopB_NDH-1_NuoG2-N7, MopB_NDH-1_NuoG2-N7: | 5e-32 | |
| COG1034 | 693 | COG1034, NuoG, NADH dehydrogenase/NADH:ubiquinone | 4e-28 | |
| PRK07860 | 797 | PRK07860, PRK07860, NADH dehydrogenase subunit G; | 3e-26 | |
| COG3383 | 978 | COG3383, COG3383, Uncharacterized anaerobic dehydr | 3e-26 | |
| pfam10588 | 41 | pfam10588, NADH-G_4Fe-4S_3, NADH-ubiquinone oxidor | 3e-18 | |
| smart00929 | 41 | smart00929, NADH-G_4Fe-4S_3, NADH-ubiquinone oxido | 1e-16 | |
| pfam10588 | 41 | pfam10588, NADH-G_4Fe-4S_3, NADH-ubiquinone oxidor | 6e-16 | |
| PTZ00305 | 297 | PTZ00305, PTZ00305, NADH:ubiquinone oxidoreductase | 3e-15 | |
| smart00929 | 41 | smart00929, NADH-G_4Fe-4S_3, NADH-ubiquinone oxido | 1e-14 | |
| PTZ00305 | 297 | PTZ00305, PTZ00305, NADH:ubiquinone oxidoreductase | 2e-14 | |
| PRK08166 | 791 | PRK08166, PRK08166, NADH dehydrogenase subunit G; | 3e-14 | |
| COG3383 | 978 | COG3383, COG3383, Uncharacterized anaerobic dehydr | 5e-13 | |
| cd02753 | 512 | cd02753, MopB_Formate-Dh-H, Formate dehydrogenase | 2e-10 | |
| cd02753 | 512 | cd02753, MopB_Formate-Dh-H, Formate dehydrogenase | 7e-10 | |
| pfam09326 | 48 | pfam09326, DUF1982, Domain of unknown function (DU | 9e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-08 | |
| COG3383 | 978 | COG3383, COG3383, Uncharacterized anaerobic dehydr | 2e-08 | |
| PRK08493 | 819 | PRK08493, PRK08493, NADH dehydrogenase subunit G; | 2e-08 | |
| PRK08493 | 819 | PRK08493, PRK08493, NADH dehydrogenase subunit G; | 2e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-08 | |
| cd02754 | 565 | cd02754, MopB_Nitrate-R-NapA-like, Nitrate reducta | 3e-08 | |
| PRK07569 | 234 | PRK07569, PRK07569, bidirectional hydrogenase comp | 3e-08 | |
| TIGR01591 | 671 | TIGR01591, Fdh-alpha, formate dehydrogenase, alpha | 2e-07 | |
| PRK07569 | 234 | PRK07569, PRK07569, bidirectional hydrogenase comp | 4e-06 | |
| pfam09728 | 309 | pfam09728, Taxilin, Myosin-like coiled-coil protei | 1e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-05 | |
| TIGR01591 | 671 | TIGR01591, Fdh-alpha, formate dehydrogenase, alpha | 2e-05 | |
| COG0243 | 765 | COG0243, BisC, Anaerobic dehydrogenases, typically | 5e-05 | |
| cd02754 | 565 | cd02754, MopB_Nitrate-R-NapA-like, Nitrate reducta | 6e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 7e-05 | |
| pfam05483 | 787 | pfam05483, SCP-1, Synaptonemal complex protein 1 ( | 7e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-04 | |
| TIGR03479 | 912 | TIGR03479, DMSO_red_II_alp, DMSO reductase family | 6e-04 | |
| pfam09728 | 309 | pfam09728, Taxilin, Myosin-like coiled-coil protei | 8e-04 | |
| TIGR01706 | 830 | TIGR01706, NAPA, periplasmic nitrate reductase, la | 8e-04 | |
| smart00926 | 55 | smart00926, Molybdop_Fe4S4, Molybdopterin oxidored | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.003 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.004 | |
| cd02750 | 461 | cd02750, MopB_Nitrate-R-NarG-like, Respiratory nit | 0.004 | |
| PRK13532 | 830 | PRK13532, PRK13532, nitrate reductase catalytic su | 0.004 |
| >gnl|CDD|236387 PRK09130, PRK09130, NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
Score = 785 bits (2029), Expect = 0.0
Identities = 306/640 (47%), Positives = 377/640 (58%), Gaps = 119/640 (18%)
Query: 790 PVAACAMPVMKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFG 849
PVA+CAMPV +G + TN+ M ++AREGVMEFLL+NHPLDCPICDQGGECDLQDQ+MA+G
Sbjct: 59 PVASCAMPVGEGMVIFTNTPMVKKAREGVMEFLLINHPLDCPICDQGGECDLQDQAMAYG 118
Query: 850 ---------------------------------------------NDLGTTGRGSDMQVG 864
+LG GRG DM++
Sbjct: 119 VDTSRYHENKRAVEDKYMGPLVKTVMTRCIHCTRCVRFATEVAGVPELGAIGRGEDMEIT 178
Query: 865 TYVEKLFLSELSGNVIDLCPVGALTSKPYSFTARPWETRKTESVDVLDAVGSNIIVSTRT 924
TY+E+ SELSGNVIDLCPVGALTSKPY+FTARPWE +KTES+DV+DAVGSNI V TR
Sbjct: 179 TYLEQALTSELSGNVIDLCPVGALTSKPYAFTARPWELKKTESIDVMDAVGSNIRVDTRG 238
Query: 925 GEVLRVLPRLNEDINEEWLADKGRFAYDGLKRQRLLTPFVRNCDGQLVATEWEDALIAVA 984
EV+R+LPR+NE++NEEW++DK RF++DGLKRQRL P+VR +G+LV W++A A+A
Sbjct: 239 REVMRILPRVNEEVNEEWISDKTRFSWDGLKRQRLDRPYVRK-NGKLVPASWDEAFAAIA 297
Query: 985 QKLQ---TSEVAGVVGSLADAEAMVALKDLLNKLGSEDL---YTEYAFPLEGAGTDLRAN 1038
K++ ++A + G LAD E+M ALKDL+ KLGS +L LRA+
Sbjct: 298 AKIKGTPGEKIAAIAGDLADVESMFALKDLMQKLGSSNLDCRQDGAKLD-----PSLRAS 352
Query: 1039 YLLNNKIAGAEEADLILLIGTNPRFEAPLFNARIRKGYLTNELDVAYIGPKVDLRYDYEH 1098
YL N IAG EEAD ILLIG NPRFEAP+ NARIRK + +A IG + DL Y YE+
Sbjct: 353 YLFNTTIAGIEEADAILLIGANPRFEAPVLNARIRKRWRAGGFKIAVIGEQADLTYPYEY 412
Query: 1099 LGESADLIKQLASGSHPFSKKLSAAKKPLIVVGADI---SDGAAVLALVQQLAAKVTCES 1155
LG D + LASG H F+ L AAK+P+I+VG +DGAAVLAL +LA KV
Sbjct: 413 LGAGPDTLADLASGKHEFADVLKAAKRPMIIVGQGALARADGAAVLALAAKLAEKVGAVR 472
Query: 1156 DVPCDWKVLNILQKAASQVAALDIGYKPGT------SAIREKPPKVLFLLGADEGSISRD 1209
D W N+L AAS+V LD+G+ PG + VL+LLGADE IS+
Sbjct: 473 D---GWNGFNVLHTAASRVGGLDLGFVPGEGGKDAAEMLESGALDVLYLLGADEIDISK- 528
Query: 1210 DVGKDCFIIYQGHHGDHGASIADAILPGAAYTEKQSTYVNTEGRAQQTLTAVTPPGLARE 1269
GK F+IYQGHHGD GA AD ILPGAAYTEK TYVNTEGR Q AV PPG A+E
Sbjct: 529 --GKSAFVIYQGHHGDRGAHRADVILPGAAYTEKSGTYVNTEGRVQLANRAVFPPGEAKE 586
Query: 1270 DWKIIRALSE--------------------------------------------GVSSNL 1285
DW I+RALS+ L
Sbjct: 587 DWAILRALSDVLGKTLPYDSLAQLRAKLAAAYPHFAAIDQITPSKDAKDLAALASKKGKL 646
Query: 1286 SSEPVDVKQKNLEDYYMTDPISRASGTMAKCIQAVHKQKQ 1325
S P K D+Y+T+PI+RAS TMA+C +
Sbjct: 647 SKAPFTSPVK---DFYLTNPIARASATMAECSALASGRAL 683
|
Length = 687 |
| >gnl|CDD|233662 TIGR01973, NuoG, NADH-quinone oxidoreductase, chain G | Back alignment and domain information |
|---|
| >gnl|CDD|239174 cd02773, MopB_Res-Cmplx1_Nad11, MopB_Res_Cmplx1_Nad11: The second domain of the Nad11/75-kDa subunit of the NADH-quinone oxidoreductase/respiratory complex I/NADH dehydrogenase-1(NDH-1) of eukaryotes and the Nqo3/G subunit of alphaproteobacteria NDH-1 | Back alignment and domain information |
|---|
| >gnl|CDD|223965 COG1034, NuoG, NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|239169 cd02768, MopB_NADH-Q-OR-NuoG2, MopB_NADH-Q-OR-NuoG2: The NuoG/Nad11/75-kDa subunit (second domain) of the NADH-quinone oxidoreductase (NADH-Q-OR)/respiratory complex I/NADH dehydrogenase-1 (NDH-1) | Back alignment and domain information |
|---|
| >gnl|CDD|236386 PRK09129, PRK09129, NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215888 pfam00384, Molybdopterin, Molybdopterin oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|239175 cd02774, MopB_Res-Cmplx1_Nad11-M, MopB_Res_Cmplx1_Nad11_M: Mitochondrial-encoded NADH-quinone oxidoreductase/respiratory complex I, the second domain of the Nad11/75-kDa subunit of some protists | Back alignment and domain information |
|---|
| >gnl|CDD|238218 cd00368, Molybdopterin-Binding, Molybdopterin-Binding (MopB) domain of the MopB superfamily of proteins, a large, diverse, heterogeneous superfamily of enzymes that, in general, bind molybdopterin as a cofactor | Back alignment and domain information |
|---|
| >gnl|CDD|236118 PRK07860, PRK07860, NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|239173 cd02772, MopB_NDH-1_NuoG2, MopB_NDH-1_NuoG2: The second domain of the NuoG subunit of the NADH-quinone oxidoreductase/NADH dehydrogenase-1 (NDH-1), found in beta- and gammaproteobacteria | Back alignment and domain information |
|---|
| >gnl|CDD|236170 PRK08166, PRK08166, NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236387 PRK09130, PRK09130, NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|239172 cd02771, MopB_NDH-1_NuoG2-N7, MopB_NDH-1_NuoG2-N7: The second domain of the NuoG subunit (with a [4Fe-4S] cluster, N7) of the NADH-quinone oxidoreductase/NADH dehydrogenase-1 (NDH-1) found in various bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|223965 COG1034, NuoG, NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|236118 PRK07860, PRK07860, NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|225918 COG3383, COG3383, Uncharacterized anaerobic dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|204520 pfam10588, NADH-G_4Fe-4S_3, NADH-ubiquinone oxidoreductase-G iron-sulfur binding region | Back alignment and domain information |
|---|
| >gnl|CDD|214918 smart00929, NADH-G_4Fe-4S_3, NADH-ubiquinone oxidoreductase-G iron-sulfur binding region | Back alignment and domain information |
|---|
| >gnl|CDD|204520 pfam10588, NADH-G_4Fe-4S_3, NADH-ubiquinone oxidoreductase-G iron-sulfur binding region | Back alignment and domain information |
|---|
| >gnl|CDD|140326 PTZ00305, PTZ00305, NADH:ubiquinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214918 smart00929, NADH-G_4Fe-4S_3, NADH-ubiquinone oxidoreductase-G iron-sulfur binding region | Back alignment and domain information |
|---|
| >gnl|CDD|140326 PTZ00305, PTZ00305, NADH:ubiquinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236170 PRK08166, PRK08166, NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|225918 COG3383, COG3383, Uncharacterized anaerobic dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|239154 cd02753, MopB_Formate-Dh-H, Formate dehydrogenase H (Formate-Dh-H) catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons | Back alignment and domain information |
|---|
| >gnl|CDD|239154 cd02753, MopB_Formate-Dh-H, Formate dehydrogenase H (Formate-Dh-H) catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons | Back alignment and domain information |
|---|
| >gnl|CDD|204199 pfam09326, DUF1982, Domain of unknown function (DUF1982) | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|225918 COG3383, COG3383, Uncharacterized anaerobic dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236277 PRK08493, PRK08493, NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236277 PRK08493, PRK08493, NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|239155 cd02754, MopB_Nitrate-R-NapA-like, Nitrate reductases, NapA (Nitrate-R-NapA), NasA, and NarB catalyze the reduction of nitrate to nitrite | Back alignment and domain information |
|---|
| >gnl|CDD|181037 PRK07569, PRK07569, bidirectional hydrogenase complex protein HoxU; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|130652 TIGR01591, Fdh-alpha, formate dehydrogenase, alpha subunit, archaeal-type | Back alignment and domain information |
|---|
| >gnl|CDD|181037 PRK07569, PRK07569, bidirectional hydrogenase complex protein HoxU; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220366 pfam09728, Taxilin, Myosin-like coiled-coil protein | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|130652 TIGR01591, Fdh-alpha, formate dehydrogenase, alpha subunit, archaeal-type | Back alignment and domain information |
|---|
| >gnl|CDD|223321 COG0243, BisC, Anaerobic dehydrogenases, typically selenocysteine-containing [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|239155 cd02754, MopB_Nitrate-R-NapA-like, Nitrate reductases, NapA (Nitrate-R-NapA), NasA, and NarB catalyze the reduction of nitrate to nitrite | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|114219 pfam05483, SCP-1, Synaptonemal complex protein 1 (SCP-1) | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|132519 TIGR03479, DMSO_red_II_alp, DMSO reductase family type II enzyme, molybdopterin subunit | Back alignment and domain information |
|---|
| >gnl|CDD|220366 pfam09728, Taxilin, Myosin-like coiled-coil protein | Back alignment and domain information |
|---|
| >gnl|CDD|130767 TIGR01706, NAPA, periplasmic nitrate reductase, large subunit | Back alignment and domain information |
|---|
| >gnl|CDD|197994 smart00926, Molybdop_Fe4S4, Molybdopterin oxidoreductase Fe4S4 domain | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|239151 cd02750, MopB_Nitrate-R-NarG-like, Respiratory nitrate reductase A (NarGHI), alpha chain (NarG) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|237416 PRK13532, PRK13532, nitrate reductase catalytic subunit; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1334 | |||
| KOG2282|consensus | 708 | 100.0 | ||
| PRK09130 | 687 | NADH dehydrogenase subunit G; Validated | 100.0 | |
| COG3383 | 978 | Uncharacterized anaerobic dehydrogenase [General f | 100.0 | |
| PRK07860 | 797 | NADH dehydrogenase subunit G; Validated | 100.0 | |
| TIGR01973 | 603 | NuoG NADH-quinone oxidoreductase, chain G. This mo | 100.0 | |
| PRK09129 | 776 | NADH dehydrogenase subunit G; Validated | 100.0 | |
| PRK08166 | 847 | NADH dehydrogenase subunit G; Validated | 100.0 | |
| COG1034 | 693 | NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc | 100.0 | |
| PRK08493 | 819 | NADH dehydrogenase subunit G; Validated | 100.0 | |
| cd02774 | 366 | MopB_Res-Cmplx1_Nad11-M MopB_Res_Cmplx1_Nad11_M: M | 100.0 | |
| cd02773 | 375 | MopB_Res-Cmplx1_Nad11 MopB_Res_Cmplx1_Nad11: The s | 100.0 | |
| cd02752 | 649 | MopB_Formate-Dh-Na-like Formate dehydrogenase N, a | 100.0 | |
| cd02768 | 386 | MopB_NADH-Q-OR-NuoG2 MopB_NADH-Q-OR-NuoG2: The Nuo | 100.0 | |
| TIGR01553 | 1009 | formate-DH-alph formate dehydrogenase, alpha subun | 100.0 | |
| cd02754 | 565 | MopB_Nitrate-R-NapA-like Nitrate reductases, NapA | 100.0 | |
| cd02772 | 414 | MopB_NDH-1_NuoG2 MopB_NDH-1_NuoG2: The second doma | 100.0 | |
| cd02766 | 501 | MopB_3 The MopB_3 CD includes a group of related u | 100.0 | |
| cd02753 | 512 | MopB_Formate-Dh-H Formate dehydrogenase H (Formate | 100.0 | |
| cd02771 | 472 | MopB_NDH-1_NuoG2-N7 MopB_NDH-1_NuoG2-N7: The secon | 100.0 | |
| TIGR03479 | 912 | DMSO_red_II_alp DMSO reductase family type II enzy | 100.0 | |
| cd02759 | 477 | MopB_Acetylene-hydratase The MopB_Acetylene-hydrat | 100.0 | |
| TIGR01591 | 671 | Fdh-alpha formate dehydrogenase, alpha subunit, ar | 100.0 | |
| cd02755 | 454 | MopB_Thiosulfate-R-like The MopB_Thiosulfate-R-lik | 100.0 | |
| cd02762 | 539 | MopB_1 The MopB_1 CD includes a group of related u | 100.0 | |
| TIGR01706 | 830 | NAPA periplasmic nitrate reductase, large subunit. | 100.0 | |
| cd02750 | 461 | MopB_Nitrate-R-NarG-like Respiratory nitrate reduc | 100.0 | |
| PRK13532 | 830 | nitrate reductase catalytic subunit; Provisional | 100.0 | |
| cd02764 | 524 | MopB_PHLH The MopB_PHLH CD includes a group of rel | 100.0 | |
| cd02763 | 679 | MopB_2 The MopB_2 CD includes a group of related u | 100.0 | |
| PRK15488 | 759 | thiosulfate reductase PhsA; Provisional | 100.0 | |
| cd02757 | 523 | MopB_Arsenate-R This CD includes the respiratory a | 100.0 | |
| cd00368 | 374 | Molybdopterin-Binding Molybdopterin-Binding (MopB) | 100.0 | |
| cd02758 | 735 | MopB_Tetrathionate-Ra The MopB_Tetrathionate-Ra CD | 100.0 | |
| cd02765 | 567 | MopB_4 The MopB_4 CD includes a group of related u | 100.0 | |
| cd02770 | 617 | MopB_DmsA-EC This CD (MopB_DmsA-EC) includes the D | 100.0 | |
| cd02756 | 676 | MopB_Arsenite-Ox Arsenite oxidase (Arsenite-Ox) ox | 100.0 | |
| cd02751 | 609 | MopB_DMSOR-like The MopB_DMSOR-like CD contains di | 100.0 | |
| cd02760 | 760 | MopB_Phenylacetyl-CoA-OR The MopB_Phenylacetyl-CoA | 100.0 | |
| TIGR02166 | 797 | dmsA_ynfE anaerobic dimethyl sulfoxide reductase, | 100.0 | |
| PRK14990 | 814 | anaerobic dimethyl sulfoxide reductase subunit A; | 100.0 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 100.0 | |
| TIGR03129 | 421 | one_C_dehyd_B formylmethanofuran dehydrogenase sub | 100.0 | |
| COG0243 | 765 | BisC Anaerobic dehydrogenases, typically selenocys | 100.0 | |
| cd02761 | 415 | MopB_FmdB-FwdB The MopB_FmdB-FwdB CD contains the | 100.0 | |
| TIGR02693 | 806 | arsenite_ox_L arsenite oxidase, large subunit. Thi | 100.0 | |
| cd02769 | 609 | MopB_DMSOR-BSOR-TMAOR The MopB_DMSOR-BSOR-TMAOR CD | 100.0 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 100.0 | |
| PRK14991 | 1031 | tetrathionate reductase subunit A; Provisional | 100.0 | |
| PRK09939 | 759 | putative oxidoreductase; Provisional | 100.0 | |
| TIGR02164 | 822 | torA trimethylamine-N-oxide reductase TorA. This v | 100.0 | |
| TIGR00509 | 770 | bisC_fam molybdopterin guanine dinucleotide-contai | 100.0 | |
| TIGR01580 | 1235 | narG respiratory nitrate reductase, alpha subunit. | 100.0 | |
| cd02767 | 574 | MopB_ydeP The MopB_ydeP CD includes a group of rel | 100.0 | |
| TIGR01701 | 743 | Fdhalpha-like oxidoreductase alpha (molybdopterin) | 100.0 | |
| PF00384 | 432 | Molybdopterin: Molybdopterin oxidoreductase; Inter | 100.0 | |
| PRK15102 | 825 | trimethylamine N-oxide reductase I catalytic subun | 100.0 | |
| KOG0996|consensus | 1293 | 100.0 | ||
| PTZ00305 | 297 | NADH:ubiquinone oxidoreductase; Provisional | 100.0 | |
| COG1029 | 429 | FwdB Formylmethanofuran dehydrogenase subunit B [E | 100.0 | |
| KOG0964|consensus | 1200 | 100.0 | ||
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 100.0 | |
