Psyllid ID: psy11954

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-
MKSTPTSGKVVRSIHFISGTNVALRRPTNQSSTIRGAPSSNANDGELTTVHDGKRCTETQKEVSPWWQVDLLRPYPIRIVRITTRGCCGHQPLQDLEIRVGNSTDLQKNPLCAWFPGTLGHQPLQDLEIRVGNSTDLQKNPLCAWFPGTLEEGITKSFTCARTLVGQNVFIQLVGVEGSLSLCEVEIFTTDGELERRKDRLKTLLVWIGAQKDPGITARTWKWVDGEVVTKPSWGKDQPNNYNGEQNCVVLDGGRGWLWNDVGCKLDYLHWICQHNPANCGSPDRHVNTTFVGTVSTKLGSTISYACPEGNMLVGSATRTCKEGFWTGVAPTCQYFQLQPMDVPNLVLYLFLSKLFRESYERLNVDCGKLEHIEHGTVTLETTRTTHGAVAIYACHENYTLIGETRRVCGDGGKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGSNVNIDCGRLTAIPYGSISYLNETTYLGSEVLYSCSRNYRLVGHPRRSCLESKVWSDTAPKCEGKATKDIKVCSNVAVDRREIRCPEPTLPAHSILSVTGNDRLYGRTLIKTADSASSVATYKIGALPTLPAHSILSVTGNDRLYGRTLIKTADSASSVATYKIGALVKYRCERGYKVEGEPLSTCEDTGSWSGSVPECIYVDCGNPETVPNGGFTLTSNATYYGTAVLYECDENYRLEGHARRLCLENGTWSSGLPTCKGNEGHARRLCLENGTWSSGLPTCKGCKTPKKSLTRPALSCLPGKRFYYHRGIFRLQNTQKVSYTRTCTKRGTWSGHIPTCKAIDCSHPGSIDNGRVIIMNQTTTYNSAVEYHCVPQYQRIGPYLRKCMEDGSWSGDEPRCEKRFNSGIPGRSRRSPINSF
cccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEEEcccEEEEEEEEEEccccccccccccEEEEccccccccccccccccccccccccEEEEccccccccccccccccccccccccccEEEEcccccccccEEEEEEcccccccccccEEEEccccccccccccccccEEEccccccccccccEEEEcccEEEEEEcccccccccccccccEEEEEcccccEEccccccccccccEEEEccccccccccccccEEEEccccccccEEEEEcccccEEccccEEEcccccEEcccccEEEEEcccccccccEEEEEcccccccccccccEEccccccccccEEEEcccccccccEEEEEEccccEEEcccEEEEccccEEccccccEEEEEccccccccccEEEccccccccEEEEEcccccEEEcccEEEcccccccccccEEEEccccEEcccEEEEEcccccEEcccccEEEcccccEEcccccEEEEEccccccccccEEcccccccccccccccEEEEEEccEEEEccEEEEEcccccEEcEEEEcccccccccEEEEcccccccccccccccccccccccccccccEEEEEcccccEEcccccEEcccccccccccccEEEEEccccccccccEEEEcccccccccEEEEEcccccEEEcccEEEEccccEEccccccEEEcccccccccccccccccccccccccccccccccccEEEEccccEEEEEcEEEEEccccccEEEEEEccccEEEccccEEEEEcccccccccccEEEEcccccccccEEEEEcccccEEEccccEEEcccccEEcccccccccccccccccccccccccc
ccccccccEEEEcccccccEEEEEEcccccccccccccccccccccccccccccEccccccccccccHHHHcccccEEEEEEEccccccccccccccEEEccccccccccEEEcccccccccccEEEEcccccEEEcccccEEEEEcccccccccccccccccccccccccccccccccccEEEEEEEEccccEEEEEccccccEEEEccccEEEEccccEccccccccccccccccccccccccEEEEEEccccEEEccccccEEcccccccccEEccccccccccccEEEcccccEcccEEEEEEcccEEEEcccEEEEccccccccccccEcccccccccccccEEccccccccccccccEEcccccccccccEEEEEcEEEEcccEEEEEEcccEEEEcccEEEEEcccccccccccEEEccccccccccccEEccccEEEccEEEEEEcccEEEEcccEEEEcccccccccccEEccccccccccEEEEEEcccEEEEcccEEEEccccccccccccEEEccccccccccccEEcccccccccccccccEEEEEcccccccccEEEcccccEEEccccccccccccccccccccccccccccccccccccccccccccEcccEEEEEEcccEEEEcccEEEEccccccccccccEEEccccccccccccEEEcccccEEcccEEEEEEccccEEcccccEEEcccccccccccccEEcccccccccccccccccccccccccccccccccEEEEEEccccEEEcccEEEEEEccccccEEEEEccccccccccccEEEccccccccccccEEEccccccEcccEEEEEEcccEEEEcccEEEEccccccccccccccccccccccccccccccccc
mkstptsgkvvrsihfisgtnvalrrptnqsstirgapssnandgelttvhdgkrctetqkevspwwqvdllrpypirivrittrgccghqplqdleirvgnstdlqknplcawfpgtlghqplqdleirvgnstdlqknplcawfpgtleegitksFTCARTLVGQNVFIQLVGVegslslceVEIFTTDGELERRKDRLKTLLVWIGaqkdpgitartwkwvdgevvtkpswgkdqpnnyngeqncvvldggrgwlwndvgcKLDYLHWicqhnpancgspdrhvnttFVGTVSTKLgstisyacpegnmlvgsatrtckegfwtgvaptcqyfqlqpmdvpnLVLYLFLSKLFRESYERLnvdcgklehiehgtvtlettrtthGAVAIYACHenytligetrrvcgdggkwngtepqclfdwcaeppqisggivttsgrrtgsvatyscepgfilfgsnvnidcgrltaipygsisylnettylGSEVLYSCSrnyrlvghprrscleskvwsdtapkcegkatkdikVCSNVAvdrreircpeptlpahsilsvtgndrlygrtliktadsassvatykigalptlpahsilsvtgndrlygrtliktadsassvATYKIGALVKYRCergykvegeplstcedtgswsgsvpeciyvdcgnpetvpnggftltsnatYYGTAVLYEcdenyrlegHARRLClengtwssglptckgnegharrlclengtwssglptckgcktpkksltrpalsclpgkrfyyhrgifrlqntqkvsytrtctkrgtwsghiptckaidcshpgsidngrVIIMNQTTTynsaveyhcvpqyqrigpylrkcmedgswsgdeprcekrfnsgipgrsrrspinsf