| KOG0018|consensus | 1141 | 100.0 | ||
| KOG0933|consensus | 1174 | 100.0 | ||
| PRK07569 | 234 | bidirectional hydrogenase complex protein HoxU; Va | 99.96 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.95 | |
| COG5013 | 1227 | NarG Nitrate reductase alpha subunit [Energy produ | 99.94 | |
| PTZ00305 | 297 | NADH:ubiquinone oxidoreductase; Provisional | 99.86 | |
| COG1034 | 693 | NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc | 99.85 | |
| TIGR01973 | 603 | NuoG NADH-quinone oxidoreductase, chain G. This mo | 99.83 | |
| COG3383 | 978 | Uncharacterized anaerobic dehydrogenase [General f | 99.81 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.8 | |
| PRK09130 | 687 | NADH dehydrogenase subunit G; Validated | 99.79 | |
| KOG0250|consensus | 1074 | 99.78 | ||
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 99.73 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 99.71 | |
| PRK07860 | 797 | NADH dehydrogenase subunit G; Validated | 99.71 | |
| PRK08493 | 819 | NADH dehydrogenase subunit G; Validated | 99.7 | |
| KOG0964|consensus | 1200 | 99.7 | ||
| PRK09129 | 776 | NADH dehydrogenase subunit G; Validated | 99.7 | |
| PRK07569 | 234 | bidirectional hydrogenase complex protein HoxU; Va | 99.67 | |
| KOG2282|consensus | 708 | 99.65 | ||
| KOG0996|consensus | 1293 | 99.65 | ||
| PF06470 | 120 | SMC_hinge: SMC proteins Flexible Hinge Domain; Int | 99.6 | |
| PRK08166 | 847 | NADH dehydrogenase subunit G; Validated | 99.59 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 99.56 | |
| KOG0979|consensus | 1072 | 99.5 | ||
| PF10588 | 41 | NADH-G_4Fe-4S_3: NADH-ubiquinone oxidoreductase-G | 99.44 | |
| KOG0161|consensus | 1930 | 99.43 | ||
| PRK03918 | 880 | chromosome segregation protein; Provisional | 99.42 | |
| KOG0161|consensus | 1930 | 99.42 | ||
| PRK02224 | 880 | chromosome segregation protein; Provisional | 99.41 | |
| KOG0933|consensus | 1174 | 99.37 | ||
| KOG0250|consensus | 1074 | 99.34 | ||
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 99.31 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 99.29 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 99.25 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 99.25 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 99.23 | |
| PF04879 | 55 | Molybdop_Fe4S4: Molybdopterin oxidoreductase Fe4S4 | 99.23 | |
| KOG4674|consensus | 1822 | 99.2 | ||
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 99.19 | |
| KOG4674|consensus | 1822 | 99.13 | ||
| KOG0018|consensus | 1141 | 99.1 | ||
| PRK01156 | 895 | chromosome segregation protein; Provisional | 99.06 | |
| PF13510 | 82 | Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; | 99.0 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 98.96 | |
| PRK08764 | 135 | ferredoxin; Provisional | 98.68 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.62 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.62 | |
| PF09326 | 49 | DUF1982: Domain of unknown function (DUF1982); Int | 98.57 | |
| PRK05113 | 191 | electron transport complex protein RnfB; Provision | 98.52 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.46 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.39 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.29 | |
| KOG0979|consensus | 1072 | 98.25 | ||
| PRK06991 | 270 | ferredoxin; Provisional | 98.23 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.21 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.2 | |
| KOG0994|consensus | 1758 | 98.18 | ||
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.18 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 98.17 | |
| KOG1029|consensus | 1118 | 98.16 | ||
| KOG4643|consensus | 1195 | 98.14 | ||
| TIGR01944 | 165 | rnfB electron transport complex, RnfABCDGE type, B | 98.11 | |
| PF10588 | 41 | NADH-G_4Fe-4S_3: NADH-ubiquinone oxidoreductase-G | 98.08 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 98.05 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.04 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.04 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 98.03 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 98.02 | |
| KOG0976|consensus | 1265 | 98.01 | ||
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 98.0 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 98.0 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 97.98 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 97.94 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 97.9 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 97.88 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 97.87 | |
| KOG0971|consensus | 1243 | 97.84 | ||
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 97.83 | |
| KOG4643|consensus | 1195 | 97.82 | ||
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 97.8 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 97.79 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 97.78 | |
| KOG1029|consensus | 1118 | 97.75 | ||
| KOG0994|consensus | 1758 | 97.74 | ||
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 97.72 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 97.71 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.71 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 97.65 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 97.65 | |
| KOG0962|consensus | 1294 | 97.65 | ||
| PF13514 | 1111 | AAA_27: AAA domain | 97.63 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.6 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.57 | |
| KOG0977|consensus | 546 | 97.56 | ||
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 97.54 | |
| KOG1003|consensus | 205 | 97.53 | ||
| KOG0978|consensus | 698 | 97.52 | ||
| KOG0946|consensus | 970 | 97.5 | ||
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 97.48 | |
| KOG0977|consensus | 546 | 97.47 | ||
| TIGR00384 | 220 | dhsB succinate dehydrogenase and fumarate reductas | 97.46 | |
| KOG0995|consensus | 581 | 97.45 | ||
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.42 | |
| COG1143 | 172 | NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino | 97.42 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 97.41 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.4 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 97.37 | |
| KOG0980|consensus | 980 | 97.36 | ||
| PF13187 | 55 | Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_ | 97.31 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 97.3 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 97.3 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 97.3 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.27 | |
| KOG0995|consensus | 581 | 97.25 | ||
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 97.25 | |
| KOG0612|consensus | 1317 | 97.23 | ||
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.22 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 97.21 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 97.2 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 97.2 | |
| KOG1003|consensus | 205 | 97.19 | ||
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 97.18 | |
| KOG0976|consensus | 1265 | 97.17 | ||
| KOG0962|consensus | 1294 | 97.15 | ||
| KOG0963|consensus | 629 | 97.14 | ||
| KOG0946|consensus | 970 | 97.14 | ||
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 97.13 | |
| PF12798 | 15 | Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 | 97.09 | |
| KOG0980|consensus | 980 | 97.05 | ||
| KOG0963|consensus | 629 | 97.04 | ||
| PRK08764 | 135 | ferredoxin; Provisional | 97.03 | |
| KOG3256|consensus | 212 | 96.98 | ||
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 96.98 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.95 | |
| KOG0612|consensus | 1317 | 96.95 | ||
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.94 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 96.92 | |
| PF14697 | 59 | Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE | 96.9 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 96.9 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 96.88 | |
| KOG4673|consensus | 961 | 96.88 | ||
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.82 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 96.82 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 96.77 | |
| PF12838 | 52 | Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014 | 96.75 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 96.75 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 96.66 | |
| TIGR00403 | 183 | ndhI NADH-plastoquinone oxidoreductase subunit I p | 96.65 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 96.65 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.61 | |
| PRK12577 | 329 | succinate dehydrogenase iron-sulfur subunit; Provi | 96.55 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 96.52 | |
| PRK12576 | 279 | succinate dehydrogenase iron-sulfur subunit; Provi | 96.5 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.5 | |
| KOG4593|consensus | 716 | 96.5 | ||
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.48 | |
| PF00037 | 24 | Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T | 96.47 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.47 | |
| PF13514 | 1111 | AAA_27: AAA domain | 96.45 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 96.45 | |
| PRK06991 | 270 | ferredoxin; Provisional | 96.41 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 96.4 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.39 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.37 | |
| KOG0971|consensus | 1243 | 96.37 | ||
| TIGR02512 | 374 | Fe_only_hydrog hydrogenases, Fe-only. This model d | 96.36 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 96.34 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 96.33 | |
| PRK05888 | 164 | NADH dehydrogenase subunit I; Provisional | 96.33 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 96.33 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 96.3 | |
| CHL00014 | 167 | ndhI NADH dehydrogenase subunit I | 96.29 | |
| PRK06259 | 486 | succinate dehydrogenase/fumarate reductase iron-su | 96.28 | |
| TIGR02936 | 91 | fdxN_nitrog ferredoxin III, nif-specific. Members | 96.27 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 96.26 | |
| PF12837 | 24 | Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 | 96.24 | |
| PLN00071 | 81 | photosystem I subunit VII; Provisional | 96.24 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 96.24 | |
| PRK06273 | 165 | ferredoxin; Provisional | 96.18 | |
| KOG1853|consensus | 333 | 96.18 | ||
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 96.16 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 96.16 | |
| TIGR03048 | 80 | PS_I_psaC photosystem I iron-sulfur protein PsaC. | 96.14 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 96.13 | |
| PRK12387 | 180 | formate hydrogenlyase complex iron-sulfur subunit; | 96.11 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 96.07 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 96.05 | |
| PRK08222 | 181 | hydrogenase 4 subunit H; Validated | 96.02 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 96.01 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 95.98 | |
| KOG1937|consensus | 521 | 95.97 | ||
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 95.97 | |
| KOG1937|consensus | 521 | 95.9 | ||
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 95.89 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 95.89 | |
| KOG0999|consensus | 772 | 95.85 | ||
| TIGR01971 | 122 | NuoI NADH-quinone oxidoreductase, chain I. This mo | 95.85 | |
| CHL00065 | 81 | psaC photosystem I subunit VII | 95.85 | |
| PRK08348 | 120 | NADH-plastoquinone oxidoreductase subunit; Provisi | 95.77 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 95.75 | |
| KOG0978|consensus | 698 | 95.75 | ||
| PRK02651 | 81 | photosystem I subunit VII; Provisional | 95.72 | |
| TIGR01944 | 165 | rnfB electron transport complex, RnfABCDGE type, B | 95.69 | |
| PRK12385 | 244 | fumarate reductase iron-sulfur subunit; Provisiona | 95.65 | |
| PRK10194 | 163 | ferredoxin-type protein; Provisional | 95.62 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 95.6 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 95.55 | |
| TIGR00402 | 101 | napF ferredoxin-type protein NapF. The gene codes | 95.55 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 95.53 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 95.52 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 95.45 | |
| KOG4593|consensus | 716 | 95.45 | ||
| KOG0999|consensus | 772 | 95.43 | ||
| PRK05950 | 232 | sdhB succinate dehydrogenase iron-sulfur subunit; | 95.39 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 95.39 | |
| KOG0249|consensus | 916 | 95.38 | ||
| PF12838 | 52 | Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014 | 95.34 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 95.26 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 95.25 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 95.24 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 95.23 | |
| KOG0249|consensus | 916 | 95.2 | ||
| TIGR02176 | 1165 | pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid | 95.19 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 95.17 | |
| KOG4809|consensus | 654 | 95.16 | ||
| PRK14028 | 312 | pyruvate ferredoxin oxidoreductase subunit gamma/d | 95.16 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 95.15 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 95.15 | |
| COG2221 | 317 | DsrA Dissimilatory sulfite reductase (desulfovirid | 95.12 | |
| PRK09476 | 254 | napG quinol dehydrogenase periplasmic component; P | 95.1 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 95.1 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 95.07 | |
| PRK05113 | 191 | electron transport complex protein RnfB; Provision | 95.06 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 95.02 | |
| TIGR00397 | 213 | mauM_napG MauM/NapG family ferredoxin-type protein | 95.02 | |
| PRK13552 | 239 | frdB fumarate reductase iron-sulfur subunit; Provi | 94.97 | |
| COG1142 | 165 | HycB Fe-S-cluster-containing hydrogenase component | 94.95 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 94.89 | |
| TIGR02912 | 314 | sulfite_red_C sulfite reductase, subunit C. Member | 94.88 | |
| PRK09477 | 271 | napH quinol dehydrogenase membrane component; Prov | 94.85 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 94.84 | |
| PF06705 | 247 | SF-assemblin: SF-assemblin/beta giardin | 94.84 | |
| KOG1853|consensus | 333 | 94.83 | ||
| KOG4809|consensus | 654 | 94.79 | ||
| KOG2991|consensus | 330 | 94.79 | ||
| PRK05035 | 695 | electron transport complex protein RnfC; Provision | 94.72 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 94.71 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 94.62 | |
| KOG4360|consensus | 596 | 94.58 | ||
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 94.53 | |
| PRK09626 | 103 | oorD 2-oxoglutarate-acceptor oxidoreductase subuni | 94.47 | |
| TIGR03224 | 411 | benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p | 94.46 | |
| PRK09624 | 105 | porD pyuvate ferredoxin oxidoreductase subunit del | 94.45 | |
| COG1139 | 459 | Uncharacterized conserved protein containing a fer | 94.4 | |
| COG1145 | 99 | NapF Ferredoxin [Energy production and conversion] | 94.32 | |
| PRK08318 | 420 | dihydropyrimidine dehydrogenase subunit B; Validat | 94.31 | |
| TIGR01660 | 492 | narH nitrate reductase, beta subunit. The Nitrate | 94.29 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 94.23 | |
| COG1143 | 172 | NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino | 94.21 | |
| PF13484 | 67 | Fer4_16: 4Fe-4S double cluster binding domain | 94.21 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 94.18 | |
| KOG4360|consensus | 596 | 94.14 | ||
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 94.14 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 94.13 | |
| COG1146 | 68 | Ferredoxin [Energy production and conversion] | 94.11 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 94.05 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 94.03 | |
| PRK09898 | 208 | hypothetical protein; Provisional | 94.03 | |
| TIGR02494 | 295 | PFLE_PFLC glycyl-radical enzyme activating protein | 93.99 | |
| PRK09623 | 105 | vorD 2-ketoisovalerate ferredoxin oxidoreductase s | 93.97 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 93.97 | |
| KOG1899|consensus | 861 | 93.88 | ||
| COG1149 | 284 | MinD superfamily P-loop ATPase containing an inser | 93.81 | |
| TIGR02163 | 255 | napH_ ferredoxin-type protein, NapH/MauN family. M | 93.77 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 93.76 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 93.74 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 93.68 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 93.66 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 93.65 | |
| TIGR00315 | 162 | cdhB CO dehydrogenase/acetyl-CoA synthase complex, | 93.64 | |
| PF13510 | 82 | Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; | 93.52 | |
| PRK11433 | 217 | aldehyde oxidoreductase 2Fe-2S subunit; Provisiona | 93.49 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 93.49 | |
| PRK10361 | 475 | DNA recombination protein RmuC; Provisional | 93.44 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 93.37 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 93.37 | |
| COG2080 | 156 | CoxS Aerobic-type carbon monoxide dehydrogenase, s | 93.35 | |
| COG3862 | 117 | Uncharacterized protein with conserved CXXC pairs | 93.27 | |
| KOG0804|consensus | 493 | 93.26 | ||
| PF13187 | 55 | Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_ | 93.22 | |
| TIGR03478 | 321 | DMSO_red_II_bet DMSO reductase family type II enzy | 93.08 | |
| TIGR03149 | 225 | cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S | 93.05 | |
| COG0479 | 234 | FrdB Succinate dehydrogenase/fumarate reductase, F | 93.01 | |
| PRK09625 | 133 | porD pyruvate flavodoxin oxidoreductase subunit de | 93.0 | |
| COG2878 | 198 | Predicted NADH:ubiquinone oxidoreductase, subunit | 92.99 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 92.94 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 92.92 | |
| PF14697 | 59 | Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE | 92.91 | |
| KOG0243|consensus | 1041 | 92.9 | ||
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 92.89 | |
| PRK05659 | 66 | sulfur carrier protein ThiS; Validated | 92.83 | |
| TIGR00273 | 432 | iron-sulfur cluster-binding protein. Members of th | 92.79 | |
| TIGR01372 | 985 | soxA sarcosine oxidase, alpha subunit family, hete | 92.79 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 92.73 | |
| COG0437 | 203 | HybA Fe-S-cluster-containing hydrogenase component | 92.7 | |
| KOG1899|consensus | 861 | 92.63 | ||
| PRK10882 | 328 | hydrogenase 2 protein HybA; Provisional | 92.62 | |
| PRK07118 | 280 | ferredoxin; Validated | 92.61 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 92.57 | |
| PRK00945 | 171 | acetyl-CoA decarbonylase/synthase complex subunit | 92.55 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 92.53 | |
| KOG2129|consensus | 552 | 92.51 | ||
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 92.5 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 92.48 | |
| TIGR03315 | 1012 | Se_ygfK putative selenate reductase, YgfK subunit. | 92.47 | |
| TIGR02060 | 132 | aprB adenosine phosphosulphate reductase, beta sub | 92.37 | |
| TIGR03478 | 321 | DMSO_red_II_bet DMSO reductase family type II enzy | 92.25 | |
| PRK09898 | 208 | hypothetical protein; Provisional | 92.22 | |
| TIGR03193 | 148 | 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm | 92.1 | |
| TIGR02179 | 78 | PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta | 92.02 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 91.97 | |
| PRK10194 | 163 | ferredoxin-type protein; Provisional | 91.96 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 91.9 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 91.85 | |
| PF13237 | 52 | Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A. | 91.79 | |
| COG0437 | 203 | HybA Fe-S-cluster-containing hydrogenase component | 91.7 | |
| PRK09626 | 103 | oorD 2-oxoglutarate-acceptor oxidoreductase subuni | 91.66 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 91.63 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 91.62 | |
| PRK07118 | 280 | ferredoxin; Validated | 91.61 | |
| COG1029 | 429 | FwdB Formylmethanofuran dehydrogenase subunit B [E | 91.56 | |
| PRK09908 | 159 | xanthine dehydrogenase subunit XdhC; Provisional | 91.53 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 91.53 | |
| PF13247 | 98 | Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX | 91.53 | |
| TIGR03198 | 151 | pucE xanthine dehydrogenase E subunit. This gene h | 91.52 | |
| KOG0804|consensus | 493 | 91.45 | ||
| COG1144 | 91 | Pyruvate:ferredoxin oxidoreductase and related 2-o | 91.45 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 91.43 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 91.42 | |
| KOG0982|consensus | 502 | 91.26 | ||
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 91.23 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 91.21 | |
| PF12800 | 17 | Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 | 91.2 | |
| COG1145 | 99 | NapF Ferredoxin [Energy production and conversion] | 91.2 | |
| TIGR03048 | 80 | PS_I_psaC photosystem I iron-sulfur protein PsaC. | 91.2 | |
| PRK12386 | 251 | fumarate reductase iron-sulfur subunit; Provisiona | 91.19 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 91.11 | |
| KOG4438|consensus | 446 | 91.05 | ||
| PF13183 | 57 | Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_ | 91.05 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 90.98 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 90.97 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 90.96 | |
| KOG2129|consensus | 552 | 90.9 | ||
| PLN02939 | 977 | transferase, transferring glycosyl groups | 90.88 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 90.86 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 90.86 | |
| PF13166 | 712 | AAA_13: AAA domain | 90.77 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 90.76 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 90.56 | |
| PRK14993 | 244 | tetrathionate reductase subunit B; Provisional | 90.46 | |
| PRK10882 | 328 | hydrogenase 2 protein HybA; Provisional | 90.45 | |
| TIGR02066 | 341 | dsrB sulfite reductase, dissimilatory-type beta su | 90.2 | |
| PRK08348 | 120 | NADH-plastoquinone oxidoreductase subunit; Provisi | 90.18 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 90.17 | |
| KOG0243|consensus | 1041 | 90.15 | ||
| KOG4673|consensus | 961 | 90.02 | ||
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 89.99 | |
| KOG4302|consensus | 660 | 89.95 | ||
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 89.76 | |
| PRK09853 | 1019 | putative selenate reductase subunit YgfK; Provisio | 89.67 | |
| PRK14993 | 244 | tetrathionate reductase subunit B; Provisional | 89.65 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 89.65 | |
| COG2768 | 354 | Uncharacterized Fe-S center protein [General funct | 89.63 | |
| PRK08222 | 181 | hydrogenase 4 subunit H; Validated | 89.61 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 89.6 | |
| TIGR02745 | 434 | ccoG_rdxA_fixG cytochrome c oxidase accessory prot | 89.41 | |
| PLN00071 | 81 | photosystem I subunit VII; Provisional | 89.41 | |
| TIGR01582 | 283 | FDH-beta formate dehydrogenase, beta subunit, Fe-S | 89.38 | |
| KOG0982|consensus | 502 | 89.34 | ||
| TIGR02700 | 234 | flavo_MJ0208 archaeoflavoprotein, MJ0208 family. T | 89.32 | |
| COG4656 | 529 | RnfC Predicted NADH:ubiquinone oxidoreductase, sub | 89.24 | |
| PF13746 | 69 | Fer4_18: 4Fe-4S dicluster domain | 89.23 | |
| PRK05888 | 164 | NADH dehydrogenase subunit I; Provisional | 89.19 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 89.17 | |
| PRK07440 | 70 | hypothetical protein; Provisional | 89.16 | |
| PF15450 | 531 | DUF4631: Domain of unknown function (DUF4631) | 89.15 | |
| PRK02651 | 81 | photosystem I subunit VII; Provisional | 89.01 | |
| PRK06273 | 165 | ferredoxin; Provisional | 88.87 | |
| TIGR00276 | 282 | iron-sulfur cluster binding protein, putative. Thi | 88.84 | |
| COG1149 | 284 | MinD superfamily P-loop ATPase containing an inser | 88.79 | |
| PRK00945 | 171 | acetyl-CoA decarbonylase/synthase complex subunit | 88.73 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 88.7 | |
| PF10212 | 518 | TTKRSYEDQ: Predicted coiled-coil domain-containing | 88.68 | |
| PRK10330 | 181 | formate dehydrogenase-H ferredoxin subunit; Provis | 88.53 | |
| TIGR03149 | 225 | cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S | 88.45 | |
| TIGR01971 | 122 | NuoI NADH-quinone oxidoreductase, chain I. This mo | 88.41 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 88.14 | |
| PF03148 | 384 | Tektin: Tektin family; InterPro: IPR000435 Tektin | 88.1 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 88.1 | |
| CHL00065 | 81 | psaC photosystem I subunit VII | 88.04 | |
| COG1600 | 337 | Uncharacterized Fe-S protein [Energy production an | 87.51 | |
| COG2768 | 354 | Uncharacterized Fe-S center protein [General funct | 87.48 | |
| PRK15055 | 344 | anaerobic sulfite reductase subunit A; Provisional | 87.42 | |
| KOG2991|consensus | 330 | 87.32 | ||
| TIGR02176 | 1165 | pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid | 87.29 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 87.22 | |
| TIGR00314 | 784 | cdhA CO dehydrogenase/acetyl-CoA synthase complex, | 87.12 | |
| PRK00941 | 781 | acetyl-CoA decarbonylase/synthase complex subunit | 87.09 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 87.04 | |
| PRK09853 | 1019 | putative selenate reductase subunit YgfK; Provisio | 86.93 | |
| TIGR02066 | 341 | dsrB sulfite reductase, dissimilatory-type beta su | 86.9 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 86.79 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 86.72 | |
| PRK07570 | 250 | succinate dehydrogenase/fumarate reductase iron-su | 86.69 | |
| COG1152 | 772 | CdhA CO dehydrogenase/acetyl-CoA synthase alpha su | 86.61 | |
| TIGR02936 | 91 | fdxN_nitrog ferredoxin III, nif-specific. Members | 86.61 | |
| COG1148 | 622 | HdrA Heterodisulfide reductase, subunit A and rela | 86.52 | |
| TIGR02338 | 110 | gimC_beta prefoldin, beta subunit, archaeal. Chape | 86.46 | |
| TIGR03336 | 595 | IOR_alpha indolepyruvate ferredoxin oxidoreductase | 86.44 | |
| cd01916 | 731 | ACS_1 Acetyl-CoA synthase (ACS), also known as ace | 86.33 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 86.32 | |
| KOG4807|consensus | 593 | 86.28 | ||
| KOG3256|consensus | 212 | 86.22 | ||
| COG1142 | 165 | HycB Fe-S-cluster-containing hydrogenase component | 86.22 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 86.11 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 85.99 | |
| TIGR02951 | 161 | DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi | 85.9 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 85.81 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 85.81 | |
| KOG4438|consensus | 446 | 85.76 | ||
| TIGR03287 | 391 | methan_mark_16 putative methanogenesis marker 16 m | 85.73 | |
| COG5293 | 591 | Predicted ATPase [General function prediction only | 85.72 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 85.62 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 85.57 | |
| COG4231 | 640 | Indolepyruvate ferredoxin oxidoreductase, alpha an | 85.55 | |
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 85.5 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 85.48 | |
| PF12252 | 1439 | SidE: Dot/Icm substrate protein; InterPro: IPR0210 | 85.41 |
| >KOG2282|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.6e-128 Score=1064.08 Aligned_cols=594 Identities=70% Similarity=1.131 Sum_probs=565.6
Q ss_pred CCcEEEEECCEEEEeCCCCcchh------------------------------------hhhhhcCCCCCCCEEEcCCHH
Q psy11935 662 NEKFEVFIDDKKVMVDPGTTVLQ------------------------------------PVAACAMPVMKGWRVKTNSEM 705 (1334)
Q Consensus 662 ~~~~~~~idg~~~~v~~g~til~------------------------------------~~~ac~~~~~~gm~v~t~s~~ 705 (1334)
++.|+++|||++|.|+||+|||| |++||+|||+.||+|.|+|+.
T Consensus 30 ~~~ievfvd~~~v~v~pg~tvlqac~~~gv~iprfcyh~rlsvagncrmclvevekspkpva~campvm~g~~iktns~~ 109 (708)
T KOG2282|consen 30 PNKIEVFVDDQSVMVEPGTTVLQACAKVGVDIPRFCYHERLSVAGNCRMCLVEVEKSPKPVAACAMPVMKGWKIKTNSDK 109 (708)
T ss_pred ccceEEEECCeeEeeCCCcHHHHHHHHhCCCcchhhhhhhhhhccceeEEEEEeccCCCcchhhcccccCCceeecCchH
Confidence 78999999999999999999999 999999999999999999999
Q ss_pred HHHHHHHHHHHHHHhCCCCCCCCCCCCCCchhhhHHHhCCCCCcccccccCCCCCccchhhhhhccCCCCcccccceeec
Q psy11935 706 TRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDIDFSGKSGTYTRVTRQRSWGLIPSRVFLQSINR 785 (1334)
Q Consensus 706 ~~~~r~~~~~~ll~~hp~~C~~c~~~g~c~lq~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ip~lc~~~~v~~ 785 (1334)
++++|++||||||.|||||||||||||||+|||++|.||++++||.+ +|| +|++
T Consensus 110 ~kkaregvmefll~nhpldcpicdqggecdlqdq~m~fgsdr~rf~~----~kr----------------------aved 163 (708)
T KOG2282|consen 110 SKKAREGVMEFLLMNHPLDCPICDQGGECDLQDQAMAFGSDRSRFTE----GKR----------------------AVED 163 (708)
T ss_pred HHHHHHHHHHHHHhCCCCCCCccCCCCcCcchHhHhhhcCchhhhhh----hhh----------------------hhhc
Confidence 99999999999999999999999999999999999999999999999 899 9999
Q ss_pred CCCcccccccccCCCCcEEEcCCHHHHHHHHHHHHHHhhCCCCCCcccccCCccchhhhhcccCccccccCCCCCceecc
Q psy11935 786 HWIGPVAACAMPVMKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGNDLGTTGRGSDMQVGT 865 (1334)
Q Consensus 786 ~~~~~~~aC~~~v~~gm~i~t~s~~~r~~r~~~~~~ll~~h~~~C~~C~~~g~c~~~~~e~~g~~~~~~~~rg~~~~i~~ 865 (1334)
++.||+ |.| -|+|| |+|+|| |||+.||+|+++||..|||.+++||+
T Consensus 164 knigpl------------vkt--imtrc--------------iqctrc------vrfaseiagv~dlgttgrg~d~qigt 209 (708)
T KOG2282|consen 164 KNIGPL------------VKT--IMTRC--------------IQCTRC------VRFASEIAGVDDLGTTGRGNDMQIGT 209 (708)
T ss_pred CccchH------------HHH--HHHHH--------------HhHHHH------HHHHHhhcCCcccccccCCCcchHHH
Confidence 999999 999 99999 999999 99999999999999999999999999
Q ss_pred ccccccccccccccccccccccccccCCcccCCCCcceeeeeecccCCCCCceEEEeeCCEEEEecCCCCCCCCcccccc
Q psy11935 866 YVEKLFLSELSGNVIDLCPVGALTSKPYSFTARPWETRKTESVDVLDAVGSNIIVSTRTGEVLRVLPRLNEDINEEWLAD 945 (1334)
Q Consensus 866 ~~~~~~~~~~cg~cv~~CpvGAl~~k~~~~~~r~we~~~~~s~c~~C~~gC~i~v~v~~g~v~ri~p~~~~~vn~g~lC~ 945 (1334)
|.++.+.++++||.||+|||||||+|||.|++||||+++++|+++++++|++|.|.+|.|+|+||.|+.|+++|+.||.|
T Consensus 210 yvek~f~selsgniidicpvgaltskpyaf~arpwe~rktesidv~davgsnivvs~rt~ev~ri~pr~nedineewi~d 289 (708)
T KOG2282|consen 210 YVEKLFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVLRILPRMNEDINEEWISD 289 (708)
T ss_pred HHHHHHHHhhcCCeeeeccccccccCcceeeccccccccccceehhhhccCcEEEecCCccceeeccccccccchhhhcc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccccccccccccCCceEecCCCCeeecCHHHHHHHHHHHhcc---CCEEEEeCCcCCHHHHHHHHHHHHHhCCCcccc
Q psy11935 946 KGRFAYDGLKRQRLLTPFVRNCDGQLVATEWEDALIAVAQKLQT---SEVAGVVGSLADAEAMVALKDLLNKLGSEDLYT 1022 (1334)
Q Consensus 946 kgr~~~~~l~~~Rl~~PliR~~~g~~~~iSWdeAl~~ia~~L~~---~~i~~~~g~~~~~e~~~~~~~l~~~lGs~~~~~ 1022 (1334)
|.||+||++..+||+.||+|..+|.|+++||++||..+|..|++ +.+++++|+..+.|.+.+++.|++++|+.++.+
T Consensus 290 ksrfa~dglkrqrl~~pmvr~~~g~l~~~~we~al~~va~~~~~~~~~~~a~iag~L~daea~valkdl~nrl~se~v~t 369 (708)
T KOG2282|consen 290 KSRFAYDGLKRQRLTEPMVRNEDGLLKAVSWEDALSRVAGMLQSFQGKQIAAIAGGLVDAEALVALKDLLNRVGSENVCT 369 (708)
T ss_pred cceeeecchhhhhhcccceeCCCCceeeeeHHHHHHHHHHHHHhcCccceeeeccchhhHHHHHHHHHHHhhcCccccee
Confidence 99999999999999999999989999999999999999999998 889999999999999999999999999999999
Q ss_pred CCCCCcchhhhhhhhhccCCCCcccccccCeEEEEcCCccccchhHHHHHHHHHhhCCCeEEEEccCCCCccccccCCCc
Q psy11935 1023 EYAFPLEGAGTDLRANYLLNNKIAGAEEADLILLIGTNPRFEAPLFNARIRKGYLTNELDVAYIGPKVDLRYDYEHLGES 1102 (1334)
Q Consensus 1023 ~~~~~~~~~~~~~~~~~~~~~~~~die~ad~Il~~G~np~~~~p~~~~rir~a~~~~g~kiivIdp~~~~t~~~a~~Gtd 1102 (1334)
...|. +.+.+++++|+++.++..+++||.++++|+||+.++|.++.|+|+.+.++..++.+|+|..+++|.+.+||++
T Consensus 370 e~~f~--s~gtdlrsnyl~nt~iag~e~adavllVgtnpr~eap~~narirks~~~~~~qv~~Ig~~aDl~y~~~~lga~ 447 (708)
T KOG2282|consen 370 EEVFP--GGGTDLRSNYLLNTTIAGVEEADAVLLVGTNPRFEAPLVNARIRKSWLHNDLQVALIGPPVDLTYDYDHLGAS 447 (708)
T ss_pred ecccC--CCCchhhhhhhhhcchhhhcccceeeeecCCccccccccchhhheeeeeccceeeeecCCcceeeeeccCCCc
Confidence 98887 5678999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhcHHHHHHHHhcCCCcEEEEcCCc---ccHHHHHHHHHHHHHhhcCCCCCCCCCcccccchhhhhhhhhhhc
Q psy11935 1103 ADLIKQLASGSHPFSKKLSAAKKPLIVVGADI---SDGAAVLALVQQLAAKVTCESDVPCDWKVLNILQKAASQVAALDI 1179 (1334)
Q Consensus 1103 ~a~l~~l~~g~~~~A~~l~~a~~~~ii~G~~~---~~g~~~~~al~~l~~~~g~~Gg~~~~~~~~~~l~~~~n~~G~~~~ 1179 (1334)
+.++..+++|++.||+.+..++.|+||+|.+. .+|.++...+..++..++.. ..|+.+|+|+..+..+|+++.