mkstptsgkvvrsihfisgtnvalrrptnqsstirgapssnandgelttvhdGKRCtetqkevspwwqvdllrpYPIRIVRITTRGCCGHQPLQDLEIRVGNSTDLQKNPLCAWFPGTLGHQPLQDLEIRVGNSTDLQKNPLCAWFPGTLEEGITKSFTCARTLVGQNVFIQLVGVEGSLSLCEVEIFttdgelerrkDRLKTLLvwigaqkdpgitartwkwvDGEVVTKpswgkdqpnnynGEQNCVVLDGGRGWLWNDVGCKLDYLHWICQHNPANCGSPDRHVNTTFVGTVSTKLGSTISYACPEGNMLVGSATRTCKEGFWTGVAPTCQYFQLQPMDVPNLVLYLFLSKLFRESYERLNVDCGKLEHIEHGTVTLETTRTTHGAVAIYACHENYTLIGETRRVCGDGGKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGSNVNIDCGRLTAIPYGSISYLNETTYLGSEVLYSCSRNYRLVghprrscleskvwsdtapkcegkatkdikvcSNVAVDRreircpeptlpahsilsvtgndrLYGRTLIKTADSASSVATYKIgalptlpahsiLSVTGNDRLYGRTLiktadsassvatyKIGALVKYRCERGYKvegeplstcedtgswSGSVPECIYVDCGNPETVPNGGFTLTSNATYYGTAVLYECDENYRLEGHARRLCLENGTWSSGLPTCKGNEGHARRLCLEngtwssglptckgcktpkksltrpalsclpgKRFYYHrgifrlqntqkvsyTRTCtkrgtwsghiptcKAIDCSHPGSIDNGRVIIMNQTTTYNSAVEYHCVPQYQRIGPYLRKCMEDgswsgdeprcekrfnsgipgrsrrspinsf
MKSTPTSGKVVRSIHFISGTNVALRRPTNQSSTIRGAPSSNANDGELTTVHDGKRCTETQKEVSPWWQVDLLRPYPIRIVRITTRGCCGHQPLQDLEIRVGNSTDLQKNPLCAWFPGTLGHQPLQDLEIRVGNSTDLQKNPLCAWFPGTLEEGITKSFTCARTLVGQNVFIQLVGVEGSLSLCEVEIFTTDGELERRKDRLKTLLVWIGAQKDPGITARTWKWVDGEVVTKPSWGKDQPNNYNGEQNCVVLDGGRGWLWNDVGCKLDYLHWICQHNPANCGSPDRHVNTTFVGTVSTKLGSTISYACPEGNMLVGSATRTCKEGFWTGVAPTCQYFQLQPMDVPNLVLYLFLSKLFRESYERLNVDCGKLEHIEHGTVTLETTRTTHGAVAIYACHENYTLIGETRRVCGDGGKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGSNVNIDCGRLTAIPYGSISYLNETTYLGSEVLYSCSRNYRLVGHPRRSCLESKVWSDTAPKCEGKATKDIKVCSNVAVDRREIRCPEPTLPAHSILSVTGNDRLYGRTLIKTADSASSVATYKIGALPTLPAHSILSVTGNDRLYGRTLIKTADSASSVATYKIGALVKYRCERGYKVEGEPLSTCEDTGSWSGSVPECIYVDCGNPETVPNGGFTLTSNATYYGTAVLYECDENYRLEGHARRLCLENGTWSSGLPTCKGNEGHARRLCLENGTWSSGLPTCKGCKTPKKSLTRPALSCLPGKRFYYHRGIFRLQNTQKVSYTRTCTKRGTWSGHIPTCKAIDCSHPGSIDNGRVIIMNQTTTYNSAVEYHCVPQYQRIGPYLRKCMEDGSWSGDEPRCEKRFNSGIPGRSRRSPINSF
***********RSIHFISGTN***************************************KEVSPWWQVDLLRPYPIRIVRITTRGCCGHQPLQDLEIRVGNSTDLQKNPLCAWFPGTLGHQPLQDLEIRVGNSTDLQKNPLCAWFPGTLEEGITKSFTCARTLVGQNVFIQLVGVEGSLSLCEVEIFTTDGELERRKDRLKTLLVWIGAQKDPGITARTWKWVDGEVVTKPSWGKDQPNNYNGEQNCVVLDGGRGWLWNDVGCKLDYLHWICQHNPANCGSPDRHVNTTFVGTVSTKLGSTISYACPEGNMLVGSATRTCKEGFWTGVAPTCQYFQLQPMDVPNLVLYLFLSKLFRESYERLNVDCGKLEHIEHGTVTLETTRTTHGAVAIYACHENYTLIGETRRVCGDGGKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGSNVNIDCGRLTAIPYGSISYLNETTYLGSEVLYSCSRNYRLVGHPRRSCLESKVWSDTAPKCEGKATKDIKVCSNVAVDRREIRCPEPTLPAHSILSVTGNDRLYGRTLIKTADSASSVATYKIGALPTLPAHSILSVTGNDRLYGRTLIKTADSASSVATYKIGALVKYRCERGYKVEGEPLSTCEDTGSWSGSVPECIYVDCGNPETVPNGGFTLTSNATYYGTAVLYECDENYRLEGHARRLCLENGTWSSGLPTCKGNEGHARRLCLENGTWSSGLPTCKGCKTPKKSLTRPALSCLPGKRFYYHRGIFRLQNTQKVSYTRTCTKRGTWSGHIPTCKAIDCSHPGSIDNGRVIIMNQTTTYNSAVEYHCVPQYQRIGPYLRKCMED******************************
**********VRSIHFISGTNVALRR****************************RCTETQKEVSPWWQVDLLRPYPIRIVRITTRGCCGHQPLQDLEIRVGNSTDLQKNPLCAWFPGTLGHQPLQDLEIRVGNSTDLQKNPLCAWFPGTLEEGITKSFTCARTLVGQNVFIQLVGVEGSLSLCEVEIFTTDGELERRKDRLKTLLVWIGAQKDPGITARTWKWVDGEVVTKPSWGKDQPNNYNGEQNCVVLDGGRGWLWNDVGCKLDYLHWICQHNPANCGSPDRHVNTTFVGTVSTKLGSTISYACPEGNMLVGSATRTCKEGFWTGVAPTCQYFQLQPMDVPNLVLYLFLSKLFRESYERLNVDCGKLEHIEHGTVTLETTRTTHGAVAIYACHENYTLIGETRRVCGDGGKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGSNVNIDCGRLTAIPYGSISYLNETTYLGSEVLYSCSRNYRLVGHPRRSCLESKVWSDTAPKCEGKATKDIKVCSNVAVDRREIRCPEPTLPAHSILSVTGNDRLYGRTLIKTADSASSVATYKIGALPTLPAHSILSVTGNDRLYGRT************TYKIGALVKYRCERGYKVEGEPLSTCEDTGSWSGSVPECIYVDCGNPETVPNGGFTLTSNATYYGTAVLYECDENYRLEGHARRLCLENGTWSSGLPTCKGNEGHARRLCLENGTWSSGLPTCKGCKTPKKSLTRPALSCLPGKRFYYHRGIFRLQNTQKVSYTRTCTKRGTWSGHIPTCKAIDCSHPGSIDNGRVIIMNQTTTYNSAVEYHCVPQYQRIGPYLRKCMEDGSWSGDEPRCEKR*****************