T Consensus 448 ~~i~~~Ia~g~h~fak~l~~ak~p~iIvga~~l~r~dgaAil~~v~qia~kL~~~----~~w~~~nvL~~~a~q~~aLd~ 523 (708)
T KOG2282|consen 448 AKILKDIASGSHPFSKVLKEAKKPAIIVGASALQRNDGAAILAAVSSIAQKLRMT----PDWKVLNVLQRIAAQVGALDV 523 (708)
T ss_pred HHHHHHHHcCccHHHHHhccCCCceEEEcchhhcccchhHHHHHHHHHHHHhccC----CcceeehHHHHhhhhhhhccc
Confidence 99999999999999999999999999999988 78888888888888887653 579999999999999999999
Q ss_pred CCCcchhhHhcCCCcEEEEECCChhhhHHhhcCCCceEEEEcCCCChhhccccEEecCCCCCCCCcccccCCCceEEecc
Q psy11935 1180 GYKPGTSAIREKPPKVLFLLGADEGSISRDDVGKDCFIIYQGHHGDHGASIADAILPGAAYTEKQSTYVNTEGRAQQTLT 1259 (1334)
Q Consensus 1180 g~~pg~~~i~~g~ik~l~~~g~np~~~~~~al~k~~fvV~~d~~~~eta~~ADvVLP~a~~~Ek~Gt~~n~egrvq~~~~ 1259 (1334)
|+.+|...+....+|++|++|+|.....++.+++.+||||++||+|..+..||||||++.|+|+.|+|+|++|+.|...|
T Consensus 524 gyk~ga~~~~k~~~KVlylL~Ad~g~vt~~~lPkd~fvvyqghhgD~ga~~AdvvlpgaaytekeGtyvntegr~Qqt~p 603 (708)
T KOG2282|consen 524 GYKAGVAAIRKNPPKVLFLLGADAGKVTRQDLPKDCFVVYQGHHGDVGAPIADVVLPGAAYTEKEGTYVNTEGRAQQTKP 603 (708)
T ss_pred cchhhhHHHhcCCceEEEEeccCCCcchhhcCChhheEEeeeeecccccccceeecceeeEecccceeecccCccccccC
Confidence 99999888888899999999999977788899999999999999999999999999999999999999999999999999
Q ss_pred ccCCCCCcccHHHHHHHHHHHhc-------------------CCCC------C-----------------CCcccccccc
Q psy11935 1260 AVTPPGLAREDWKIIRALSEGVS-------------------SNLS------S-----------------EPVDVKQKNL 1297 (1334)
Q Consensus 1260 av~P~gear~dw~Il~~La~~lg-------------------~~~~------~-----------------~~~~~~~~~~ 1297 (1334)
++.|||++|.||.|+++|++.-| |+|. . .|+. +...+
T Consensus 604 av~ppg~ar~dwkIirALSevsg~~Lpyssl~~vr~rle~vaPnLVr~de~E~Aafgpsakp~sket~~ttp~~-p~~~l 682 (708)
T KOG2282|consen 604 AVSPPGDAREDWKIIRALSEVSGKTLPYDTLDEVRNRLEEVAPNLVRYDDLEPAAFGPQAKPLSKETGSTTPDD-PLLEL 682 (708)
T ss_pred CCCCCcccccchHHHHHHHHhcCCCCCcccHHHHHHhhhhcCCcceecccccccccccccchhhhhhcCCCCCc-chHHH
Confidence 99999999999999999999977 2211 1 2222 12357
Q ss_pred ccccccchhhhchHHHHHhHHHHHh
Q psy11935 1298 EDYYMTDPISRASGTMAKCIQAVHK 1322 (1334)
Q Consensus 1298 ~~~y~td~i~r~s~~m~~~~~~~~~ 1322 (1334)
+||||||+|||+|++||+|+++..+
T Consensus 683 edfYMTNSISRASk~MAQCsaallK 707 (708)
T KOG2282|consen 683 EDFYMTNSISRASKTMAQCSKAVLK 707 (708)
T ss_pred HHHhhhhhhhhhhHHHHHHHHHHhc
Confidence 8999999999999999999998754
|
|
| >PRK09130 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07860 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >TIGR01973 NuoG NADH-quinone oxidoreductase, chain G | Back alignment and domain information |
|---|
| >PRK09129 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK08166 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08493 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >cd02774 MopB_Res-Cmplx1_Nad11-M MopB_Res_Cmplx1_Nad11_M: Mitochondrial-encoded NADH-quinone oxidoreductase/respiratory complex I, the second domain of the Nad11/75-kDa subunit of some protists | Back alignment and domain information |
|---|
| >cd02773 MopB_Res-Cmplx1_Nad11 MopB_Res_Cmplx1_Nad11: The second domain of the Nad11/75-kDa subunit of the NADH-quinone oxidoreductase/respiratory complex I/NADH dehydrogenase-1(NDH-1) of eukaryotes and the Nqo3/G subunit of alphaproteobacteria NDH-1 | Back alignment and domain information |
|---|
| >cd02752 MopB_Formate-Dh-Na-like Formate dehydrogenase N, alpha subunit (Formate-Dh-Na) is a major component of nitrate respiration in bacteria such as in the E | Back alignment and domain information |
|---|
| >cd02768 MopB_NADH-Q-OR-NuoG2 MopB_NADH-Q-OR-NuoG2: The NuoG/Nad11/75-kDa subunit (second domain) of the NADH-quinone oxidoreductase (NADH-Q-OR)/respiratory complex I/NADH dehydrogenase-1 (NDH-1) | Back alignment and domain information |
|---|
| >TIGR01553 formate-DH-alph formate dehydrogenase, alpha subunit, proteobacterial-type | Back alignment and domain information |
|---|
| >cd02754 MopB_Nitrate-R-NapA-like Nitrate reductases, NapA (Nitrate-R-NapA), NasA, and NarB catalyze the reduction of nitrate to nitrite | Back alignment and domain information |
|---|
| >cd02772 MopB_NDH-1_NuoG2 MopB_NDH-1_NuoG2: The second domain of the NuoG subunit of the NADH-quinone oxidoreductase/NADH dehydrogenase-1 (NDH-1), found in beta- and gammaproteobacteria | Back alignment and domain information |
|---|
| >cd02766 MopB_3 The MopB_3 CD includes a group of related uncharacterized bacterial and archaeal molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site | Back alignment and domain information |
|---|
| >cd02753 MopB_Formate-Dh-H Formate dehydrogenase H (Formate-Dh-H) catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons | Back alignment and domain information |
|---|
| >cd02771 MopB_NDH-1_NuoG2-N7 MopB_NDH-1_NuoG2-N7: The second domain of the NuoG subunit (with a [4Fe-4S] cluster, N7) of the NADH-quinone oxidoreductase/NADH dehydrogenase-1 (NDH-1) found in various bacteria | Back alignment and domain information |
|---|
| >TIGR03479 DMSO_red_II_alp DMSO reductase family type II enzyme, molybdopterin subunit | Back alignment and domain information |
|---|
| >cd02759 MopB_Acetylene-hydratase The MopB_Acetylene-hydratase CD contains acetylene hydratase (Ahy) and other related proteins | Back alignment and domain information |
|---|
| >TIGR01591 Fdh-alpha formate dehydrogenase, alpha subunit, archaeal-type | Back alignment and domain information |
|---|
| >cd02755 MopB_Thiosulfate-R-like The MopB_Thiosulfate-R-like CD contains thiosulfate-, sulfur-, and polysulfide-reductases, and other related proteins | Back alignment and domain information |
|---|
| >cd02762 MopB_1 The MopB_1 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site | Back alignment and domain information |
|---|
| >TIGR01706 NAPA periplasmic nitrate reductase, large subunit | Back alignment and domain information |
|---|
| >cd02750 MopB_Nitrate-R-NarG-like Respiratory nitrate reductase A (NarGHI), alpha chain (NarG) and related proteins | Back alignment and domain information |
|---|
| >PRK13532 nitrate reductase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd02764 MopB_PHLH The MopB_PHLH CD includes a group of related uncharacterized putative hydrogenase-like homologs (PHLH) of molybdopterin binding (MopB) proteins | Back alignment and domain information |
|---|
| >cd02763 MopB_2 The MopB_2 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site | Back alignment and domain information |
|---|
| >PRK15488 thiosulfate reductase PhsA; Provisional | Back alignment and domain information |
|---|
| >cd02757 MopB_Arsenate-R This CD includes the respiratory arsenate reductase, As(V), catalytic subunit (ArrA) and other related proteins | Back alignment and domain information |
|---|
| >cd00368 Molybdopterin-Binding Molybdopterin-Binding (MopB) domain of the MopB superfamily of proteins, a large, diverse, heterogeneous superfamily of enzymes that, in general, bind molybdopterin as a cofactor | Back alignment and domain information |
|---|
| >cd02758 MopB_Tetrathionate-Ra The MopB_Tetrathionate-Ra CD contains tetrathionate reductase, subunit A, (TtrA) and other related proteins | Back alignment and domain information |
|---|
| >cd02765 MopB_4 The MopB_4 CD includes a group of related uncharacterized bacterial and archaeal molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site | Back alignment and domain information |
|---|
| >cd02770 MopB_DmsA-EC This CD (MopB_DmsA-EC) includes the DmsA enzyme of the dmsABC operon encoding the anaerobic dimethylsulfoxide reductase (DMSOR) of Escherichia coli and other related DMSOR-like enzymes | Back alignment and domain information |
|---|
| >cd02756 MopB_Arsenite-Ox Arsenite oxidase (Arsenite-Ox) oxidizes arsenite to the less toxic arsenate; it transfers the electrons obtained from the oxidation of arsenite towards the soluble periplasmic electron carriers cytochrome c and/or amicyanin | Back alignment and domain information |
|---|
| >cd02751 MopB_DMSOR-like The MopB_DMSOR-like CD contains dimethylsulfoxide reductase (DMSOR), biotin sulfoxide reductase (BSOR), trimethylamine N-oxide reductase (TMAOR) and other related proteins | Back alignment and domain information |
|---|
| >cd02760 MopB_Phenylacetyl-CoA-OR The MopB_Phenylacetyl-CoA-OR CD contains the phenylacetyl-CoA:acceptor oxidoreductase, large subunit (PadB2), and other related proteins | Back alignment and domain information |
|---|
| >TIGR02166 dmsA_ynfE anaerobic dimethyl sulfoxide reductase, A subunit, DmsA/YnfE family | Back alignment and domain information |
|---|
| >PRK14990 anaerobic dimethyl sulfoxide reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03129 one_C_dehyd_B formylmethanofuran dehydrogenase subunit B | Back alignment and domain information |
|---|
| >COG0243 BisC Anaerobic dehydrogenases, typically selenocysteine-containing [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd02761 MopB_FmdB-FwdB The MopB_FmdB-FwdB CD contains the molybdenum/tungsten formylmethanofuran dehydrogenases, subunit B (FmdB/FwdB), and other related proteins | Back alignment and domain information |
|---|
| >TIGR02693 arsenite_ox_L arsenite oxidase, large subunit | Back alignment and domain information |
|---|
| >cd02769 MopB_DMSOR-BSOR-TMAOR The MopB_DMSOR-BSOR-TMAOR CD contains dimethylsulfoxide reductase (DMSOR), biotin sulfoxide reductase (BSOR), trimethylamine N-oxide reductase (TMAOR) and other related proteins | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PRK14991 tetrathionate reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK09939 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02164 torA trimethylamine-N-oxide reductase TorA | Back alignment and domain information |
|---|
| >TIGR00509 bisC_fam molybdopterin guanine dinucleotide-containing S/N-oxide reductases | Back alignment and domain information |
|---|
| >TIGR01580 narG respiratory nitrate reductase, alpha subunit | Back alignment and domain information |
|---|
| >cd02767 MopB_ydeP The MopB_ydeP CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative molybdopterin cofactor binding site | Back alignment and domain information |
|---|
| >TIGR01701 Fdhalpha-like oxidoreductase alpha (molybdopterin) subunit | Back alignment and domain information |
|---|
| >PF00384 Molybdopterin: Molybdopterin oxidoreductase; InterPro: IPR006656 This domain is found in a number of molybdopterin-containing oxidoreductases, tungsten formylmethanofuran dehydrogenase subunit d (FwdD) and molybdenum formylmethanofuran dehydrogenase subunit (FmdD); where a single domain constitutes almost the entire subunit | Back alignment and domain information |
|---|
| >PRK15102 trimethylamine N-oxide reductase I catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >PTZ00305 NADH:ubiquinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG1029 FwdB Formylmethanofuran dehydrogenase subunit B [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0964|consensus | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >KOG0018|consensus | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >PRK07569 bidirectional hydrogenase complex protein HoxU; Validated | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >COG5013 NarG Nitrate reductase alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00305 NADH:ubiquinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01973 NuoG NADH-quinone oxidoreductase, chain G | Back alignment and domain information |
|---|
| >COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PRK09130 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK07860 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK08493 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >KOG0964|consensus | Back alignment and domain information |
|---|
| >PRK09129 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK07569 bidirectional hydrogenase complex protein HoxU; Validated | Back alignment and domain information |
|---|
| >KOG2282|consensus | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >PF06470 SMC_hinge: SMC proteins Flexible Hinge Domain; InterPro: IPR010935 This entry represents the hinge region of the SMC (Structural Maintenance of Chromosomes) family of proteins | Back alignment and domain information |
|---|
| >PRK08166 NADH dehydrogenase subunit G; Validated | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0979|consensus | Back alignment and domain information |
|---|
| >PF10588 NADH-G_4Fe-4S_3: NADH-ubiquinone oxidoreductase-G iron-sulfur binding region; InterPro: IPR019574 NADH:ubiquinone oxidoreductase (complex I) (1 | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PF04879 Molybdop_Fe4S4: Molybdopterin oxidoreductase Fe4S4 domain; InterPro: IPR006963 The molybdopterin oxidoreductase Fe4S4 domain is found in a number of reductase/dehydrogenase families, which include the periplasmic nitrate reductase precursor and the formate dehydrogenase alpha chain [] | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >KOG0018|consensus | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PRK08764 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF09326 DUF1982: Domain of unknown function (DUF1982); InterPro: IPR015405 This C-terminal domain is functionally uncharacterised and is found in various prokaryotic NADH dehydrogenases including NADH-quinone oxidoreductase, chain G | Back alignment and domain information |
|---|
| >PRK05113 electron transport complex protein RnfB; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >KOG0979|consensus | Back alignment and domain information |
|---|
| >PRK06991 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >KOG4643|consensus | Back alignment and domain information |
|---|
| >TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit | Back alignment and domain information |
|---|
| >PF10588 NADH-G_4Fe-4S_3: NADH-ubiquinone oxidoreductase-G iron-sulfur binding region; InterPro: IPR019574 NADH:ubiquinone oxidoreductase (complex I) (1 | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0976|consensus | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >KOG4643|consensus | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG0962|consensus | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0977|consensus | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1003|consensus | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >KOG0946|consensus | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG0977|consensus | Back alignment and domain information |
|---|
| >TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein | Back alignment and domain information |
|---|
| >KOG0995|consensus | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG0980|consensus | Back alignment and domain information |
|---|
| >PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0995|consensus | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >KOG1003|consensus | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >KOG0976|consensus | Back alignment and domain information |
|---|
| >KOG0962|consensus | Back alignment and domain information |
|---|
| >KOG0963|consensus | Back alignment and domain information |
|---|
| >KOG0946|consensus | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >KOG0980|consensus | Back alignment and domain information |
|---|
| >KOG0963|consensus | Back alignment and domain information |
|---|
| >PRK08764 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >KOG3256|consensus | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >KOG4673|consensus | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG4593|consensus | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PRK06991 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >TIGR02512 Fe_only_hydrog hydrogenases, Fe-only | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PRK05888 NADH dehydrogenase subunit I; Provisional | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >CHL00014 ndhI NADH dehydrogenase subunit I | Back alignment and domain information |
|---|
| >PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02936 fdxN_nitrog ferredoxin III, nif-specific | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >PLN00071 photosystem I subunit VII; Provisional | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PRK06273 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >KOG1853|consensus | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PRK08222 hydrogenase 4 subunit H; Validated | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >KOG1937|consensus | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >KOG1937|consensus | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >KOG0999|consensus | Back alignment and domain information |
|---|
| >TIGR01971 NuoI NADH-quinone oxidoreductase, chain I | Back alignment and domain information |
|---|
| >CHL00065 psaC photosystem I subunit VII | Back alignment and domain information |
|---|
| >PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >PRK02651 photosystem I subunit VII; Provisional | Back alignment and domain information |
|---|
| >TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit | Back alignment and domain information |
|---|
| >PRK12385 fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10194 ferredoxin-type protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00402 napF ferredoxin-type protein NapF | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >KOG4593|consensus | Back alignment and domain information |
|---|
| >KOG0999|consensus | Back alignment and domain information |
|---|
| >PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG0249|consensus | Back alignment and domain information |
|---|
| >PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >KOG0249|consensus | Back alignment and domain information |
|---|
| >TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >KOG4809|consensus | Back alignment and domain information |
|---|
| >PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09476 napG quinol dehydrogenase periplasmic component; Provisional | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PRK05113 electron transport complex protein RnfB; Provisional | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein | Back alignment and domain information |
|---|
| >PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >TIGR02912 sulfite_red_C sulfite reductase, subunit C | Back alignment and domain information |
|---|
| >PRK09477 napH quinol dehydrogenase membrane component; Provisional | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >PF06705 SF-assemblin: SF-assemblin/beta giardin | Back alignment and domain information |
|---|
| >KOG1853|consensus | Back alignment and domain information |
|---|
| >KOG4809|consensus | Back alignment and domain information |
|---|
| >KOG2991|consensus | Back alignment and domain information |
|---|
| >PRK05035 electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG4360|consensus | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed | Back alignment and domain information |
|---|
| >TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein | Back alignment and domain information |
|---|
| >PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1145 NapF Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >TIGR01660 narH nitrate reductase, beta subunit | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13484 Fer4_16: 4Fe-4S double cluster binding domain | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >KOG4360|consensus | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >COG1146 Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PRK09898 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family | Back alignment and domain information |
|---|
| >PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >KOG1899|consensus | Back alignment and domain information |
|---|
| >COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >TIGR00315 cdhB CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit | Back alignment and domain information |
|---|
| >PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A | Back alignment and domain information |
|---|
| >PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PRK10361 DNA recombination protein RmuC; Provisional | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG3862 Uncharacterized protein with conserved CXXC pairs [Function unknown] | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J | Back alignment and domain information |
|---|
| >TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit | Back alignment and domain information |
|---|
| >TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein | Back alignment and domain information |
|---|
| >COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed | Back alignment and domain information |
|---|
| >COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK05659 sulfur carrier protein ThiS; Validated | Back alignment and domain information |
|---|
| >TIGR00273 iron-sulfur cluster-binding protein | Back alignment and domain information |
|---|
| >TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1899|consensus | Back alignment and domain information |
|---|
| >PRK10882 hydrogenase 2 protein HybA; Provisional | Back alignment and domain information |
|---|
| >PRK07118 ferredoxin; Validated | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PRK00945 acetyl-CoA decarbonylase/synthase complex subunit epsilon; Provisional | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >KOG2129|consensus | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >TIGR02060 aprB adenosine phosphosulphate reductase, beta subunit | Back alignment and domain information |
|---|
| >TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit | Back alignment and domain information |
|---|
| >PRK09898 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit | Back alignment and domain information |
|---|
| >TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PRK10194 ferredoxin-type protein; Provisional | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A | Back alignment and domain information |
|---|
| >COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PRK07118 ferredoxin; Validated | Back alignment and domain information |
|---|
| >COG1029 FwdB Formylmethanofuran dehydrogenase subunit B [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09908 xanthine dehydrogenase subunit XdhC; Provisional | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B | Back alignment and domain information |
|---|
| >TIGR03198 pucE xanthine dehydrogenase E subunit | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >KOG0982|consensus | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters | Back alignment and domain information |
|---|
| >COG1145 NapF Ferredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC | Back alignment and domain information |
|---|
| >PRK12386 fumarate reductase iron-sulfur subunit; Provisional | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG4438|consensus | Back alignment and domain information |
|---|
| >PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >KOG2129|consensus | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PRK14993 tetrathionate reductase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK10882 hydrogenase 2 protein HybA; Provisional | Back alignment and domain information |
|---|
| >TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit | Back alignment and domain information |
|---|
| >PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >KOG4673|consensus | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >KOG4302|consensus | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK09853 putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >PRK14993 tetrathionate reductase subunit B; Provisional | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2768 Uncharacterized Fe-S center protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08222 hydrogenase 4 subunit H; Validated | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG | Back alignment and domain information |
|---|
| >PLN00071 photosystem I subunit VII; Provisional | Back alignment and domain information |
|---|
| >TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing | Back alignment and domain information |
|---|
| >KOG0982|consensus | Back alignment and domain information |
|---|
| >TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family | Back alignment and domain information |
|---|
| >COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13746 Fer4_18: 4Fe-4S dicluster domain | Back alignment and domain information |
|---|
| >PRK05888 NADH dehydrogenase subunit I; Provisional | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PRK07440 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF15450 DUF4631: Domain of unknown function (DUF4631) | Back alignment and domain information |
|---|
| >PRK02651 photosystem I subunit VII; Provisional | Back alignment and domain information |
|---|
| >PRK06273 ferredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR00276 iron-sulfur cluster binding protein, putative | Back alignment and domain information |
|---|
| >COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK00945 acetyl-CoA decarbonylase/synthase complex subunit epsilon; Provisional | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif | Back alignment and domain information |
|---|
| >PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein | Back alignment and domain information |
|---|
| >TIGR01971 NuoI NADH-quinone oxidoreductase, chain I | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >CHL00065 psaC photosystem I subunit VII | Back alignment and domain information |
|---|
| >COG1600 Uncharacterized Fe-S protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG2768 Uncharacterized Fe-S center protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15055 anaerobic sulfite reductase subunit A; Provisional | Back alignment and domain information |
|---|
| >KOG2991|consensus | Back alignment and domain information |
|---|
| >TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >TIGR00314 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit | Back alignment and domain information |
|---|
| >PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PRK09853 putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated | Back alignment and domain information |
|---|
| >COG1152 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02936 fdxN_nitrog ferredoxin III, nif-specific | Back alignment and domain information |
|---|
| >COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02338 gimC_beta prefoldin, beta subunit, archaeal | Back alignment and domain information |
|---|
| >TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit | Back alignment and domain information |
|---|
| >cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >KOG4807|consensus | Back alignment and domain information |
|---|
| >KOG3256|consensus | Back alignment and domain information |
|---|
| >COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4438|consensus | Back alignment and domain information |
|---|
| >TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein | Back alignment and domain information |
|---|
| >COG5293 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >PF12252 SidE: Dot/Icm substrate protein; InterPro: IPR021014 This entry represents bacterial proteins that are typically between 397 and 1543 amino acids in length including SidE protein in the Dot/Icm pathway of Legionella pneumophila bacteria | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1334 | ||||
| 2fug_3 | 783 | Crystal Structure Of The Hydrophilic Domain Of Resp | 9e-35 |
| >pdb|2FUG|3 Chain 3, Crystal Structure Of The Hydrophilic Domain Of Respiratory Complex I From Thermus Thermophilus Length = 783 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Length = 783 | Back alignment and structure |
|---|
Score = 648 bits (1673), Expect = 0.0
Identities = 155/700 (22%), Positives = 252/700 (36%), Gaps = 130/700 (18%)
Query: 685 PVAACAMPVMKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFG 744
A+C V G V T S++ R A+ G++EF L+NHPLDCP CD+GG C+LQD+++ +G
Sbjct: 79 LAASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYG 138
Query: 745 SDRSRFTDIDFSGKSGTYTRVTRQRSWGLIPSRVFLQSINRHWIGPVAACAMPVMKGWRV 804
+ T TR R + + P V
Sbjct: 139 LYEKYYQKGPLELPVYTRFEFTR---------RHVDKHHP---LSPF------------V 174
Query: 805 KTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGNDLGTTGRGSDMQVG 864
+ R C C C + + L RG +G
Sbjct: 175 IL--DRER-----------------CIHC---KRCVRYFEEVPGDEVLDFIERGVHTFIG 212
Query: 865 TYVEKLFLSELSGNVIDLCPVGALTSKPYSFTARPWETRKTESVDVLDAVGSNIIVSTRT 924
T + S SGN+ D+CPVGAL F AR WE +T + L VG I TR+
Sbjct: 213 TM-DFGLPSGFSGNITDICPVGALLDLTARFRARNWEMEETPTTCALCPVGCGITADTRS 271
Query: 925 GEVLRVLPRLNEDINEEWLADKGRFAYDGLKRQRLLTPFVRNCDGQLVATEWEDALIAVA 984
GE+LR+ R ++NE W+ D GRF ++ + RL TP VR +G+LV WE+A +A+
Sbjct: 272 GELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRK-EGRLVEATWEEAFLALK 330
Query: 985 QKLQT---SEVAGVVGSLADAEAMVALKDLLNKLGSEDLYTEYAFPLEGAGTDLRANYLL 1041
+ L+ EV + A E + +L L + L + T A+
Sbjct: 331 EGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQ-------GRTAAPASLFP 383
Query: 1042 NNKIAGAEEADLILLIGTNPRFEAPLFNARIRKGYL------------------------ 1077
+ +AD L++G +P EAP+ + R+ +
Sbjct: 384 PASLEDLLQADFALVLG-DPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMP 442
Query: 1078 TNELDVAYIGP------KVDLRYDYEHLGESADLIKQLASGSHP------FSKKLSAAKK 1125
+A P K ++ GE +++ L + AK
Sbjct: 443 RRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLALLGDKEGSEMVAKAKEAWEKAKN 502
Query: 1126 PLIVVGADISDGAAVLALVQQLAAKVTCESDVPCDWKVLNILQKAASQVAALDIGYKPGT 1185
P++++GA + + LA + + + AA+ +G PG
Sbjct: 503 PVLILGAGVLQDTVAAERARLLAER---------KGAKVLAMTPAANARGLEAMGVLPGA 553
Query: 1186 SAIREKPPKVLFLLGADEGSISRDDVGKDCFIIYQGHHGDHGASIADAILPGAAYTEKQS 1245
P L+ GK +++ H A +LP + EK+
Sbjct: 554 KGASWDEPGALYAYYGFV-PPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRG 612
Query: 1246 TYVNTEGRAQQTLTAVTPPGLAREDWKIIRALSEGV------------------------ 1281
VN EGR A G A +++ L+E +
Sbjct: 613 HLVNLEGRVLPLSPAPIENGEAEGALQVLALLAEALGVRPPFRLHLEAQKALKARKVPEA 672
Query: 1282 SSNLSSEPVDVK-QKNLEDYYMTDPISRASGTMAKCIQAV 1320
LS +++ ++ +Y+ + +A + K +A
Sbjct: 673 MGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAA 712
|
| >3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Length = 574 | Back alignment and structure |
|---|
| >3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Length = 574 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2iv2_X Formate dehydrogenase H; oxidoreductase, 4Fe-4S, anaerobic, complete proteome, direct protein sequencing, Fe4S4, iron, iron sulfur cluster; HET: 2MD MGD; 2.27A {Escherichia coli} SCOP: b.52.2.2 c.81.1.1 PDB: 1fdi_A* 1fdo_A* 1aa6_A* Length = 715 | Back alignment and structure |
|---|
| >2iv2_X Formate dehydrogenase H; oxidoreductase, 4Fe-4S, anaerobic, complete proteome, direct protein sequencing, Fe4S4, iron, iron sulfur cluster; HET: 2MD MGD; 2.27A {Escherichia coli} SCOP: b.52.2.2 c.81.1.1 PDB: 1fdi_A* 1fdo_A* 1aa6_A* Length = 715 | Back alignment and structure |
|---|
| >2nap_A Protein (periplasmic nitrate reductase); nitrogenous acceptor, dissimilatory nitrate reductase; HET: MGD MES; 1.90A {Desulfovibrio desulfuricans} SCOP: b.52.2.2 c.81.1.1 PDB: 2jim_A* 2jir_A* 2jip_A* 2v45_A* 2v3v_A* 2jiq_A* 2jio_A* Length = 723 | Back alignment and structure |
|---|
| >2nap_A Protein (periplasmic nitrate reductase); nitrogenous acceptor, dissimilatory nitrate reductase; HET: MGD MES; 1.90A {Desulfovibrio desulfuricans} SCOP: b.52.2.2 c.81.1.1 PDB: 2jim_A* 2jir_A* 2jip_A* 2v45_A* 2v3v_A* 2jiq_A* 2jio_A* Length = 723 | Back alignment and structure |
|---|
| >3ml1_A NAPA, periplasmic nitrate reductase; heterodimer, oxidoreductase; HET: MGD HEC; 1.60A {Ralstonia eutropha} PDB: 3o5a_A* 1ogy_A* 2nya_A* Length = 802 | Back alignment and structure |
|---|
| >3ml1_A NAPA, periplasmic nitrate reductase; heterodimer, oxidoreductase; HET: MGD HEC; 1.60A {Ralstonia eutropha} PDB: 3o5a_A* 1ogy_A* 2nya_A* Length = 802 | Back alignment and structure |
|---|
| >1g8k_A Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, [2Fe-2S] rieske, oxidoreductase; HET: MGD; 1.64A {Alcaligenes faecalis} SCOP: b.52.2.2 c.81.1.1 PDB: 1g8j_A* Length = 825 | Back alignment and structure |
|---|
| >1g8k_A Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, [2Fe-2S] rieske, oxidoreductase; HET: MGD; 1.64A {Alcaligenes faecalis} SCOP: b.52.2.2 c.81.1.1 PDB: 1g8j_A* Length = 825 | Back alignment and structure |
|---|
| >2e7z_A Acetylene hydratase AHY; tungstoprotein, DMSO reductase family, iron-sulfur-cluster, lyase; HET: MGD; 1.26A {Pelobacter acetylenicus} Length = 727 | Back alignment and structure |
|---|
| >2e7z_A Acetylene hydratase AHY; tungstoprotein, DMSO reductase family, iron-sulfur-cluster, lyase; HET: MGD; 1.26A {Pelobacter acetylenicus} Length = 727 | Back alignment and structure |
|---|
| >2vpz_A Thiosulfate reductase; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_A* 2vpw_A* 2vpy_A* Length = 765 | Back alignment and structure |
|---|
| >2vpz_A Thiosulfate reductase; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_A* 2vpw_A* 2vpy_A* Length = 765 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1h0h_A Formate dehydrogenase (large subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: b.52.2.2 c.81.1.1 Length = 977 | Back alignment and structure |
|---|
| >1h0h_A Formate dehydrogenase (large subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: b.52.2.2 c.81.1.1 Length = 977 | Back alignment and structure |
|---|
| >1kqf_A FDH-N alpha, formate dehydrogenase, nitrate-inducible, major S; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: b.52.2.2 c.81.1.1 PDB: 1kqg_A* Length = 1015 | Back alignment and structure |
|---|
| >1kqf_A FDH-N alpha, formate dehydrogenase, nitrate-inducible, major S; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: b.52.2.2 c.81.1.1 PDB: 1kqg_A* Length = 1015 | Back alignment and structure |
|---|
| >1ti6_A Pyrogallol hydroxytransferase large subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.52.2.2 c.81.1.1 PDB: 1ti2_A* 1ti4_A* 1vld_M* 1vle_M* 1vlf_M* Length = 875 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1334 | |||
| 3i9v_3 | 783 | NADH-quinone oxidoreductase subunit 3; electron tr | 100.0 | |
| 2iv2_X | 715 | Formate dehydrogenase H; oxidoreductase, 4Fe-4S, a | 100.0 | |
| 3ml1_A | 802 | NAPA, periplasmic nitrate reductase; heterodimer, | 100.0 | |
| 2nap_A | 723 | Protein (periplasmic nitrate reductase); nitrogeno | 100.0 | |
| 1h0h_A | 977 | Formate dehydrogenase (large subunit); tungsten se | 100.0 | |
| 1kqf_A | 1015 | FDH-N alpha, formate dehydrogenase, nitrate-induci | 100.0 | |
| 2e7z_A | 727 | Acetylene hydratase AHY; tungstoprotein, DMSO redu | 100.0 | |
| 2vpz_A | 765 | Thiosulfate reductase; oxidoreductase, molybdopter | 100.0 | |
| 1g8k_A | 825 | Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, | 100.0 | |
| 4aay_A | 845 | AROA; oxidoreductase, rieske, iron sulfur, molybdo | 100.0 | |
| 2ivf_A | 976 | Ethylbenzene dehydrogenase alpha-subunit; anaerobi | 100.0 | |
| 1q16_A | 1247 | Respiratory nitrate reductase 1 alpha chain; membr | 100.0 | |
| 1ti6_A | 875 | Pyrogallol hydroxytransferase large subunit; molyb | 100.0 | |
| 1tmo_A | 829 | TMAO reductase, trimethylamine N-oxide reductase; | 100.0 | |
| 1eu1_A | 780 | Dimethyl sulfoxide reductase; molybdenum, molybden | 100.0 | |
| 3l51_B | 166 | Structural maintenance of chromosomes protein 4; s | 99.95 | |
| 1gxl_A | 213 | SMC, chromosome segregation SMC protein; SMC dimer | 99.93 | |
| 3nwc_A | 189 | SMC protein; structural maintenance of chromosomes | 99.93 | |
| 3l51_A | 161 | Structural maintenance of chromosomes protein 2; s | 99.92 | |
| 1gxj_A | 186 | SMC, chromosome segregation SMC protein; SMC dimer | 99.92 | |
| 2wd5_B | 213 | Structural maintenance of chromosomes protein 3; D | 99.89 | |
| 2wd5_A | 233 | Structural maintenance of chromosomes protein 1A; | 99.89 | |
| 3c8y_A | 574 | Iron hydrogenase 1; dithiomethylether, H-cluster, | 99.89 | |
| 3i9v_3 | 783 | NADH-quinone oxidoreductase subunit 3; electron tr | 99.65 | |
| 3c8y_A | 574 | Iron hydrogenase 1; dithiomethylether, H-cluster, | 99.4 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 99.01 | |
| 1kf6_B | 243 | Fumarate reductase iron-sulfur protein; respiratio | 98.94 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.84 | |
| 2wdq_B | 238 | Succinate dehydrogenase iron-sulfur subunit; succi | 98.79 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.5 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 98.49 | |
| 2c42_A | 1231 | Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, | 98.13 | |
| 1kf6_B | 243 | Fumarate reductase iron-sulfur protein; respiratio | 98.07 | |
| 2wdq_B | 238 | Succinate dehydrogenase iron-sulfur subunit; succi | 97.78 | |
| 1t3q_A | 168 | Quinoline 2-oxidoreductase small subunit; QOR, mol | 97.75 | |
| 3cf4_A | 807 | Acetyl-COA decarboxylase/synthase alpha subunit; m | 97.36 | |
| 1rm6_C | 161 | 4-hydroxybenzoyl-COA reductase gamma subunit; xant | 97.31 | |
| 1n62_A | 166 | Carbon monoxide dehydrogenase small chain; CODH, m | 97.22 | |
| 2c42_A | 1231 | Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, | 97.16 | |
| 1jb0_C | 80 | Photosystem I iron-sulfur center; membrane protein | 97.15 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.15 | |
| 1ffv_A | 163 | CUTS, iron-sulfur protein of carbon monoxide dehyd | 97.13 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.96 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 96.73 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.67 | |
| 2h88_B | 252 | Succinate dehydrogenase IP subunit; complex II, me | 96.59 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 96.58 | |
| 1f2g_A | 58 | Ferredoxin II; electron transport, FDII desulfovib | 96.56 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 96.5 | |
| 1xer_A | 103 | Ferredoxin; electron transport, iron-sulfur, dupli | 96.36 | |
| 1iqz_A | 81 | Ferredoxin; iron-sulfer protein, ultlahigh resolut | 96.32 | |
| 1y56_A | 493 | Hypothetical protein PH1363; dehydrogenase, protei | 96.31 | |
| 1dwl_A | 59 | Ferredoxin I; electron transfer, model, heteronucl | 96.22 | |
| 1dax_A | 64 | Ferredoxin I; electron transport, electron-transfe | 96.2 | |
| 1hfe_L | 421 | Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg | 96.17 | |
| 1rof_A | 60 | Ferredoxin; electron transport, iron-sulfur; NMR { | 96.16 | |
| 1t3q_A | 168 | Quinoline 2-oxidoreductase small subunit; QOR, mol | 96.14 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.08 | |
| 2fdn_A | 55 | Ferredoxin; electron transport, iron-sulfur, 4Fe-4 | 96.04 | |
| 3i9v_9 | 182 | NADH-quinone oxidoreductase subunit 9; electron tr | 96.01 | |
| 1sj1_A | 66 | Ferredoxin; thermostability, iron-sulfur cluster, | 95.99 | |
| 2bs2_B | 241 | Quinol-fumarate reductase iron-sulfur subunit B; 2 | 95.99 | |
| 3vr8_B | 282 | Iron-sulfur subunit of succinate dehydrogenase; me | 95.88 | |
| 1bc6_A | 77 | 7-Fe ferredoxin; electron transport, iron-sulfur; | 95.7 | |
| 3gyx_B | 166 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 95.68 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 95.67 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 95.6 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 95.49 | |
| 1h98_A | 78 | Ferredoxin; electron transport, thermophilic, iron | 95.42 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 95.41 | |
| 1rgv_A | 80 | Ferredoxin; electron transport; 2.90A {Thauera aro | 95.34 | |
| 7fd1_A | 106 | FD1, protein (7-Fe ferredoxin I); electron transpo | 95.31 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 95.31 | |
| 3hrd_D | 160 | Nicotinate dehydrogenase small FES subunit; seleni | 95.26 | |
| 2fgo_A | 82 | Ferredoxin; allochromatium vinosum, [4Fe-4S] clust | 95.09 | |
| 1jnr_B | 150 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 95.04 | |
| 2v2k_A | 105 | Ferredoxin; iron, transport, iron-sulfur, mycobact | 94.95 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 94.87 | |
| 1frr_A | 95 | Ferredoxin I; electron transfer(iron-sulfur protei | 94.87 | |
| 3eun_A | 82 | Ferredoxin; electron transport, [4Fe-4S] cluster, | 94.83 | |
| 2zvs_A | 85 | Uncharacterized ferredoxin-like protein YFHL; elec | 94.45 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 94.34 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 94.24 | |
| 1q16_B | 512 | Respiratory nitrate reductase 1 beta chain; membra | 94.14 | |
| 2ivf_B | 352 | Ethylbenzene dehydrogenase beta-subunit; anaerobic | 93.95 | |
| 1frd_A | 98 | Heterocyst [2Fe-2S] ferredoxin; electron transport | 93.52 | |
| 1jq4_A | 98 | Methane monooxygenase component C; [2Fe-2S] ferred | 93.48 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 93.37 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 93.29 | |
| 3cf4_A | 807 | Acetyl-COA decarboxylase/synthase alpha subunit; m | 92.96 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 92.42 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 92.37 | |
| 2vpz_B | 195 | NRFC protein; oxidoreductase, molybdopterin guanin | 92.22 | |
| 2fgo_A | 82 | Ferredoxin; allochromatium vinosum, [4Fe-4S] clust | 92.13 | |
| 2zvs_A | 85 | Uncharacterized ferredoxin-like protein YFHL; elec | 92.06 | |
| 1rgv_A | 80 | Ferredoxin; electron transport; 2.90A {Thauera aro | 91.59 | |
| 2ivf_B | 352 | Ethylbenzene dehydrogenase beta-subunit; anaerobic | 91.53 | |
| 3eun_A | 82 | Ferredoxin; electron transport, [4Fe-4S] cluster, | 91.41 | |
| 1ti6_B | 274 | Pyrogallol hydroxytransferase small subunit; molyb | 91.28 | |
| 2fdn_A | 55 | Ferredoxin; electron transport, iron-sulfur, 4Fe-4 | 91.23 | |
| 1iue_A | 98 | Ferredoxin; electron transport, iron-sulfur; 1.70A | 91.07 | |
| 3nvw_A | 164 | Xanthine dehydrogenase/oxidase; hydroxylase, homod | 90.93 | |
| 2xzr_A | 114 | Immunoglobulin-binding protein EIBD; cell adhesion | 90.69 | |
| 1kqf_B | 294 | FDH-N beta S, formate dehydrogenase, nitrate-induc | 90.52 | |
| 3ah7_A | 113 | [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur | 90.35 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 90.17 | |
| 3mm5_B | 366 | Sulfite reductase, dissimilatory-type subunit BET; | 89.67 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 89.64 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 89.51 | |
| 1hfe_L | 421 | Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg | 89.5 | |
| 1jb0_C | 80 | Photosystem I iron-sulfur center; membrane protein | 89.41 | |
| 1h0h_B | 214 | Formate dehydrogenase (small subunit); tungsten se | 89.34 | |
| 3cf4_G | 170 | Acetyl-COA decarboxylase/synthase epsilon subunit; | 89.3 | |
| 2gag_A | 965 | Heterotetrameric sarcosine oxidase alpha-subunit; | 88.87 | |
| 1q16_B | 512 | Respiratory nitrate reductase 1 beta chain; membra | 88.84 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 88.83 | |
| 2vpz_B | 195 | NRFC protein; oxidoreductase, molybdopterin guanin | 88.83 | |
| 1bc6_A | 77 | 7-Fe ferredoxin; electron transport, iron-sulfur; | 88.74 | |
| 1awd_A | 94 | Ferredoxin; electron transport, eukaryotic, green | 88.56 | |
| 3i9v_9 | 182 | NADH-quinone oxidoreductase subunit 9; electron tr | 88.27 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 88.08 | |
| 1xer_A | 103 | Ferredoxin; electron transport, iron-sulfur, dupli | 88.03 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 87.81 | |
| 1h0h_B | 214 | Formate dehydrogenase (small subunit); tungsten se | 87.56 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 87.49 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 87.49 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 87.11 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 87.03 | |
| 1h98_A | 78 | Ferredoxin; electron transport, thermophilic, iron | 86.85 | |
| 1x79_B | 112 | RAB GTPase binding effector protein 1; rabaptin5, | 86.79 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 86.6 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 86.59 | |
| 1kqf_B | 294 | FDH-N beta S, formate dehydrogenase, nitrate-induc | 86.17 | |
| 7fd1_A | 106 | FD1, protein (7-Fe ferredoxin I); electron transpo | 86.01 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 85.81 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 85.77 | |
| 3q8t_A | 96 | Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 | 85.59 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 85.44 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 85.11 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 84.88 | |
| 3mm5_A | 418 | Sulfite reductase, dissimilatory-type subunit ALP; | 84.81 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 84.48 | |
| 1ti6_B | 274 | Pyrogallol hydroxytransferase small subunit; molyb | 84.1 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 84.01 | |
| 1i7h_A | 111 | Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch | 83.91 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 83.58 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 83.18 | |
| 2gmh_A | 584 | Electron transfer flavoprotein-ubiquinone oxidored | 82.93 | |
| 1doi_A | 128 | 2Fe-2S ferredoxin; halophilic protein, redox prote | 82.87 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 82.71 | |
| 1fxk_A | 107 | Prefoldin; archaeal protein, chaperone; 2.30A {Met | 82.6 | |
| 1ffv_A | 163 | CUTS, iron-sulfur protein of carbon monoxide dehyd | 82.43 | |
| 1a70_A | 97 | Ferredoxin; iron-sulfur protein, photosynthesis, e | 82.33 | |
| 1krh_A | 338 | Benzoate 1,2-dioxygenase reductase; alpha-beta, FA | 82.1 | |
| 1tyg_B | 87 | YJBS; alpha beta barrel, protein-protein complex, | 82.08 | |
| 2w3s_A | 462 | Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 | 81.83 | |
| 3jsv_C | 94 | NF-kappa-B essential modulator; ubiquitin, coiled- | 81.34 | |
| 1n62_A | 166 | Carbon monoxide dehydrogenase small chain; CODH, m | 81.18 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 81.13 | |
| 2v2k_A | 105 | Ferredoxin; iron, transport, iron-sulfur, mycobact | 81.0 | |
| 1czp_A | 98 | Ferredoxin I; [2Fe-2S] protein, crystal reduced wi | 80.71 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 80.1 |
| >3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* | Back alignment and structure |
|---|
Probab=100.00 E-value=7.3e-98 Score=961.09 Aligned_cols=572 Identities=27% Similarity=0.431 Sum_probs=485.8
Q ss_pred cEEEEECCEEEEeCCCCcchh------------------------------h---------------------------h
Q psy11935 664 KFEVFIDDKKVMVDPGTTVLQ------------------------------P---------------------------V 686 (1334)
Q Consensus 664 ~~~~~idg~~~~v~~g~til~------------------------------~---------------------------~ 686 (1334)
||+|+|||++|+||+|+|||+ . +
T Consensus 1 mv~i~idg~~~~v~~g~til~a~~~~gi~ip~~C~~~~~~~~G~C~~C~V~v~~~~~~~~g~~~~~~~G~~~~~~~~~~~ 80 (783)
T 3i9v_3 1 MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLA 80 (783)
T ss_dssp CEEEECSSCEEEECTTCBHHHHHHHTTCCCCCSSCCTTSCCCCCSCCSEEEEECC-----------------CCBCSSCE
T ss_pred CeEEEECCEEEEeCCCChHHHHHHHhCCCccccCCCCCCCCCcccCCcEEEecccccccccccccccccccccccCCCcc
Confidence 799999999999999999999 2 1
Q ss_pred hhhcCCCCCCCEEEcCCHHHHHHHHHHHHHHHHhCCCCCCCCCCCCCCchhhhHHHhCCCCCccccc--------ccC-C
Q psy11935 687 AACAMPVMKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQGGECDLQDQSMAFGSDRSRFTDI--------DFS-G 757 (1334)
Q Consensus 687 ~ac~~~~~~gm~v~t~s~~~~~~r~~~~~~ll~~hp~~C~~c~~~g~c~lq~~~~~~g~~~~~~~~~--------~~~-~ 757 (1334)
+||+|||.+||+|.|+||++.++|+.+|||||.|||+|||+||++|+|+|||+++.||+...+|... .|. .