*********VVRSIHFISGTNVALRRPTNQSSTIRGAPSSNANDGELTTVHDGKRCTETQKEVSPWWQVDLLRPYPIRIVRITTRGCCGHQPLQDLEIRVGNSTDLQKNPLCAWFPGTLGHQPLQDLEIRVGNSTDLQKNPLCAWFPGTLEEGITKSFTCARTLVGQNVFIQLVGVEGSLSLCEVEIFTTDGELERRKDRLKTLLVWIGAQKDPGITARTWKWVDGEVVTKPSWGKDQPNNYNGEQNCVVLDGGRGWLWNDVGCKLDYLHWICQHNPANCGSPDRHVNTTFVGTVSTKLGSTISYACPEGNMLVGSATRTCKEGFWTGVAPTCQYFQLQPMDVPNLVLYLFLSKLFRESYERLNVDCGKLEHIEHGTVTLETTRTTHGAVAIYACHENYTLIGETRRVCGDGGKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGSNVNIDCGRLTAIPYGSISYLNETTYLGSEVLYSCSRNYRLVGHPRRSCLESKVWSDTAPKCEGKATKDIKVCSNVAVDRREIRCPEPTLPAHSILSVTGNDRLYGRTLIKTADSASSVATYKIGALPTLPAHSILSVTGNDRLYGRTLIKTADSASSVATYKIGALVKYRCERGYKVEGEPL*********SGSVPECIYVDCGNPETVPNGGFTLTSNATYYGTAVLYECDENYRLEGHARRLCLENGTWSSGLPTCKGNEGHARRLCLENGTWSSGLPTCKGCKTPKKSLTRPALSCLPGKRFYYHRGIFRLQNTQKVSYTRTCTKRGTWSGHIPTCKAIDCSHPGSIDNGRVIIMNQTTTYNSAVEYHCVPQYQRIGPYLRKCMEDGSWSGDEPRCEKRFNS**************
****PTSGKVVRSIHFISGTNVALRRPTN**************************CT***KEVSPWWQVDLLRPYPIRIVRITTRGCCGHQPLQDLEIRVGNSTDLQKNPLCAWFPGTLGHQPLQDLEIRVGNSTDLQKNPLCAWFPGTLEEGITKSFTCARTLVGQNVFIQLVGVEGSLSLCEVEIFTTDGELERRKDRLKTLLVWIGAQKDPGITARTWKWVDGEVVTKPSWGKDQPNNYNGEQNCVVLDGGRGWLWNDVGCKLDYLHWICQHNPANCGSPDRHVNTTFVGTVSTKLGSTISYACPEGNMLVGSATRTCKEGFWTGVAPTCQYFQLQPMDVPNLVLYLFLSKLFRESYERLNVDCGKLEHIEHGTVTLETTRTTHGAVAIYACHENYTLIGETRRVCGDGGKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGSNVNIDCGRLTAIPYGSISYLNETTYLGSEVLYSCSRNYRLVGHPRRSCLESKVWSDTAPKCEGKATKDIKVCSNVAVDRREIRCPEPTLPAHSILSVTGNDRLYGRTLIKTADSASSVATYKIGALPTLPAHSILSVTGNDRLYGRTLIKTADSASSVATYKIGALVKYRCERGYKVEGEPLSTCEDTGSWSGSVPECIYVDCGNPETVPNGGFTLTSNATYYGTAVLYECDENYRLEGHARRLCLENGTWSSGLPTCKGNEGHARRLCLENGTWSSGLPTCKGCKTPKKSLTRPALSCLPGKRFYYHRGIFRLQNTQKVSYTRTCTKRGTWSGHIPTCKAIDCSHPGSIDNGRVIIMNQTTTYNSAVEYHCVPQYQRIGPYLRKCMEDGSWSGDEPRCEKRFNSGI************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSTPTSGKVVRSIHFISGTNVALRRPTNQSSTIRGAPSSNANDGELTTVHDGKRCTETQKEVSPWWQVDLLRPYPIRIVRITTRGCCGHQPLQDLEIRVGNSTDLQKNPLCAWFPGTLGHQPLQDLEIRVGNSTDLQKNPLCAWFPGTLEEGITKSFTCARTLVGQNVFIQLVGVEGSLSLCEVEIFTTDGELERRKDRLKTLLVWIGAQKDPGITARTWKWVDGEVVTKPSWGKDQPNNYNGEQNCVVLDGGRGWLWNDVGCKLDYLHWICQHNPANCGSPDRHVNTTFVGTVSTKLGSTISYACPEGNMLVGSATRTCKEGFWTGVAPTCQYFQLQPMDVPNLVLYLFLSKLFRESYERLNVDCGKLEHIEHGTVTLETTRTTHGAVAIYACHENYTLIGETRRVCGDGGKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGSNVNIDCGRLTAIPYGSISYLNETTYLGSEVLYSCSRNYRLVGHPRRSCLESKVWSDTAPKCEGKATKDIKVCSNVAVDRREIRCPEPTLPAHSILSVTGNDRLYGRTLIKTADSASSVATYKIGALPTLPAHSILSVTGNDRLYGRTLIKTADSASSVATYKIGALVKYRCERGYKVEGEPLSTCEDTGSWSGSVPECIYVDCGNPETVPNGGFTLTSNATYYGTAVLYECDENYRLEGHARRLCLENGTWSSGLPTCKGNEGHARRLCLENGTWSSGLPTCKGCKTPKKSLTRPALSCLPGKRFYYHRGIFRLQNTQKVSYTRTCTKRGTWSGHIPTCKAIDCSHPGSIDNGRVIIMNQTTTYNSAVEYHCVPQYQRIGPYLRKCMEDGSWSGDEPRCEKRFNSGIPGRSRRSPINSF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query881 2.2.26 [Sep-21-2011]
Q96PZ7 3565 CUB and sushi domain-cont yes N/A 0.656 0.162 0.260 2e-45
Q923L3 3564 CUB and sushi domain-cont yes N/A 0.659 0.163 0.265 5e-45
Q7Z407 3707 CUB and sushi domain-cont no N/A 0.572 0.135 0.263 3e-44
P0C6B8 3564 Sushi, von Willebrand fac no N/A 0.606 0.149 0.245 6e-43
A2AVA0 3567 Sushi, von Willebrand fac no N/A 0.565 0.139 0.276 1e-42
Q80T79 3707 CUB and sushi domain-cont no N/A 0.566 0.134 0.261 1e-42
Q4LDE5 3571 Sushi, von Willebrand fac no N/A 0.599 0.147 0.247 1e-42
Q7Z408 3487 CUB and sushi domain-cont no N/A 0.644 0.162 0.265 2e-41
P16109830 P-selectin OS=Homo sapien no N/A 0.643 0.683 0.220 9e-25
P17927 2039 Complement receptor type no N/A 0.616 0.266 0.231 2e-23
>sp|Q96PZ7|CSMD1_HUMAN CUB and sushi domain-containing protein 1 OS=Homo sapiens GN=CSMD1 PE=1 SV=2 Back     alignment and function desciption
 Score =  185 bits (469), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 193/742 (26%), Positives = 287/742 (38%), Gaps = 164/742 (22%)

Query: 267  DYLHWICQHNPANCGSPDRHVNTTFVGTVSTKLGSTISYACPEGNMLVGS--ATRTCKE- 323
            D L  +CQ    +CG P+   N +F G   T L S + Y C EG  L  S  AT  C+E 
Sbjct: 2485 DSLTPLCQ--AVSCGIPESPGNGSFTGNEFT-LDSKVVYECHEGFKLESSQQATAVCQED 2541

Query: 324  GFWT--GVAPTCQYFQLQPMDVPNL-------VLYLFLSKLFRESYERLNVDCGKLEHIE 374
            G W+  G  P C+     P+  P++       V++  +S    E   ++ + C    ++E
Sbjct: 2542 GLWSNKGKPPMCK-----PVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLLSCSPGYYLE 2596

Query: 375  ---------HGTVTLETTR-----------------------TTHGAVAIYACHENYTLI 402
                     +GT  +   R                       T +GA AI+ C+  YTL+
Sbjct: 2597 GWRLLRCQANGTWNIGDERPSCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLV 2656

Query: 403  GETRRVCGDGGKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFILFGS 462
            G   R C   G W+G+E +CL   C  P  I  G ++  G        Y C PGF L G+
Sbjct: 2657 GSHVRECLANGLWSGSETRCLAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGT 2716

Query: 463  NVN-----------------IDCGRLTAIPYGSISYLNETTY-LGSEVLYSCSRNYRLVG 504
            +V                  I CG      +G   + N + + L   V ++C+  Y L G
Sbjct: 2717 SVRICLQDHKWSGQTPVCVPITCGHPGNPAHG---FTNGSEFNLNDVVNFTCNTGYLLQG 2773

Query: 505  HPRRSCLESKVWSDTAPKCEGKATKDIKVCSNVAVDRREIRCPEPTLPAHSILS--VTGN 562
              R  C  +  WS   P C      D     N A+   +   PE      SIL     G 
Sbjct: 2774 VSRAQCRSNGQWSSPLPTCRVVNCSDPGFVEN-AIRHGQQNFPESFEYGMSILYHCKKGF 2832

Query: 563  DRLYGRTLIKTADSASSVATYKIGAL----PTLPAHSIL-------------SVTGNDRL 605
              L    L   A+     +  K  A+    P +PA+++L             S  G++ L
Sbjct: 2833 HLLGSSALTCMANGLWDRSLPKCLAISCGHPGVPANAVLTGELFTYGAVVHYSCRGSESL 2892

Query: 606  YGR-TLIKTADSASSVA--------------------------TYKIGALVKYRCERGYK 638
             G  T +   DS  S A                           +K  +L+++ CE G++
Sbjct: 2893 IGNDTRVCQEDSHWSGALPHCTGNNPGFCGDPGTPAHGSRLGDDFKTKSLLRFSCEMGHQ 2952

Query: 639  VEGEPLSTCEDTGSWSGSVPECIYVDCGNPETVPNGGFTLTSNATYYGTAVLYECDENYR 698
            + G P  TC   GSWSG  P C  V CGNP T P  G  ++S+   + ++V+Y C E Y+
Sbjct: 2953 LRGSPERTCLLNGSWSGLQPVCEAVSCGNPGT-PTNGMIVSSDGILFSSSVIYACWEGYK 3011

Query: 699  LEGHARRLCLENGTWSSGLPTC-----------------------------KGNEGHARR 729
              G   R C  NGTW+   P C                             + N G+   
Sbjct: 3012 TSGLMTRHCTANGTWTGTAPDCTIISCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVME 3071

Query: 730  L-------CLENGTWSSGLPTCKGCKTPKKSLTRPALSCLPGKRFYYHRGI-FRLQNTQK 781
                    C ++G W+   P CK    P+    +     + G  F +   I +   +  +
Sbjct: 3072 AVTSATIRCTKDGRWNPSKPVCKAVLCPQPPPVQNGT--VEGSDFRWGSSISYSCMDGYQ 3129

Query: 782  VSYTR--TCTKRGTWSGHIPTCKAIDCSHPGSIDNGRVIIMNQTTTYNSAVEYHCVPQYQ 839
            +S++   +C  RG W G IP C  + C  PG    GR  +  ++ TY S V + C   + 
Sbjct: 3130 LSHSAILSCEGRGVWKGEIPQCLPVFCGDPGIPAEGR--LSGKSFTYKSEVFFQCKSPFI 3187

Query: 840  RIGPYLRKCMEDGSWSGDEPRC 861
             +G   R C  DG+WSG +P C
Sbjct: 3188 LVGSSRRVCQADGTWSGIQPTC 3209
Potential suppressor of squamous cell carcinomas.
Homo sapiens (taxid: 9606)
>sp|Q923L3|CSMD1_MOUSE CUB and sushi domain-containing protein 1 OS=Mus musculus GN=Csmd1 PE=2 SV=2 Back     alignment and function description
>sp|Q7Z407|CSMD3_HUMAN CUB and sushi domain-containing protein 3 OS=Homo sapiens GN=CSMD3 PE=2 SV=3 Back     alignment and function description
>sp|P0C6B8|SVEP1_RAT Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Rattus norvegicus GN=Svep1 PE=1 SV=1 Back     alignment and function description
>sp|A2AVA0|SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus GN=Svep1 PE=1 SV=1 Back     alignment and function description
>sp|Q80T79|CSMD3_MOUSE CUB and sushi domain-containing protein 3 OS=Mus musculus GN=Csmd3 PE=2 SV=3 Back     alignment and function description
>sp|Q4LDE5|SVEP1_HUMAN Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens GN=SVEP1 PE=1 SV=3 Back     alignment and function description
>sp|Q7Z408|CSMD2_HUMAN CUB and sushi domain-containing protein 2 OS=Homo sapiens GN=CSMD2 PE=1 SV=2 Back     alignment and function description
>sp|P16109|LYAM3_HUMAN P-selectin OS=Homo sapiens GN=SELP PE=1 SV=3 Back     alignment and function description
>sp|P17927|CR1_HUMAN Complement receptor type 1 OS=Homo sapiens GN=CR1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query881
340715485 1109 PREDICTED: sushi, von Willebrand factor 0.877 0.697 0.423 0.0
242022444 1103 furrowed, putative [Pediculus humanus co 0.885 0.707 0.432 0.0
307171953 1097 Sushi, von Willebrand factor type A, EGF 0.878 0.705 0.412 0.0
350396836 1109 PREDICTED: sushi, von Willebrand factor 0.877 0.697 0.423 0.0
307200073 1105 Sushi, von Willebrand factor type A, EGF 0.880 0.702 0.405 0.0
189235439 1087 PREDICTED: similar to C-type lectin, sel 0.875 0.709 0.414 0.0
332026645 1086 Sushi, von Willebrand factor type A, EGF 0.880 0.714 0.399 0.0
345482661 1125 PREDICTED: sushi, von Willebrand factor 0.859 0.672 0.393 0.0
357622670 1119 putative furrowed [Danaus plexippus] 0.853 0.672 0.395 0.0
270004998 1056 hypothetical protein TcasGA2_TC030754 [T 0.849 0.708 0.404 0.0
>gi|340715485|ref|XP_003396243.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Bombus terrestris] Back     alignment and taxonomy information
 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/976 (42%), Positives = 528/976 (54%), Gaps = 203/976 (20%)

Query: 19  GTNVALRRPTNQSSTIRGAPSSNANDGELTTVHDGKRCTETQKEVSPWWQVDLLRPYPIR 78
           GTNVA R+PTNQS+T+RG  +S+ NDG+ +T HDGKRCTETQ E SPWW+VDLL+ Y ++
Sbjct: 73  GTNVAFRKPTNQSTTVRGGDASHGNDGDSSTEHDGKRCTETQSEPSPWWKVDLLKSYSVK 132