T Consensus 81 ~aC~t~v~~gm~v~t~~~~~~~~r~~~le~ll~nhp~dC~~C~~~g~C~Lq~~~~~~g~~~~~~~~~~~~~p~~~r~~~~ 160 (783)
T 3i9v_3 81 ASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFT 160 (783)
T ss_dssp ETTTCBCCSSEEEESSSHHHHHHHHHHHHHHHTSCCCCTTTCTTGGGCHHHHHHHHHCSCCCC------CCCCCCCCCSC
T ss_pred cccCCCCCCCCEEEECCHHHHHHHHHHHHHHHhcCCCCCccCCCCCCCHHHHHHHHhCCccccccccccccccccccccc
Confidence 3999999999999999999999999999999999999999999999999999999999954433210 000 2
Q ss_pred CCCccchhhhhhccCCCCcccccceeec-CCCcccccccccCCCCcEEEcCCHHHHHHHHHHHHHHhhCCCCCCcccccC
Q psy11935 758 KSGTYTRVTRQRSWGLIPSRVFLQSINR-HWIGPVAACAMPVMKGWRVKTNSEMTRRAREGVMEFLLVNHPLDCPICDQG 836 (1334)
Q Consensus 758 ~~~~~~~~~~~~~~~~ip~lc~~~~v~~-~~~~~~~aC~~~v~~gm~i~t~s~~~r~~r~~~~~~ll~~h~~~C~~C~~~ 836 (1334)
++ .++. ...+|. |.. ++.+| |.|++|
T Consensus 161 k~----------------------~~~~~~~~~p~------------i~~--d~~~C--------------I~C~~C--- 187 (783)
T 3i9v_3 161 RR----------------------HVDKHHPLSPF------------VIL--DRERC--------------IHCKRC--- 187 (783)
T ss_dssp CC----------------------CCCCSEEEETT------------EEE--CTTTC--------------CCCCHH---
T ss_pred cc----------------------cCCcccCCCcc------------EEE--chhhC--------------CCccHH---
Confidence 22 1111 122455 777 78889 999888
Q ss_pred CccchhhhhcccCccccccCCCCCceeccccccccccccccccccccccccccccCCcccCCCCcceeeeeecccCCCCC
Q psy11935 837 GECDLQDQSMAFGNDLGTTGRGSDMQVGTYVEKLFLSELSGNVIDLCPVGALTSKPYSFTARPWETRKTESVDVLDAVGS 916 (1334)
Q Consensus 837 g~c~~~~~e~~g~~~~~~~~rg~~~~i~~~~~~~~~~~~cg~cv~~CpvGAl~~k~~~~~~r~we~~~~~s~c~~C~~gC 916 (1334)
+++|.++++..++++.+||.+..|++. +.++.|++||+|+++||||||+++++.|++|+|+++.++|+|++|+.||
T Consensus 188 ---v~~C~~~~~~~~i~~~~~g~~~~i~~~-~~~~~C~~CG~Cv~vCP~gAl~~~~~~~~~r~w~~~~~~s~C~~C~~gC 263 (783)
T 3i9v_3 188 ---VRYFEEVPGDEVLDFIERGVHTFIGTM-DFGLPSGFSGNITDICPVGALLDLTARFRARNWEMEETPTTCALCPVGC 263 (783)
T ss_dssp ---HHHHHHTTCCCCCEECSCTTSCCEECS-STTCCSTTTTTHHHHCSSSSEEEGGGTTSCCTTTSEEEEEECCSSSSCC
T ss_pred ---HHHhhhhcCCceeeeecCCCccEEccC-CCCCCCccchhHHhhcccCceeccccccccccccceEEEEeCCCCCCcc
Confidence 999999999999999999999888774 3456899999999999999999999999999999999999999999999
Q ss_pred ceEEEeeCCEEEEecCCCCCCCCccccccccccccccccccccCCceEecCCCCeeecCHHHHHHHHHHHhcc---CCEE
Q psy11935 917 NIIVSTRTGEVLRVLPRLNEDINEEWLADKGRFAYDGLKRQRLLTPFVRNCDGQLVATEWEDALIAVAQKLQT---SEVA 993 (1334)
Q Consensus 917 ~i~v~v~~g~v~ri~p~~~~~vn~g~lC~kgr~~~~~l~~~Rl~~PliR~~~g~~~~iSWdeAl~~ia~~L~~---~~i~ 993 (1334)
++.+++++|+|+||+|++++|+|+||+|+||||++++++.+||++||+|.+ |+|+++||||||+.||++|++ ++++
T Consensus 264 ~i~v~v~~g~v~rv~~~~~~p~n~g~lC~kGr~~~~~~~~dRL~~Pl~R~~-G~~~~iSWdeAl~~ia~~L~~i~~~~i~ 342 (783)
T 3i9v_3 264 GITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKE-GRLVEATWEEAFLALKEGLKEARGEEVG 342 (783)
T ss_dssp EEEEEEETBEEEEEEECCCTTSSCSCCCHHHHHTTTTTTTSCCCSCEEESS-SSEEECCHHHHHHHHHHHHHTCCTTSEE
T ss_pred cceeeeECCEEEeccCCCCCCCCCCccChhhhhHhhhhhhccccCceEccC-CceeEeCHHHHHHHHHHHHHhhccCCEE
Confidence 999999999999999999999999999999999999995599999999985 999999999999999999998 6899
Q ss_pred EEeCCcCCHHHHHHHHHHHHHhCCCccccCCCCCcchhhhhhhhhccCCCCcccccccCeEEEEcCCccccchhHHHHHH
Q psy11935 994 GVVGSLADAEAMVALKDLLNKLGSEDLYTEYAFPLEGAGTDLRANYLLNNKIAGAEEADLILLIGTNPRFEAPLFNARIR 1073 (1334)
Q Consensus 994 ~~~g~~~~~e~~~~~~~l~~~lGs~~~~~~~~~~~~~~~~~~~~~~~~~~~~~die~ad~Il~~G~np~~~~p~~~~rir 1073 (1334)
+++|+..++|+.|++++|++.||++|+++....|.... .+.+.++.|+++||+||+|| ||.+++|+++.|++
T Consensus 343 ~~~s~~~t~E~~~~~~kl~~~lGt~n~d~~~~~~~~~~-------~~~~~~~~di~~ad~Il~~G-Np~~~~P~~~~rlr 414 (783)
T 3i9v_3 343 LYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPAS-------LFPPASLEDLLQADFALVLG-DPTEEAPILHLRLS 414 (783)
T ss_dssp EEECTTCCTTHHHHHHHHHHHTTCSCEEETTCCSSCGG-------GSCBCCHHHHHHCSCEEEES-CHHHHSTHHHHHHH
T ss_pred EEECCCCCHHHHHHHHHHHHHhCCCcccCCchhhhhhc-------cCCCCCHHHHhhCCEEEEeC-ChhHhCcHHHHHHH
Confidence 99999999999999999999999999988766664321 23467899999999999999 99999999999999
Q ss_pred HHHh------------------------hCCCeEEEEccCCCCcccccc------CCCcHHHHHHHHhc------HHHHH
Q psy11935 1074 KGYL------------------------TNELDVAYIGPKVDLRYDYEH------LGESADLIKQLASG------SHPFS 1117 (1334)
Q Consensus 1074 ~a~~------------------------~~g~kiivIdp~~~~t~~~a~------~Gtd~a~l~~l~~g------~~~~A 1117 (1334)
++.+ ++|++|++|||+.+.++..++ ||+|.+++.+++.. +.++|
T Consensus 415 ~a~~~~~~~~~~~~g~~~~~~~v~~~~~~~g~klividPr~t~ta~~Ad~~l~i~PGtD~all~al~~~li~~e~i~~~A 494 (783)
T 3i9v_3 415 EFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLALLGDKEGSEMVAKAK 494 (783)
T ss_dssp HHHTTCCCCCCBTTBSCSSCTTCCTTCCCCTTSEEEEESSCCGGGTTCSEEEECCSSCHHHHHHHHHTSSCCCHHHHHHH
T ss_pred HHHHhcccchhhcccccchhhhhhhhhhcCCCEEEEEeCCcchhhHhhcceEecCCCcHHHHHHHHHHhccCHHHHHHHH
Confidence 9863 578999999999999887764 99999999999754 57899
Q ss_pred HHHhcCCCcEEEEcCCc-ccHHHHHHHHHHHHHhhcCCCCCCCCCcccccchhhhhhhhhhhcCCCcchh--hHh-cCCC
Q psy11935 1118 KKLSAAKKPLIVVGADI-SDGAAVLALVQQLAAKVTCESDVPCDWKVLNILQKAASQVAALDIGYKPGTS--AIR-EKPP 1193 (1334)
Q Consensus 1118 ~~l~~a~~~~ii~G~~~-~~g~~~~~al~~l~~~~g~~Gg~~~~~~~~~~l~~~~n~~G~~~~g~~pg~~--~i~-~g~i 1193 (1334)
+.|+++++++|++|.++ .+..... ++..|++++| .+++++++.+|.+|+.++|+.|+.. .+. .| +
T Consensus 495 ~~la~a~~~~I~~G~g~~~~~~~~~-~~~~l~g~~G---------~g~~~l~~~~N~~Ga~~~G~~p~~~g~~~~~~g-i 563 (783)
T 3i9v_3 495 EAWEKAKNPVLILGAGVLQDTVAAE-RARLLAERKG---------AKVLAMTPAANARGLEAMGVLPGAKGASWDEPG-A 563 (783)
T ss_dssp HHHHHCSSCEEEECSHHHHCHHHHH-HHHHHHHHTT---------CCEEECCSSTTHHHHHHHTCSCCSSCCCTTSCC-C
T ss_pred HHHHhCCCcEEEECchhhhcHHHHH-HHHHHhcccC---------CCeeeccCcchhhhhhhcCCCCCchhhhhhcCC-C
Confidence 99999999999999998 2221122 2223777765 2366778888999999999887532 111 46 9
Q ss_pred cEEEEECCChhhhHHhhcCCCceEEEEcCCCChhh-ccccEEecCCCCCCCCcccccCCCceEEeccccCCCCCcccHHH
Q psy11935 1194 KVLFLLGADEGSISRDDVGKDCFIIYQGHHGDHGA-SIADAILPGAAYTEKQSTYVNTEGRAQQTLTAVTPPGLAREDWK 1272 (1334)
Q Consensus 1194 k~l~~~g~np~~~~~~al~k~~fvV~~d~~~~eta-~~ADvVLP~a~~~Ek~Gt~~n~egrvq~~~~av~P~gear~dw~ 1272 (1334)
|++|++|.||... |++++|+|++|+|+|+|+ .+||||||+++|+|++|||+|++|++|.++++++|+|++|+||+
T Consensus 564 kal~v~g~np~~~----L~~~~fvVv~d~~~t~ta~~~ADvvLP~a~~~E~~gt~~n~eg~~~~~~~~v~p~ge~r~d~~ 639 (783)
T 3i9v_3 564 LYAYYGFVPPEEA----LKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQ 639 (783)
T ss_dssp SEEEESSCCCHHH----HTTCSEEEECCSSCCTTTTTTCSEECCCCCGGGCCEEEECTTSBEEEECCCCBCCCSCCCHHH
T ss_pred eEEEEeCCCHHHH----HhhCCEEEEEeCcCCchhhhCCcEEecCCcccccCCeEEccCCcEEEeccccCCCCCCccHHH
Confidence 9999999999643 899999999999999999 99999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhcCCCCC-------------------CCccc------cccccccccccchhhhchHHHHHh
Q psy11935 1273 IIRALSEGVSSNLSS-------------------EPVDV------KQKNLEDYYMTDPISRASGTMAKC 1316 (1334)
Q Consensus 1273 Il~~La~~lg~~~~~-------------------~~~~~------~~~~~~~~y~td~i~r~s~~m~~~ 1316 (1334)
||+.||++||..... ..+.+ +...-.++|++|+..|++..++..
T Consensus 640 il~~La~~lG~~~~~~~~~~~~~~l~~~~~~~~~g~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~ 708 (783)
T 3i9v_3 640 VLALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKA 708 (783)
T ss_dssp HHHHHHHTTSSCCSCCSHHHHHHHHHHHTCCCTTCBCCCCCCCCCCCCCCTTEEEEECSSCGGGCSTTH
T ss_pred HHHHHHHHhCCCCCCCCHHHHHHHHHhccCccccCccCCCCCcCCCCCCCCceeecccceecccccchh
Confidence 999999999921110 00000 001124899999999988665433
|
| >2iv2_X Formate dehydrogenase H; oxidoreductase, 4Fe-4S, anaerobic, complete proteome, direct protein sequencing, Fe4S4, iron, iron sulfur cluster; HET: 2MD MGD; 2.27A {Escherichia coli} SCOP: b.52.2.2 c.81.1.1 PDB: 1fdi_A* 1fdo_A* 1aa6_A* | Back alignment and structure |
|---|
| >3ml1_A NAPA, periplasmic nitrate reductase; heterodimer, oxidoreductase; HET: MGD HEC; 1.60A {Ralstonia eutropha} PDB: 3o5a_A* 1ogy_A* 2nya_A* | Back alignment and structure |
|---|
| >2nap_A Protein (periplasmic nitrate reductase); nitrogenous acceptor, dissimilatory nitrate reductase; HET: MGD MES; 1.90A {Desulfovibrio desulfuricans} SCOP: b.52.2.2 c.81.1.1 PDB: 2jim_A* 2jir_A* 2jip_A* 2v45_A* 2v3v_A* 2jiq_A* 2jio_A* | Back alignment and structure |
|---|
| >1h0h_A Formate dehydrogenase (large subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: b.52.2.2 c.81.1.1 | Back alignment and structure |
|---|
| >1kqf_A FDH-N alpha, formate dehydrogenase, nitrate-inducible, major S; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: b.52.2.2 c.81.1.1 PDB: 1kqg_A* | Back alignment and structure |
|---|
| >2e7z_A Acetylene hydratase AHY; tungstoprotein, DMSO reductase family, iron-sulfur-cluster, lyase; HET: MGD; 1.26A {Pelobacter acetylenicus} | Back alignment and structure |
|---|
| >2vpz_A Thiosulfate reductase; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_A* 2vpw_A* 2vpy_A* | Back alignment and structure |
|---|
| >1g8k_A Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, [2Fe-2S] rieske, oxidoreductase; HET: MGD; 1.64A {Alcaligenes faecalis} SCOP: b.52.2.2 c.81.1.1 PDB: 1g8j_A* | Back alignment and structure |
|---|
| >4aay_A AROA; oxidoreductase, rieske, iron sulfur, molybdopterin; HET: MGD; 2.70A {Rhizobium species} | Back alignment and structure |
|---|
| >2ivf_A Ethylbenzene dehydrogenase alpha-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} | Back alignment and structure |
|---|
| >1q16_A Respiratory nitrate reductase 1 alpha chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: b.52.2.2 c.81.1.1 PDB: 3ir7_A* 1y5i_A* 1siw_A* 1y4z_A* 1r27_A* 1y5l_A* 1y5n_A* 3ir6_A* 3ir5_A* 3egw_A* | Back alignment and structure |
|---|
| >1ti6_A Pyrogallol hydroxytransferase large subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.52.2.2 c.81.1.1 PDB: 1ti2_A* 1ti4_A* 1vld_M* 1vle_M* 1vlf_M* | Back alignment and structure |
|---|
| >1tmo_A TMAO reductase, trimethylamine N-oxide reductase; oxidoreductase, oxotransferase, molybdoenzyme, MO-cofactor, molybdenum; HET: 2MD; 2.50A {Shewanella massilia} SCOP: b.52.2.2 c.81.1.1 | Back alignment and structure |
|---|
| >3l51_B Structural maintenance of chromosomes protein 4; structural maintenance of chromosomes (SMC), hinge domain, C cycle, cell division, cytoplasm; 1.51A {Mus musculus} SCOP: d.215.1.0 | Back alignment and structure |
|---|
| >1gxl_A SMC, chromosome segregation SMC protein; SMC dimerisation domain, anti parallel coiled coil, SMC proteins; 3.0A {Thermotoga maritima} SCOP: d.215.1.1 | Back alignment and structure |
|---|
| >3nwc_A SMC protein; structural maintenance of chromosomes (SMC), SMC hinge domai dimerization, DNA binding, cell cycle; 1.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3l51_A Structural maintenance of chromosomes protein 2; structural maintenance of chromosomes (SMC), hinge domain, C cycle, cell division, cytoplasm; 1.51A {Mus musculus} | Back alignment and structure |
|---|
| >1gxj_A SMC, chromosome segregation SMC protein; SMC dimerisation domain, anti parallel coiled coil, SMC proteins; 2.0A {Thermotoga maritima} SCOP: d.215.1.1 PDB: 1gxk_A | Back alignment and structure |
|---|
| >2wd5_B Structural maintenance of chromosomes protein 3; DNA damage, cell cycle, cell division; 2.70A {Mus musculus} | Back alignment and structure |
|---|
| >2wd5_A Structural maintenance of chromosomes protein 1A; DNA damage, cell cycle, cell division; 2.70A {Mus musculus} | Back alignment and structure |
|---|
| >3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* | Back alignment and structure |
|---|
| >3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* | Back alignment and structure |
|---|
| >3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* | Back alignment and structure |
|---|
| >1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* | Back alignment and structure |
|---|
| >2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* | Back alignment and structure |
|---|
| >1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 | Back alignment and structure |
|---|
| >3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} | Back alignment and structure |
|---|
| >1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* | Back alignment and structure |
|---|
| >1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* | Back alignment and structure |
|---|
| >2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* | Back alignment and structure |
|---|
| >1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A | Back alignment and structure |
|---|
| >1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* | Back alignment and structure |
|---|
| >1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 | Back alignment and structure |
|---|
| >1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A | Back alignment and structure |
|---|
| >1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A* | Back alignment and structure |
|---|
| >1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A | Back alignment and structure |
|---|
| >1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A | Back alignment and structure |
|---|
| >3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9* | Back alignment and structure |
|---|
| >1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A | Back alignment and structure |
|---|
| >2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* | Back alignment and structure |
|---|
| >3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* | Back alignment and structure |
|---|
| >1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A | Back alignment and structure |
|---|
| >3gyx_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1 | Back alignment and structure |
|---|
| >7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1jnr_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.1.5 PDB: 1jnz_B* 2fja_B* 2fjb_B* 2fjd_B* 2fje_B* | Back alignment and structure |
|---|
| >2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A | Back alignment and structure |
|---|
| >2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* | Back alignment and structure |
|---|
| >2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} | Back alignment and structure |
|---|
| >1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* | Back alignment and structure |
|---|
| >2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli} | Back alignment and structure |
|---|
| >1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1 | Back alignment and structure |
|---|
| >2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} | Back alignment and structure |
|---|
| >3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A | Back alignment and structure |
|---|
| >1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* | Back alignment and structure |
|---|
| >2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A | Back alignment and structure |
|---|
| >1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* | Back alignment and structure |
|---|
| >2xzr_A Immunoglobulin-binding protein EIBD; cell adhesion, trimeric autotransporter adhesin, TAA; 2.80A {Enterobacteria phage p-eibd} | Back alignment and structure |
|---|
| >1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* | Back alignment and structure |
|---|
| >3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3mm5_B Sulfite reductase, dissimilatory-type subunit BET; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3c7b_B* 3mm6_B* 3mm7_B* 3mm8_B* 3mm9_B* 3mma_B* 3mmb_B* 3mmc_B* | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A* | Back alignment and structure |
|---|
| >1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* | Back alignment and structure |
|---|
| >1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 | Back alignment and structure |
|---|
| >3cf4_G Acetyl-COA decarboxylase/synthase epsilon subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} | Back alignment and structure |
|---|
| >2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* | Back alignment and structure |
|---|
| >1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* | Back alignment and structure |
|---|
| >1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A | Back alignment and structure |
|---|
| >1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9* | Back alignment and structure |
|---|
| >1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2 | Back alignment and structure |
|---|
| >1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* | Back alignment and structure |
|---|
| >7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >3mm5_A Sulfite reductase, dissimilatory-type subunit ALP; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3mm6_A* 3mm7_A* 3mm8_A* 3mm9_A* 3mma_A* 3mmb_A* 3mmc_A* 3c7b_A* | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* | Back alignment and structure |
|---|
| >1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* | Back alignment and structure |
|---|
| >1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A | Back alignment and structure |
|---|
| >1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B | Back alignment and structure |
|---|
| >1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* | Back alignment and structure |
|---|
| >1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A | Back alignment and structure |
|---|
| >1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 | Back alignment and structure |
|---|
| >1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 | Back alignment and structure |
|---|
| >2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* | Back alignment and structure |
|---|
| >3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B | Back alignment and structure |
|---|
| >1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1334 | ||||
| d2fug32 | 439 | c.81.1.1 (3:247-685) NADH-quinone oxidoreductase c | 4e-64 | |
| d2fug34 | 151 | d.58.1.5 (3:96-246) NADH-quinone oxidoreductase ch | 4e-28 | |
| d3c8ya2 | 126 | d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal | 3e-27 | |
| d3c8ya2 | 126 | d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal | 1e-23 | |
| d2iv2x2 | 564 | c.81.1.1 (X:1-564) Formate dehydrogenase H {Escher | 2e-19 | |
| d2iv2x2 | 564 | c.81.1.1 (X:1-564) Formate dehydrogenase H {Escher | 3e-09 | |
| d1ogya2 | 670 | c.81.1.1 (A:12-681) Periplasmic nitrate reductase | 2e-18 | |
| d1ogya2 | 670 | c.81.1.1 (A:12-681) Periplasmic nitrate reductase | 3e-10 | |
| d1h0ha2 | 812 | c.81.1.1 (A:1-812) Tungsten containing formate deh | 4e-15 | |
| d1h0ha2 | 812 | c.81.1.1 (A:1-812) Tungsten containing formate deh | 1e-08 | |
| d2jioa2 | 597 | c.81.1.1 (A:4-600) Periplasmic nitrate reductase a | 5e-14 | |
| d2jioa2 | 597 | c.81.1.1 (A:4-600) Periplasmic nitrate reductase a | 4e-07 | |
| d1g8ka2 | 679 | c.81.1.1 (A:4-682) Arsenite oxidase large subunit | 3e-12 | |
| d1g8ka2 | 679 | c.81.1.1 (A:4-682) Arsenite oxidase large subunit | 2e-09 | |
| d1kqfa2 | 817 | c.81.1.1 (A:34-850) Formate dehydrogenase N, alpha | 2e-09 | |
| d1kqfa2 | 817 | c.81.1.1 (A:34-850) Formate dehydrogenase N, alpha | 2e-07 | |
| d1y5ia2 | 1074 | c.81.1.1 (A:1-1074) Respiratory nitrate reductase | 4e-07 | |
| d1y5ia2 | 1074 | c.81.1.1 (A:1-1074) Respiratory nitrate reductase | 4e-04 | |
| d1vlfm2 | 728 | c.81.1.1 (M:1-728) Transhydroxylase alpha subunit, | 8e-06 | |
| d1eu1a2 | 622 | c.81.1.1 (A:4-625) Dimethylsulfoxide reductase (DM | 2e-04 | |
| d1eu1a2 | 622 | c.81.1.1 (A:4-625) Dimethylsulfoxide reductase (DM | 4e-04 | |
| d1tmoa2 | 627 | c.81.1.1 (A:5-631) Trimethylamine N-oxide reductas | 5e-04 | |
| d3c8ya3 | 83 | d.58.1.5 (A:127-209) Fe-only hydrogenase, second d | 7e-04 |
| >d2fug32 c.81.1.1 (3:247-685) NADH-quinone oxidoreductase chain 3, Nqo3 {Thermus thermophilus [TaxId: 274]} Length = 439 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Formate dehydrogenase/DMSO reductase, domains 1-3 superfamily: Formate dehydrogenase/DMSO reductase, domains 1-3 family: Formate dehydrogenase/DMSO reductase, domains 1-3 domain: NADH-quinone oxidoreductase chain 3, Nqo3 species: Thermus thermophilus [TaxId: 274]
Score = 222 bits (567), Expect = 4e-64
Identities = 87/416 (20%), Positives = 146/416 (35%), Gaps = 52/416 (12%)
Query: 900 WETRKTESVDVLDAVGSNIIVSTRTGEVLRVLPRLNEDINEEWLADKGRFAYDGLKRQRL 959
WE +T + L VG I TR+GE+LR+ R ++NE W+ D GRF ++ + RL
Sbjct: 1 WEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRL 60
Query: 960 LTPFVRNCDGQLVATEWEDALIAVAQKLQTSEVAGVVGSLADAEAMVALKDLLNKLGSED 1019
TP VR +G+LV WE+A +A+ + L+ + V LA + +
Sbjct: 61 KTPLVRK-EGRLVEATWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALK 119
Query: 1020 LYTEYAFPLEGAGTDLRANYLLNNKIAGAEEADLILLIGTNPRFEAPLFNARIRKGYL-- 1077
T A+ + +AD L++G +P EAP+ + R+ +
Sbjct: 120 TPHLD----FQGRTAAPASLFPPASLEDLLQADFALVLG-DPTEEAPILHLRLSEFVRDL 174
Query: 1078 ----------------------TNELDVAYIGP------KVDLRYDYEHLGESADLIKQL 1109
+A P K ++ GE +++ L
Sbjct: 175 KPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLAL 234
Query: 1110 ASGSHPFS------KKLSAAKKPLIVVGADISDGAAVLALVQQLAAKVTCESDVPCDWKV 1163
+ AK P++++GA ++Q A
Sbjct: 235 LGDKEGSEMVAKAKEAWEKAKNPVLILGA---------GVLQDTVAAERARLLAERKGAK 285
Query: 1164 LNILQKAASQVAALDIGYKPGTSAIREKPPKVLFLLGADEGSISRDDVGKDCFIIYQGHH 1223
+ + AA+ +G PG P L+ GK +++ H
Sbjct: 286 VLAMTPAANARGLEAMGVLPGAKGASWDEPGALYAYYGFVPPEEALK-GKRFVVMHLSHL 344
Query: 1224 GDHGASIADAILPGAAYTEKQSTYVNTEGRAQQTLTAVTPPGLAREDWKIIRALSE 1279
A +LP + EK+ VN EGR A G A +++ L+E
Sbjct: 345 HPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQVLALLAE 400
|
| >d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]} Length = 151 | Back information, alignment and structure |
|---|
| >d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Length = 126 | Back information, alignment and structure |
|---|
| >d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Length = 126 | Back information, alignment and structure |
|---|
| >d2iv2x2 c.81.1.1 (X:1-564) Formate dehydrogenase H {Escherichia coli [TaxId: 562]} Length = 564 | Back information, alignment and structure |
|---|
| >d2iv2x2 c.81.1.1 (X:1-564) Formate dehydrogenase H {Escherichia coli [TaxId: 562]} Length = 564 | Back information, alignment and structure |
|---|
| >d1ogya2 c.81.1.1 (A:12-681) Periplasmic nitrate reductase alpha chain {Rhodobacter sphaeroides [TaxId: 1063]} Length = 670 | Back information, alignment and structure |
|---|
| >d1ogya2 c.81.1.1 (A:12-681) Periplasmic nitrate reductase alpha chain {Rhodobacter sphaeroides [TaxId: 1063]} Length = 670 | Back information, alignment and structure |
|---|
| >d1h0ha2 c.81.1.1 (A:1-812) Tungsten containing formate dehydrogenase, large subunit {Desulfovibrio gigas [TaxId: 879]} Length = 812 | Back information, alignment and structure |
|---|
| >d1h0ha2 c.81.1.1 (A:1-812) Tungsten containing formate dehydrogenase, large subunit {Desulfovibrio gigas [TaxId: 879]} Length = 812 | Back information, alignment and structure |
|---|
| >d2jioa2 c.81.1.1 (A:4-600) Periplasmic nitrate reductase alpha chain {Desulfovibrio desulfuricans [TaxId: 876]} Length = 597 | Back information, alignment and structure |
|---|
| >d2jioa2 c.81.1.1 (A:4-600) Periplasmic nitrate reductase alpha chain {Desulfovibrio desulfuricans [TaxId: 876]} Length = 597 | Back information, alignment and structure |
|---|
| >d1g8ka2 c.81.1.1 (A:4-682) Arsenite oxidase large subunit {Alcaligenes faecalis [TaxId: 511]} Length = 679 | Back information, alignment and structure |
|---|
| >d1g8ka2 c.81.1.1 (A:4-682) Arsenite oxidase large subunit {Alcaligenes faecalis [TaxId: 511]} Length = 679 | Back information, alignment and structure |
|---|
| >d1kqfa2 c.81.1.1 (A:34-850) Formate dehydrogenase N, alpha subunit {Escherichia coli [TaxId: 562]} Length = 817 | Back information, alignment and structure |
|---|
| >d1kqfa2 c.81.1.1 (A:34-850) Formate dehydrogenase N, alpha subunit {Escherichia coli [TaxId: 562]} Length = 817 | Back information, alignment and structure |
|---|
| >d1y5ia2 c.81.1.1 (A:1-1074) Respiratory nitrate reductase 1 alpha chain {Escherichia coli [TaxId: 562]} Length = 1074 | Back information, alignment and structure |
|---|
| >d1y5ia2 c.81.1.1 (A:1-1074) Respiratory nitrate reductase 1 alpha chain {Escherichia coli [TaxId: 562]} Length = 1074 | Back information, alignment and structure |
|---|
| >d1vlfm2 c.81.1.1 (M:1-728) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici [TaxId: 35816]} Length = 728 | Back information, alignment and structure |
|---|
| >d1eu1a2 c.81.1.1 (A:4-625) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter sphaeroides [TaxId: 1063]} Length = 622 | Back information, alignment and structure |
|---|
| >d1eu1a2 c.81.1.1 (A:4-625) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter sphaeroides [TaxId: 1063]} Length = 622 | Back information, alignment and structure |
|---|
| >d1tmoa2 c.81.1.1 (A:5-631) Trimethylamine N-oxide reductase {Shewanella massilia [TaxId: 76854]} Length = 627 | Back information, alignment and structure |
|---|
| >d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} Length = 83 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1334 | |||
| d1h0ha2 | 812 | Tungsten containing formate dehydrogenase, large s | 100.0 | |
| d2fug32 | 439 | NADH-quinone oxidoreductase chain 3, Nqo3 {Thermus | 100.0 | |
| d1kqfa2 | 817 | Formate dehydrogenase N, alpha subunit {Escherichi | 100.0 | |
| d2iv2x2 | 564 | Formate dehydrogenase H {Escherichia coli [TaxId: | 100.0 | |
| d1ogya2 | 670 | Periplasmic nitrate reductase alpha chain {Rhodoba | 100.0 | |
| d2jioa2 | 597 | Periplasmic nitrate reductase alpha chain {Desulfo | 100.0 | |
| d1g8ka2 | 679 | Arsenite oxidase large subunit {Alcaligenes faecal | 100.0 | |
| d1y5ia2 | 1074 | Respiratory nitrate reductase 1 alpha chain {Esche | 100.0 | |