Query: 79  IVRITTRGCCGHQPLQDLEIRVGNST-DLQKNPLCAWFPGTL------------------ 119
           +VR+TTRGCCGHQPLQD+EIRVGNS+ +LQ+NPLCAWFPGT+                  
Sbjct: 133 VVRVTTRGCCGHQPLQDIEIRVGNSSVELQRNPLCAWFPGTIEEGITKTFVCARALIGQY 192

Query: 120 ---------GHQPLQDLEIRVGN--STD------LQKNPLCAWFPGTLEEGITK---SFT 159
                    G   L ++E+   +  STD         +   A F  T  E I K   SF 
Sbjct: 193 VFLQLVGVEGSLSLCEVEVFAVDEFSTDRCAYTGTPADADLAAFNSTCYEFIVKKGGSFQ 252

Query: 160 CARTLVGQNVFIQLVGVEGSLSLCEVEIFTTDGELERRKDRLKTLLVWIGAQKDPGITAR 219
            AR          + G +G+ S   V I      LERRKD+LKT LVWIGAQK+P ITAR
Sbjct: 253 EARNYCRTRGGDLVHGFQGAAS---VYILNN---LERRKDKLKTQLVWIGAQKEPLITAR 306

Query: 220 TWKWVDGEVVTKPSWGKDQPNNYNGEQNCVVLDGGRGWLWNDVGCKLDYLHWICQHNPAN 279
           TW+WVDGE+V KPSWGKDQPNNYNGEQNCVVLDGGR WLWNDVGC LDYLHWICQ  P  
Sbjct: 307 TWRWVDGEIVQKPSWGKDQPNNYNGEQNCVVLDGGRSWLWNDVGCNLDYLHWICQSRPPT 366

Query: 280 CGSPDRHVNTTFVGTVSTKLGSTISYACPEGNMLVGSATRTCK-EGFWTGVAPTCQYFQL 338
           CGSP++  NTT +GT  T +GSTI Y CP+G ML+GS +RTC+  GFW+G    C++   
Sbjct: 367 CGSPEKFENTTIIGTKRT-IGSTIEYVCPDGYMLIGSKSRTCQPNGFWSGEPAMCKF--- 422

Query: 339 QPMDVPNLVLYLFLSKLFRESYERLNVDCGKLEHIEHGTVTLETTRTTHGAVAIYACHEN 398
                                     VDCG L  +E+G +TL   RTTHGA+A YAC EN
Sbjct: 423 --------------------------VDCGPLPELENGAITLVNKRTTHGALADYACKEN 456

Query: 399 YTLIGETRRVCGDGGKWNGTEPQCLFDWCAEPPQISGGIVTTSGRRTGSVATYSCEPGFI 458
           YTL+G+ RR CGDGG W+G +PQCLFDWC EPPQI+GG+VTT+G+R GS ATYSC+ GFI
Sbjct: 457 YTLLGDARRRCGDGGIWSGHQPQCLFDWCPEPPQINGGVVTTTGKRAGSTATYSCQNGFI 516

Query: 459 LFGSNV-----------------NIDCGRLTAIPYGSISYLNETTYLGSEVLYSCSRNYR 501
           LFG NV                  +DCG    I +GS++ +N +T + S   Y+C  +Y 
Sbjct: 517 LFGDNVLTCGVGGEWSGKAPQCRFVDCGAPAQIEFGSVTLINGSTTVRSLAAYTCLEDYW 576

Query: 502 LVGHPRRSCLESKVWSDTAPKCEGKATKDIKVCSNVAVDRREIRCPEPTLPAHSILSVTG 561
           LVG  ++ C +   WS   P CE                   I C EP +PA S   V G
Sbjct: 577 LVGEAKQECTKEGKWSHDTPSCE------------------LITCEEPEVPAGSY--VVG 616

Query: 562 NDRLYGRTLIKTADSASSVATYKI-----------GALPTLPAHSILSVTGNDRLYGRTL 610
            D L   + I+    A  +   +            G +PT                G+ L
Sbjct: 617 YD-LNVHSGIEYHCEAGYLLQGETRHTCGRDGEWSGEVPTCEYVDC----------GKVL 665

Query: 611 IKTADSASSV-ATYKIGALVKYRCERGYKVEGEPLSTCEDTGSWSGSVPECIYVDCGNPE 669
                +A  V  T  +G+ + Y C R Y++ G     C D G WS + P+C  + C  P 
Sbjct: 666 PVLNGAAEYVNGTTHLGSEITYSCTRNYRLNGVSRRYCLDNGQWSDATPKCEEIRCPEPI 725

Query: 670 TVPNGGFTLTSNATYYGTAVL----------------------YECDENYRLEGHARRLC 707
              +G  ++T N   YG  ++                      Y C+  Y++ G     C
Sbjct: 726 YAEHGILSVTGNDRMYGRTLIRTGTPENSNTGATSYKIGALAKYRCERGYKVVGEPLSTC 785

Query: 708 LENGTWSSGLP---------------------------------TCKGN---EGHARRLC 731
            +NG WS  +P                                  C GN   +G ARRLC
Sbjct: 786 EDNGKWSGEVPRCVYVDCGKPEHIQHGRYTLTSNATYYGAAALYECDGNFELDGFARRLC 845

Query: 732 LENGTWSSGLPTCKG--CKTPKKS---LTRPALSCLPGKRFYYHRGIFRLQNTQKVSYTR 786
           LENGTWSS  P CK   CK P+K     T+ +   + G   Y     F ++  +    TR
Sbjct: 846 LENGTWSSDTPVCKEIRCKDPEKEGVLSTQVSTHSVGGVAHYSCPRGFYMEGNE----TR 901

Query: 787 TCTKRGTWSGHIPTCKAIDCSHPGSIDNGRVIIMNQTTTYNSAVEYHCVPQYQRIGPYLR 846
            C + G+WSG  P C ++DC HP  I+NGRVI++N +TTY    EYHC+PQY+R+GP+LR
Sbjct: 902 ICLQNGSWSGSTPACFSVDCKHPEPIENGRVIVVNASTTYGGTAEYHCLPQYERVGPFLR 961

Query: 847 KCMEDGSWSGDEPRCE 862
           KC++ GSWSGDEP+CE
Sbjct: 962 KCLDTGSWSGDEPKCE 977

Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242022444|ref|XP_002431650.1| furrowed, putative [Pediculus humanus corporis] gi|212516958|gb|EEB18912.1| furrowed, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307171953|gb|EFN63579.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|350396836|ref|XP_003484683.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307200073|gb|EFN80419.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|189235439|ref|XP_001812859.1| PREDICTED: similar to C-type lectin, selectin-like (AGAP000929-PA) [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332026645|gb|EGI66754.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345482661|ref|XP_001608039.2| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|357622670|gb|EHJ74096.1| putative furrowed [Danaus plexippus] Back     alignment and taxonomy information
>gi|270004998|gb|EFA01446.1| hypothetical protein TcasGA2_TC030754 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query881
FB|FBgn0001083 1174 fw "furrowed" [Drosophila mela 0.355 0.266 0.428 2.1e-146
FB|FBgn0030617 1141 CG9095 [Drosophila melanogaste 0.156 0.120 0.390 7.3e-49
UNIPROTKB|F1Q0A7 3253 SVEP1 "Uncharacterized protein 0.416 0.112 0.282 1.8e-45
MGI|MGI:2386403 3707 Csmd3 "CUB and Sushi multiple 0.392 0.093 0.251 8.1e-33
UNIPROTKB|J9NWK3 3569 SVEP1 "Uncharacterized protein 0.416 0.102 0.282 2.4e-45
UNIPROTKB|J9P1K9 3640 SVEP1 "Uncharacterized protein 0.416 0.100 0.282 2.6e-45
MGI|MGI:1928849 3567 Svep1 "sushi, von Willebrand f 0.522 0.128 0.265 6e-29
UNIPROTKB|F1NE59 3406 SVEP1 "Uncharacterized protein 0.526 0.136 0.280 5.9e-39
UNIPROTKB|F1SND0 3573 SVEP1 "Uncharacterized protein 0.505 0.124 0.270 2.5e-31
MGI|MGI:2137383 3564 Csmd1 "CUB and Sushi multiple 0.382 0.094 0.286 2.5e-42
FB|FBgn0001083 fw "furrowed" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 622 (224.0 bits), Expect = 2.1e-146, Sum P(3) = 2.1e-146
 Identities = 145/338 (42%), Positives = 182/338 (53%)

Query:   193 ELERRKDRLKTLLVWIGAQKDPGITARTWKWVDGEVVTKPSWGKDQPNNYNGEQNCVVLD 252
             ELERRK  LK  LVWIGAQK+PGIT+RTWKWV+G+VV KP+WGKDQPNNYNGEQNCVVLD
Sbjct:   321 ELERRKSELKPQLVWIGAQKEPGITSRTWKWVNGDVVQKPTWGKDQPNNYNGEQNCVVLD 380

Query:   253 GGRGWLWNDVGCKLDYLHWICQHNPANCGSPDRHVNTTFVGTVSTKLGSTISYACPEGNM 312
             GGR WLWNDVGC LDYLH+ICQH+P +CGSPD   NTT +G   T LG  I Y CP+G+ 
Sbjct:   381 GGRNWLWNDVGCNLDYLHFICQHSPLSCGSPDAQQNTTVMGKKFT-LGEKIQYTCPKGHS 439

Query:   313 LVGSATRTCK-EGFWTGVAPTCQYFQLQPMDVPNLVLYLFLSKLFRESYERLNVDCGKLE 371
             L+G   R C+ +G W+G +PTC+Y     +D  +L    F S    E      V      
Sbjct:   440 LLGQTERECRLDGTWSGSSPTCKY-----VDCGSLPELKFGSIHMSEERTSFGVVATYSC 494

Query:   372 HIEHGTVTLETTRTTHGAVAIYACHENYTLIG---ETRRVCGDGGKWNGTEPQCLFDWCA 428
             H E+ T+     RT   A+  ++  +   L+    + + + G   ++N         +  
Sbjct:   495 H-ENYTLIGNENRTC--AMDGWSGKQPECLVDWCPDPQPIAGGDVRFNDKRAGSTATYVC 551

Query:   429 EPPQISGGIVTTSGRRTG--SVATYSCEPGFILFGSNVNIDCGRLTAIPYGSISYLNETT 486
             EP  +  G    S    G  S  T SC      F     +DCG       G    LN TT
Sbjct:   552 EPGYVLVGEAIISCGLGGEWSSKTPSCR-----F-----VDCGAPARPNRGIAILLNGTT 601

Query:   487 YLGSEVLYSCSRNYRLVGHPRRSCLESKVWSDTAPKCE 524
              + S V Y C  ++ L G     C     WS  AP CE
Sbjct:   602 TVNSVVKYECDEDHWLDGQSELYCTREGKWSGEAPVCE 639
GO:0007423 "sensory organ development" evidence=IMP
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
GO:0007155 "cell adhesion" evidence=IEA
GO:0030246 "carbohydrate binding" evidence=ISS
FB|FBgn0030617 CG9095 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q0A7 SVEP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2386403 Csmd3 "CUB and Sushi multiple domains 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|J9NWK3 SVEP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P1K9 SVEP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1928849 Svep1 "sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NE59 SVEP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SND0 SVEP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2137383 Csmd1 "CUB and Sushi multiple domains 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query881
smart00607151 smart00607, FTP, eel-Fucolectin Tachylectin-4 Pent 7e-36
PHA02639295 PHA02639, PHA02639, EEV host range protein; Provis 4e-13
smart0003256 smart00032, CCP, Domain abundant in complement con 8e-13
smart0003256 smart00032, CCP, Domain abundant in complement con 1e-12
cd0003357 cd00033, CCP, Complement control protein (CCP) mod 1e-12
cd0003357 cd00033, CCP, Complement control protein (CCP) mod 3e-12
pfam00059108 pfam00059, Lectin_C, Lectin C-type domain 3e-12
smart0003256 smart00032, CCP, Domain abundant in complement con 5e-12
cd03590126 cd03590, CLECT_DC-SIGN_like, C-type lectin-like do 6e-12
smart0003256 smart00032, CCP, Domain abundant in complement con 2e-11
cd0003357 cd00033, CCP, Complement control protein (CCP) mod 2e-11
pfam0008456 pfam00084, Sushi, Sushi domain (SCR repeat) 3e-11
cd00037116 cd00037, CLECT, C-type lectin (CTL)/C-type lectin- 5e-11
cd0003357 cd00033, CCP, Complement control protein (CCP) mod 8e-11
PHA02927263 PHA02927, PHA02927, secreted complement-binding pr 3e-10
PHA02639295 PHA02639, PHA02639, EEV host range protein; Provis 7e-10
PHA02927263 PHA02927, PHA02927, secreted complement-binding pr 1e-09
PHA02639295 PHA02639, PHA02639, EEV host range protein; Provis 3e-09
pfam0008456 pfam00084, Sushi, Sushi domain (SCR repeat) 5e-09
PHA02927263 PHA02927, PHA02927, secreted complement-binding pr 1e-08
pfam0008456 pfam00084, Sushi, Sushi domain (SCR repeat) 2e-08
smart0003256 smart00032, CCP, Domain abundant in complement con 3e-08
smart00034124 smart00034, CLECT, C-type lectin (CTL) or carbohyd 3e-08
PHA02639295 PHA02639, PHA02639, EEV host range protein; Provis 4e-08
pfam0008456 pfam00084, Sushi, Sushi domain (SCR repeat) 4e-08
cd0003357 cd00033, CCP, Complement control protein (CCP) mod 5e-08
pfam0008456 pfam00084, Sushi, Sushi domain (SCR repeat) 5e-08
cd0003357 cd00033, CCP, Complement control protein (CCP) mod 2e-07
cd03591114 cd03591, CLECT_collectin_like, C-type lectin-like 2e-07
cd03589137 cd03589, CLECT_CEL-1_like, C-type lectin-like doma 6e-07
smart0003256 smart00032, CCP, Domain abundant in complement con 1e-06
PHA02817225 PHA02817, PHA02817, EEV Host range protein; Provis 2e-06
PHA02831268 PHA02831, PHA02831, EEV host range protein; Provis 4e-06
PHA02817225 PHA02817, PHA02817, EEV Host range protein; Provis 9e-06
PHA02817225 PHA02817, PHA02817, EEV Host range protein; Provis 1e-05
cd03594129 cd03594, CLECT_REG-1_like, C-type lectin-like doma 2e-05
PHA02639 295 PHA02639, PHA02639, EEV host range protein; Provis 4e-05
PHA02927263 PHA02927, PHA02927, secreted complement-binding pr 4e-05
pfam0008456 pfam00084, Sushi, Sushi domain (SCR repeat) 1e-04
cd03598117 cd03598, CLECT_EMBP_like, C-type lectin-like domai 1e-04
PHA02639295 PHA02639, PHA02639, EEV host range protein; Provis 2e-04
cd03603118 cd03603, CLECT_VCBS, A bacterial subgroup of the C 0.001
PHA02817 225 PHA02817, PHA02817, EEV Host range protein; Provis 0.002
cd03601119 cd03601, CLECT_TC14_like, C-type lectin-like domai 0.003
pfam00754128 pfam00754, F5_F8_type_C, F5/8 type C domain 0.003
PHA02831268 PHA02831, PHA02831, EEV host range protein; Provis 0.004
>gnl|CDD|128870 smart00607, FTP, eel-Fucolectin Tachylectin-4 Pentaxrin-1 Domain Back     alignment and domain information 
 Score =  132 bits (334), Expect = 7e-36
 Identities = 53/175 (30%), Positives = 72/175 (41%), Gaps = 35/175 (20%)