| d1vlfm2 | 728 | Transhydroxylase alpha subunit, AthL {Pelobacter a | 100.0 | |
| d1eu1a2 | 622 | Dimethylsulfoxide reductase (DMSO reductase) {Rhod | 100.0 | |
| d1tmoa2 | 627 | Trimethylamine N-oxide reductase {Shewanella massi | 100.0 | |
| d2fug34 | 151 | NADH-quinone oxidoreductase chain 3, Nqo3, domain | 99.97 | |
| d1gxja_ | 161 | Smc hinge domain {Thermotoga maritima [TaxId: 2336 | 99.94 | |
| d3c8ya2 | 126 | Fe-only hydrogenase, N-terminal domain {Clostridiu | 99.92 | |
| d3c8ya2 | 126 | Fe-only hydrogenase, N-terminal domain {Clostridiu | 99.72 | |
| d2fug34 | 151 | NADH-quinone oxidoreductase chain 3, Nqo3, domain | 99.05 | |
| d3c8ya3 | 83 | Fe-only hydrogenase, second domain {Clostridium pa | 98.81 | |
| d2fug33 | 95 | Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi | 98.41 | |
| d1jb0c_ | 80 | Photosystem I iron-sulfur protein PsaC {Synechococ | 97.58 | |
| d2fug91 | 154 | NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus | 97.46 | |
| d1hfel2 | 85 | Fe-only hydrogenase larger subunit, N-domain {Desu | 97.29 | |
| d1xera_ | 103 | Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} | 97.24 | |
| d1sj1a_ | 66 | Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI | 97.11 | |
| d1iqza_ | 81 | Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1 | 97.11 | |
| d2fdna_ | 55 | Ferredoxin II {Clostridium acidurici [TaxId: 1556] | 96.86 | |
| d1bc6a_ | 77 | Ferredoxin {Bacillus schlegelii [TaxId: 1484]} | 96.7 | |
| d1vjwa_ | 59 | Ferredoxin A {Thermotoga maritima [TaxId: 2336]} | 96.63 | |
| d1blua_ | 80 | Ferredoxin II {Chromatium vinosum [TaxId: 1049]} | 96.62 | |
| d1gtea5 | 173 | Dihydropyrimidine dehydrogenase, C-terminal domain | 96.57 | |
| d2c42a5 | 117 | Pyruvate-ferredoxin oxidoreductase, PFOR, domain V | 96.48 | |
| d1dura_ | 55 | Ferredoxin II {Peptostreptococcus asaccharolyticus | 96.44 | |
| d1fxda_ | 58 | Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} | 96.27 | |
| d1rgva_ | 80 | Ferredoxin II {Thauera aromatica [TaxId: 59405]} | 96.08 | |
| d1h98a_ | 77 | Ferredoxin {Thermus thermophilus [TaxId: 274]} | 95.7 | |
| d1fxra_ | 64 | Ferredoxin I {Sulfate-reducing bacteria (Desulfovi | 95.69 | |
| d2fdna_ | 55 | Ferredoxin II {Clostridium acidurici [TaxId: 1556] | 95.41 | |
| d7fd1a_ | 106 | Ferredoxin {Azotobacter vinelandii [TaxId: 354]} | 95.05 | |
| d1hfel2 | 85 | Fe-only hydrogenase larger subunit, N-domain {Desu | 94.99 | |
| d1vlba2 | 80 | Aldehyde oxidoreductase, N-terminal domain {Desulf | 94.85 | |
| d1rm6c2 | 81 | 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, | 94.84 | |
| d1jnrb_ | 149 | Adenylylsulfate reductase B subunit {Archaeon Arch | 94.77 | |
| d1rgva_ | 80 | Ferredoxin II {Thauera aromatica [TaxId: 59405]} | 94.67 | |
| d1dura_ | 55 | Ferredoxin II {Peptostreptococcus asaccharolyticus | 94.62 | |
| d1t3qa2 | 81 | Quinoline 2-oxidoreductase small subunit QorS, N-d | 94.36 | |
| d3c7bb1 | 65 | DsrB insert domain {Archaeoglobus fulgidus [TaxId: | 94.35 | |
| d1bc6a_ | 77 | Ferredoxin {Bacillus schlegelii [TaxId: 1484]} | 94.27 | |
| d1blua_ | 80 | Ferredoxin II {Chromatium vinosum [TaxId: 1049]} | 94.18 | |
| d1dgja2 | 80 | Aldehyde oxidoreductase, N-terminal domain {Desulf | 93.97 | |
| d2ihta1 | 177 | Carboxyethylarginine synthase {Streptomyces clavul | 93.74 | |
| d1kqfb1 | 244 | Formate dehydrogenase N, iron-sulfur (beta) subuni | 93.66 | |
| d1jb0c_ | 80 | Photosystem I iron-sulfur protein PsaC {Synechococ | 93.52 | |
| d1ozha1 | 179 | Catabolic acetolactate synthase {Klebsiella pneumo | 93.14 | |
| d1xera_ | 103 | Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} | 93.05 | |
| d1n62a2 | 79 | Carbone monoxide (CO) dehydrogenase iron-sulfur pr | 92.73 | |
| d1ffva2 | 79 | Carbone monoxide (CO) dehydrogenase iron-sulfur pr | 92.44 | |
| d2c42a5 | 117 | Pyruvate-ferredoxin oxidoreductase, PFOR, domain V | 92.25 | |
| d1pvda1 | 179 | Pyruvate decarboxylase {Baker's yeast (Saccharomyc | 92.23 | |
| d1h98a_ | 77 | Ferredoxin {Thermus thermophilus [TaxId: 274]} | 92.21 | |
| d1y5ib1 | 509 | Respiratory nitrate reductase 1 beta chain {Escher | 92.11 | |
| d7fd1a_ | 106 | Ferredoxin {Azotobacter vinelandii [TaxId: 354]} | 91.76 | |
| d2ji7a1 | 175 | Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ | 91.51 | |
| d2ez9a1 | 183 | Pyruvate oxidase {Lactobacillus plantarum [TaxId: | 91.36 | |
| d1v97a2 | 90 | Xanthine oxidase, N-terminal domain {Cow (Bos taur | 91.31 | |
| d2bs2b1 | 133 | Fumarate reductase {Wolinella succinogenes [TaxId: | 90.77 | |
| d2fug91 | 154 | NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus | 90.76 | |
| d1kf6b1 | 138 | Fumarate reductase {Escherichia coli [TaxId: 562]} | 90.65 | |
| d1gtea5 | 173 | Dihydropyrimidine dehydrogenase, C-terminal domain | 90.42 | |
| d1ovma1 | 161 | Indole-3-pyruvate decarboxylase {Enterobacter cloa | 89.71 | |
| d1nekb1 | 132 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 89.45 | |
| d1ybha1 | 179 | Acetohydroxyacid synthase catalytic subunit {Thale | 89.35 | |
| d1y5ib1 | 509 | Respiratory nitrate reductase 1 beta chain {Escher | 89.27 | |
| d1kqfb1 | 244 | Formate dehydrogenase N, iron-sulfur (beta) subuni | 89.12 | |
| d1ytla1 | 158 | Acetyl-CoA decarbonylase/synthase complex epsilon | 89.03 | |
| d2djia1 | 177 | Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 | 88.45 | |
| d1vlfn2 | 195 | Transhydroxylase beta subunit, BthL, N-terminal do | 87.65 | |
| d3c8ya3 | 83 | Fe-only hydrogenase, second domain {Clostridium pa | 87.56 | |
| d1awda_ | 94 | 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} | 87.5 | |
| d1q6za1 | 160 | Benzoylformate decarboxylase {Pseudomonas putida [ | 87.34 | |
| d1zpda1 | 175 | Pyruvate decarboxylase {Zymomonas mobilis [TaxId: | 87.08 | |
| d1h0hb_ | 214 | Tungsten containing formate dehydrogenase, small s | 86.74 | |
| d1t9ba1 | 171 | Acetohydroxyacid synthase catalytic subunit {Baker | 86.56 | |
| d2ez9a1 | 183 | Pyruvate oxidase {Lactobacillus plantarum [TaxId: | 86.33 | |
| d1fxkc_ | 133 | Prefoldin alpha subunit {Archaeon Methanobacterium | 85.91 | |
| d2djia1 | 177 | Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 | 85.74 | |
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 85.08 | |
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 84.32 | |
| d1jroa2 | 84 | Xanthine dehydrogenase chain A, N-terminal domain | 83.95 | |
| d1ybha1 | 179 | Acetohydroxyacid synthase catalytic subunit {Thale | 82.29 | |
| d1jnrb_ | 149 | Adenylylsulfate reductase B subunit {Archaeon Arch | 82.17 | |
| d1ozha1 | 179 | Catabolic acetolactate synthase {Klebsiella pneumo | 81.68 | |
| d3c7bb1 | 65 | DsrB insert domain {Archaeoglobus fulgidus [TaxId: | 80.1 |
| >d1h0ha2 c.81.1.1 (A:1-812) Tungsten containing formate dehydrogenase, large subunit {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Formate dehydrogenase/DMSO reductase, domains 1-3 superfamily: Formate dehydrogenase/DMSO reductase, domains 1-3 family: Formate dehydrogenase/DMSO reductase, domains 1-3 domain: Tungsten containing formate dehydrogenase, large subunit species: Desulfovibrio gigas [TaxId: 879]
Probab=100.00 E-value=2e-59 Score=597.63 Aligned_cols=379 Identities=19% Similarity=0.230 Sum_probs=327.4
Q ss_pred CCCCcceeeeeecccCCCCCceEEEe--eCCEEEEecCCCCCCCCccccccccccccccc-cccccCCceEecC-CCCee
Q psy11935 897 ARPWETRKTESVDVLDAVGSNIIVST--RTGEVLRVLPRLNEDINEEWLADKGRFAYDGL-KRQRLLTPFVRNC-DGQLV 972 (1334)
Q Consensus 897 ~r~we~~~~~s~c~~C~~gC~i~v~v--~~g~v~ri~p~~~~~vn~g~lC~kgr~~~~~l-~~~Rl~~PliR~~-~g~~~ 972 (1334)
-++|+.+.++|+|++|++||++.|+| ++|+|++|+|++++|+|+|++|+||+++++.+ +|+||++||+|.. +|+|+
T Consensus 5 ~~~~~~k~t~SvC~~C~~gCgi~v~v~~kdGkvv~IeGdpd~PvN~G~lC~KG~s~~~~vy~pdRL~~PL~R~rG~g~w~ 84 (812)
T d1h0ha2 5 LKTVDAKQTTSVCCYCSVGCGLIVHTDKKTNRAINVEGDPDHPINEGSLCAKGASTWQLAENERRPANPLYRAPGSDQWE 84 (812)
T ss_dssp CTTTTSEEEEEECSSBTTCCEEEEEECTTTCCEEEEEECTTCTTTTTCCCHHHHTHHHHHSCTTSCSSCEEECTTCSSCE
T ss_pred cCCCCccEEeEEcCCCccCCCeEEEEEeeCCEEEEEEcCCCCCccCcEECHhHHhHHHHhcCCccccCCEEeccCCCCee
Confidence 37899999999999999999999999 89999999999999999999999999999998 5999999999973 67899
Q ss_pred ecCHHHHHHHHHHHhcc-------------------CCEEEEeCCcCCHHHHHHHHHHHHHhCCCccccCCCCCcchhhh
Q psy11935 973 ATEWEDALIAVAQKLQT-------------------SEVAGVVGSLADAEAMVALKDLLNKLGSEDLYTEYAFPLEGAGT 1033 (1334)
Q Consensus 973 ~iSWdeAl~~ia~~L~~-------------------~~i~~~~g~~~~~e~~~~~~~l~~~lGs~~~~~~~~~~~~~~~~ 1033 (1334)
+|||||||++||++|++ +.+++++|+..++|..+++++|++.||++|+++..++|+.+...
T Consensus 85 ~ISWDEAld~IA~klk~ird~~~~~~~~~g~~v~~~~~i~~~gs~~~~ne~~~l~~kf~~~lGt~ni~~~~~iC~~~~~~ 164 (812)
T d1h0ha2 85 EKSWDWMLDTIAERVAKTREATFVTKNAKGQVVNRCDGIASVGSAAMDNEECWIYQAWLRSLGLFYIEHQARICHSATVA 164 (812)
T ss_dssp ECCHHHHHHHHHHHHHHHHHHHEEEECTTSCEEEEECSEEEECCTTSCHHHHHHHHHHHHHTTBCCEECTHHHHTHHHHH
T ss_pred ecCHHHHHHHHHHHHHHHHHHhcccccccccccccCcceEEEecCCcCcHHHHHHHHHHHHcCCCCcCCCCCcchHHHHH
Confidence 99999999999999986 35777889999999999999999999999999988889877666
Q ss_pred hhhhhcc---CCCCcccccccCeEEEEcCCccccchhHHHHHHHHHhhCCCeEEEEccCCCCcccccc------CCCcHH
Q psy11935 1034 DLRANYL---LNNKIAGAEEADLILLIGTNPRFEAPLFNARIRKGYLTNELDVAYIGPKVDLRYDYEH------LGESAD 1104 (1334)
Q Consensus 1034 ~~~~~~~---~~~~~~die~ad~Il~~G~np~~~~p~~~~rir~a~~~~g~kiivIdp~~~~t~~~a~------~Gtd~a 1104 (1334)
++..+|| +++++.|+++||+||+||+||.+++|+.+.+++++. ++|+||||||||++.|++.++ ||||.+
T Consensus 165 gl~~tfG~g~~tn~~~Di~nad~Il~~G~Npae~~p~~~~~i~~a~-~rGaklIvVDPR~t~TAa~AD~wipIrPGTD~A 243 (812)
T d1h0ha2 165 ALAESYGRGAMTNHWIDLKNSDVILMMGSNPAENHPISFKWVMRAK-DKGATLIHVDPRYTRTSTKCDLYAPLRSGSDIA 243 (812)
T ss_dssp HHHHHHSCCSCSSCTGGGGGCSEEEEESCCHHHHSTTHHHHHHHHH-HTTCEEEEECSSCCTTGGGCSEEECCCTTCHHH
T ss_pred HHHHHcCCCCCCCCHHHHhcCcEEEEeccccccchhhHHHHHHHhh-hccccceeccccccchhhhcchhhhcCCCccHH
Confidence 6666654 467899999999999999999999999999999986 689999999999999998876 999999
Q ss_pred HHHHHH--------------------------------------------------------------------------
Q psy11935 1105 LIKQLA-------------------------------------------------------------------------- 1110 (1334)
Q Consensus 1105 ~l~~l~-------------------------------------------------------------------------- 1110 (1334)
|+.+|+
T Consensus 244 ll~gmi~~Il~~~l~d~dfv~~yTna~~lv~~~~~~~~glf~g~d~~~~~~d~~~w~~~~d~~g~~~~d~~~~~~~~vf~ 323 (812)
T d1h0ha2 244 FLNGMTKYILEKELYFKDYVVNYTNASFIVGEGFAFEEGLFAGYNKETRKYDKSKWGFERDENGNPKRDETLKHPRCVFQ 323 (812)
T ss_dssp HHHHHHHHHHHTTCSCHHHHHHHBGGGBBBCTTCCEETTEETTEETTTTEECGGGGCBCBCTTSCBCBCTTSCSTTBHHH
T ss_pred HHHHHHHHHHHcCCccHHHHHHHcCcccccccccchhhhhhhccchhhhhhhhhccccccccccCccccccccccchHHH
Confidence 987653
Q ss_pred ----------------------hcHHHHHHHHhcC----CCcEEEEcCCc---ccHHHHHHHHHH---HHHhhcCCCCCC
Q psy11935 1111 ----------------------SGSHPFSKKLSAA----KKPLIVVGADI---SDGAAVLALVQQ---LAAKVTCESDVP 1158 (1334)
Q Consensus 1111 ----------------------~g~~~~A~~l~~a----~~~~ii~G~~~---~~g~~~~~al~~---l~~~~g~~Gg~~ 1158 (1334)
+.|.++|+.|+++ ++.+|++|.|. .+|.+.++++.. |.|++|.+||
T Consensus 324 ~Lk~~~~~yTpe~va~itGVp~e~I~~vA~~~a~~~~~~~~~~i~~g~G~tqh~~g~~~ira~~~L~lLlGniG~pGG-- 401 (812)
T d1h0ha2 324 IMKKHYERYDLDKISAICGTPKELILKVYDAYCATGKPDKAGTIMYAMGWTQHTVGVQNIRAMSINQLLLGNIGVAGG-- 401 (812)
T ss_dssp HHHHHHTTCCHHHHHHHHCCCHHHHHHHHHHHHGGGSTTCCEEEEECCCCSSHHHHHHHHHHHHHHHHHTTCSSSTTC--
T ss_pred HHHHHHHhCCHHHHHHhcCCCHHHHHHHHHHHHHhcCCCCcEEEEecccccccccHHHHHHHHHHHHHHhCCcccCCc--
Confidence 1246789999875 34578899888 667776666555 4556666663
Q ss_pred CCCcccccchhhhhhhhhhhcCCC----cc--------------------------------------------------
Q psy11935 1159 CDWKVLNILQKAASQVAALDIGYK----PG-------------------------------------------------- 1184 (1334)
Q Consensus 1159 ~~~~~~~~l~~~~n~~G~~~~g~~----pg-------------------------------------------------- 1184 (1334)
|++.+++++|.+|+.++|.. ||
T Consensus 402 ----Gi~~lrG~~nvqG~~d~g~~~~~lPgy~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~k~~~~~a 477 (812)
T d1h0ha2 402 ----GVNALRGEANVQGSTDHGLLMHIYPGYLGTARASIPTYEEYTKKFTPVSKDPQSANWWSNFPKYSASYIKSMWPDA 477 (812)
T ss_dssp ----SEEECCSBTTHHHHHHTTCBTTEETTTEECCBTTCCSHHHHHHHHCCCCCCTTCCCGGGGHHHHHHHHHHHHCTTS
T ss_pred ----ceecccCCCCCcCcccccccccCCccccccccccccchhhhhhhcccccccccccccccccchhhHHHHHhhcccc
Confidence 35566666666666554421 00
Q ss_pred -----------------------hhhHhcCCCcEEEEECCChhh------hHHhhcCCCceEEEEcCCCChhhcccc---
Q psy11935 1185 -----------------------TSAIREKPPKVLFLLGADEGS------ISRDDVGKDCFIIYQGHHGDHGASIAD--- 1232 (1334)
Q Consensus 1185 -----------------------~~~i~~g~ik~l~~~g~np~~------~~~~al~k~~fvV~~d~~~~eta~~AD--- 1232 (1334)
++++..|++|++|++|.||+. ..+++|.+++|+|++|+|+|+||.|||
T Consensus 478 ~~~~~~~~lp~~~~~~~~~~~~~~~~~~~G~ik~l~~~g~NP~~s~pn~~~~~~aL~kLd~lVv~D~~~teTA~fad~~~ 557 (812)
T d1h0ha2 478 DLNEAYGYLPKGEDGKDYSWLTLFDDMFQGKIKGFFAWGQNPACSGANSNKTREALTKLDWMVNVNIFDNETGSFWRGPD 557 (812)
T ss_dssp CHHHHHHHSCCBCTTCCCSHHHHHHHHHTTCCCEEEEESCCHHHHSBSHHHHHHHHTTCSEEEEEESSCCTTTTGGGSTT
T ss_pred ccccccCcccccccCCCccHHHHHHHhhcCCceEEEEeCCCHHHhCcCHHHHHHHHHCCCeEEEEecccCchHHhhcccc
Confidence 234567899999999999964 257899999999999999999999999
Q ss_pred ----------EEecCCCCCCCCcccccCCCceEEeccccCCCCCcccHHHHHHHHHHHhc
Q psy11935 1233 ----------AILPGAAYTEKQSTYVNTEGRAQQTLTAVTPPGLAREDWKIIRALSEGVS 1282 (1334)
Q Consensus 1233 ----------vVLP~a~~~Ek~Gt~~n~egrvq~~~~av~P~gear~dw~Il~~La~~lg 1282 (1334)
||||+++|+|++|+++|+++++|..+++|+||||+|+||+|+..||++|+
T Consensus 558 ~~~~~i~~~divLPaa~~~Ek~Gt~tNs~r~vq~~~kav~P~gear~D~~I~~~La~rL~ 617 (812)
T d1h0ha2 558 MDPKKIKTEVFFLPCAVAIEKEGSISNSGRWMQWRYVGPEPRKNAIPDGDLIVELAKRVQ 617 (812)
T ss_dssp CCGGGCCCEEEEEEBCCGGGCCEEEECTTCEEEEECCSSCCCTTCBCHHHHHHHHHHHHH
T ss_pred ccccccccceEEECCCCccccCCCeecCccchhhhccccCCccccCCHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999998
|
| >d2fug32 c.81.1.1 (3:247-685) NADH-quinone oxidoreductase chain 3, Nqo3 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kqfa2 c.81.1.1 (A:34-850) Formate dehydrogenase N, alpha subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2iv2x2 c.81.1.1 (X:1-564) Formate dehydrogenase H {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ogya2 c.81.1.1 (A:12-681) Periplasmic nitrate reductase alpha chain {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2jioa2 c.81.1.1 (A:4-600) Periplasmic nitrate reductase alpha chain {Desulfovibrio desulfuricans [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d1g8ka2 c.81.1.1 (A:4-682) Arsenite oxidase large subunit {Alcaligenes faecalis [TaxId: 511]} | Back information, alignment and structure |
|---|
| >d1y5ia2 c.81.1.1 (A:1-1074) Respiratory nitrate reductase 1 alpha chain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vlfm2 c.81.1.1 (M:1-728) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici [TaxId: 35816]} | Back information, alignment and structure |
|---|
| >d1eu1a2 c.81.1.1 (A:4-625) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1tmoa2 c.81.1.1 (A:5-631) Trimethylamine N-oxide reductase {Shewanella massilia [TaxId: 76854]} | Back information, alignment and structure |
|---|
| >d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gxja_ d.215.1.1 (A:) Smc hinge domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} | Back information, alignment and structure |
|---|
| >d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} | Back information, alignment and structure |
|---|
| >d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} | Back information, alignment and structure |
|---|
| >d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} | Back information, alignment and structure |
|---|
| >d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} | Back information, alignment and structure |
|---|
| >d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} | Back information, alignment and structure |
|---|
| >d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} | Back information, alignment and structure |
|---|
| >d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} | Back information, alignment and structure |
|---|
| >d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} | Back information, alignment and structure |
|---|
| >d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} | Back information, alignment and structure |
|---|
| >d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} | Back information, alignment and structure |
|---|
| >d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} | Back information, alignment and structure |
|---|
| >d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} | Back information, alignment and structure |
|---|
| >d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} | Back information, alignment and structure |
|---|
| >d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d2ihta1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} | Back information, alignment and structure |
|---|
| >d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} | Back information, alignment and structure |
|---|
| >d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} | Back information, alignment and structure |
|---|
| >d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} | Back information, alignment and structure |
|---|
| >d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} | Back information, alignment and structure |
|---|
| >d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} | Back information, alignment and structure |
|---|
| >d1pvda1 c.31.1.3 (A:182-360) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2ji7a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} | Back information, alignment and structure |
|---|
| >d2ez9a1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ovma1 c.31.1.3 (A:181-341) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} | Back information, alignment and structure |
|---|
| >d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ytla1 c.31.1.6 (A:17-174) Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2djia1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} | Back information, alignment and structure |
|---|
| >d1vlfn2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]} | Back information, alignment and structure |
|---|
| >d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} | Back information, alignment and structure |
|---|
| >d1q6za1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1zpda1 c.31.1.3 (A:188-362) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d1h0hb_ d.58.1.5 (B:) Tungsten containing formate dehydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1t9ba1 c.31.1.3 (A:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ez9a1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2djia1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} | Back information, alignment and structure |
|---|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|