Query: 19  GTNVALRRPTNQSSTIRGAPS-----SNANDGELTTVHDGKRCTETQKEVSPWWQVDLLR 73
             NVA R P  QS+  RGAP      S A DG   +      C+ T+K  +PWW+VDLL+
Sbjct: 1   QENVAGRGPATQSTYGRGAPPGLSHASAAIDGNRASFTPEGSCSHTEKRSNPWWRVDLLQ 60

Query: 74  PYPIRIVRITTRGCCGHQPLQDLEIRVGNSTDLQKNPLCAWFPGTLGHQPLQDLEIRVGN 133
              I  V IT RG C  + +    I +GNS +                            
Sbjct: 61  YMTIHSVTITNRGDCCGERITGARILIGNSLE---------------------------- 92

Query: 134 STDLQKNPLCAWFPGTLEEGITKSFTCARTLVGQNVFIQLVGVEGSLSLCEVEIF 188
             +   N       G +  G TK+F C   ++G+ V + L     SL LCEVE+ 
Sbjct: 93  --NGGINNPNCSTGGLMAGGETKTFCCPPPMIGRYVTVYLPKPNESLILCEVEVN 145

Length = 151
>gnl|CDD|165022 PHA02639, PHA02639, EEV host range protein; Provisional Back     alignment and domain information
>gnl|CDD|214478 smart00032, CCP, Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR) Back     alignment and domain information
>gnl|CDD|214478 smart00032, CCP, Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR) Back     alignment and domain information
>gnl|CDD|153056 cd00033, CCP, Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system Back     alignment and domain information
>gnl|CDD|153056 cd00033, CCP, Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system Back     alignment and domain information
>gnl|CDD|215684 pfam00059, Lectin_C, Lectin C-type domain Back     alignment and domain information
>gnl|CDD|214478 smart00032, CCP, Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR) Back     alignment and domain information
>gnl|CDD|153060 cd03590, CLECT_DC-SIGN_like, C-type lectin-like domain (CTLD) of the type found in human dendritic cell (DC)-specific intercellular adhesion molecule 3-grabbing non-integrin (DC-SIGN) and the related receptor, DC-SIGN receptor (DC-SIGNR) Back     alignment and domain information
>gnl|CDD|214478 smart00032, CCP, Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR) Back     alignment and domain information
>gnl|CDD|153056 cd00033, CCP, Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system Back     alignment and domain information
>gnl|CDD|215703 pfam00084, Sushi, Sushi domain (SCR repeat) Back     alignment and domain information
>gnl|CDD|153057 cd00037, CLECT, C-type lectin (CTL)/C-type lectin-like (CTLD) domain Back     alignment and domain information
>gnl|CDD|153056 cd00033, CCP, Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system Back     alignment and domain information
>gnl|CDD|222943 PHA02927, PHA02927, secreted complement-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|165022 PHA02639, PHA02639, EEV host range protein; Provisional Back     alignment and domain information
>gnl|CDD|222943 PHA02927, PHA02927, secreted complement-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|165022 PHA02639, PHA02639, EEV host range protein; Provisional Back     alignment and domain information
>gnl|CDD|215703 pfam00084, Sushi, Sushi domain (SCR repeat) Back     alignment and domain information
>gnl|CDD|222943 PHA02927, PHA02927, secreted complement-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|215703 pfam00084, Sushi, Sushi domain (SCR repeat) Back     alignment and domain information
>gnl|CDD|214478 smart00032, CCP, Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR) Back     alignment and domain information
>gnl|CDD|214480 smart00034, CLECT, C-type lectin (CTL) or carbohydrate-recognition domain (CRD) Back     alignment and domain information
>gnl|CDD|165022 PHA02639, PHA02639, EEV host range protein; Provisional Back     alignment and domain information
>gnl|CDD|215703 pfam00084, Sushi, Sushi domain (SCR repeat) Back     alignment and domain information
>gnl|CDD|153056 cd00033, CCP, Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system Back     alignment and domain information
>gnl|CDD|215703 pfam00084, Sushi, Sushi domain (SCR repeat) Back     alignment and domain information
>gnl|CDD|153056 cd00033, CCP, Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system Back     alignment and domain information
>gnl|CDD|153061 cd03591, CLECT_collectin_like, C-type lectin-like domain (CTLD) of the type found in human collectins including lung surfactant proteins A and D, mannose- or mannan binding lectin (MBL), and CL-L1 (collectin liver 1) Back     alignment and domain information
>gnl|CDD|153059 cd03589, CLECT_CEL-1_like, C-type lectin-like domain (CTLD) of the type found in CEL-1 from Cucumaria echinata and Echinoidin from Anthocidaris crassispina Back     alignment and domain information
>gnl|CDD|214478 smart00032, CCP, Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR) Back     alignment and domain information
>gnl|CDD|165167 PHA02817, PHA02817, EEV Host range protein; Provisional Back     alignment and domain information
>gnl|CDD|165176 PHA02831, PHA02831, EEV host range protein; Provisional Back     alignment and domain information
>gnl|CDD|165167 PHA02817, PHA02817, EEV Host range protein; Provisional Back     alignment and domain information
>gnl|CDD|165167 PHA02817, PHA02817, EEV Host range protein; Provisional Back     alignment and domain information
>gnl|CDD|153064 cd03594, CLECT_REG-1_like, C-type lectin-like domain (CTLD) of the type found in Human REG-1 (lithostathine), REG-4, and avian eggshell-specific proteins: ansocalcin, structhiocalcin-1(SCA-1), and -2(SCA-2) Back     alignment and domain information
>gnl|CDD|165022 PHA02639, PHA02639, EEV host range protein; Provisional Back     alignment and domain information
>gnl|CDD|222943 PHA02927, PHA02927, secreted complement-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|215703 pfam00084, Sushi, Sushi domain (SCR repeat) Back     alignment and domain information
>gnl|CDD|153068 cd03598, CLECT_EMBP_like, C-type lectin-like domain (CTLD) of the type found in the human proteins, eosinophil major basic protein (EMBP) and prepro major basic protein homolog (MBPH) Back     alignment and domain information
>gnl|CDD|165022 PHA02639, PHA02639, EEV host range protein; Provisional Back     alignment and domain information
>gnl|CDD|153073 cd03603, CLECT_VCBS, A bacterial subgroup of the C-type lectin-like (CTLD) domain; a subgroup of bacterial protein domains homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins Back     alignment and domain information
>gnl|CDD|165167 PHA02817, PHA02817, EEV Host range protein; Provisional Back     alignment and domain information
>gnl|CDD|153071 cd03601, CLECT_TC14_like, C-type lectin-like domain (CTLD) of the type found in lectins TC14, TC14-2, TC14-3, and TC14-4 from the budding tunicate Polyandrocarpa misakiensis and PfG6 from the Acorn worm Back     alignment and domain information
>gnl|CDD|216100 pfam00754, F5_F8_type_C, F5/8 type C domain Back     alignment and domain information
>gnl|CDD|165176 PHA02831, PHA02831, EEV host range protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 881
PHA02927263 secreted complement-binding protein; Provisional 100.0
PHA02927263 secreted complement-binding protein; Provisional 100.0
smart00607151 FTP eel-Fucolectin Tachylectin-4 Pentaxrin-1 Domai 100.0
PHA02954317 EEV membrane glycoprotein; Provisional 100.0
PHA02954317 EEV membrane glycoprotein; Provisional 100.0
PHA02639295 EEV host range protein; Provisional 99.97
PHA02639295 EEV host range protein; Provisional 99.97
PHA02831268 EEV host range protein; Provisional 99.95
PHA02831268 EEV host range protein; Provisional 99.94
PHA02817225 EEV Host range protein; Provisional 99.84
PHA02817225 EEV Host range protein; Provisional 99.82
cd00057143 FA58C Substituted updates: Jan 31, 2002 99.51
cd03601119 CLECT_TC14_like C-type lectin-like domain (CTLD) o 99.19
PF00754129 F5_F8_type_C: F5/8 type C domain; InterPro: IPR000 99.13
cd0003357 CCP Complement control protein (CCP) modules (aka 99.1
smart0003257 CCP Domain abundant in complement control proteins 99.1
PF0008456 Sushi: Sushi domain (SCR repeat); InterPro: IPR000 99.1
cd03591114 CLECT_collectin_like C-type lectin-like domain (CT 99.09
cd03592115 CLECT_selectins_like C-type lectin-like domain (CT 99.02
cd03603118 CLECT_VCBS A bacterial subgroup of the C-type lect 99.01
cd03589137 CLECT_CEL-1_like C-type lectin-like domain (CTLD) 99.01
cd03598117 CLECT_EMBP_like C-type lectin-like domain (CTLD) o 99.0
PF0008456 Sushi: Sushi domain (SCR repeat); InterPro: IPR000 98.99
cd03588124 CLECT_CSPGs C-type lectin-like domain (CTLD) of th 98.99
cd0003357 CCP Complement control protein (CCP) modules (aka 98.97
cd03596129 CLECT_tetranectin_like C-type lectin-like domain ( 98.97
smart0003257 CCP Domain abundant in complement control proteins 98.95
cd03597129 CLECT_attractin_like C-type lectin-like domain (CT 98.89
cd03590126 CLECT_DC-SIGN_like C-type lectin-like domain (CTLD 98.81
cd03599153 CLECT_DGCR2_like C-type lectin-like domain (CTLD) 98.77
cd03594129 CLECT_REG-1_like C-type lectin-like domain (CTLD) 98.72
cd03600141 CLECT_thrombomodulin_like C-type lectin-like domai 98.71
cd03602108 CLECT_1 C-type lectin (CTL)/C-type lectin-like (CT 98.68
cd03595149 CLECT_chondrolectin_like C-type lectin-like domain 98.67
smart00231139 FA58C Coagulation factor 5/8 C-terminal domain, di 98.51
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 98.48
cd03593116 CLECT_NK_receptors_like C-type lectin-like domain 98.35
PHA02953170 IEV and EEV membrane glycoprotein; Provisional 98.22
smart00034126 CLECT C-type lectin (CTL) or carbohydrate-recognit 98.19
PHA02642216 C-type lectin-like protein; Provisional 97.94
KOG4276|consensus113 97.67
cd00037116 CLECT C-type lectin (CTL)/C-type lectin-like (CTLD 97.41
PF00059105 Lectin_C: Lectin C-type domain; InterPro: IPR00130 97.39
PHA03097157 C-type lectin-like protein; Provisional 97.12
PF07738135 Sad1_UNC: Sad1 / UNC-like C-terminal ; InterPro: I 95.39
cd08366139 APC10 APC10 subunit of the anaphase-promoting comp 93.51
cd08159129 APC10-like APC10-like DOC1 domains in E3 ubiquitin 91.79
cd08667131 APC10-ZZEF1 APC10/DOC1-like domain of uncharacteri 91.13
PF14704152 DERM: Dermatopontin 89.9
KOG3516|consensus 1306 89.12
PHA02867167 C-type lectin protein; Provisional 88.77
smart00136238 LamNT Laminin N-terminal domain (domain VI). N-ter 87.28
PF00055237 Laminin_N: Laminin N-terminal (Domain VI); InterPr 86.0
KOG1094|consensus807 81.79
KOG4350|consensus620 80.31
>PHA02927 secreted complement-binding protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=6.6e-39  Score=338.99  Aligned_cols=236  Identities=27%  Similarity=0.577  Sum_probs=202.5

Q ss_pred             cccccCCCCCcCCCceEEe-----cCCcccCCcEEEEEeCCCcEEe--CcceEEecCCCcccCCCCcccccccCCCCCcC
Q psy11954        362 RLNVDCGKLEHIEHGTVTL-----ETTRTTHGAVAIYACHENYTLI--GETRRVCGDGGKWNGTEPQCLFDWCAEPPQIS  434 (881)
Q Consensus       362 ~~~~~C~~~~~~~nG~~~~-----~~~~~~~g~~~~~~C~~Gy~l~--G~~~~~C~~~G~Ws~~~P~C~~~~C~~p~~~~  434 (881)
                      +..+.|+.|..+.||.+..     ....|.+|++|+|+|++||.++  |..+++|+.+| |+. .|.|+++.|+.|+.+.
T Consensus        16 c~~~~c~~~~~~~~~~~~~~~~~~~~~~y~~g~~v~y~C~~Gy~~~~~g~~~~~C~~~g-Ws~-~p~C~~~~C~~p~~i~   93 (263)
T PHA02927         16 CVLSCCTIPSRPINMKFKNSVETDANANYNIGDTIEYLCLPGYRKQKMGPIYAKCTGTG-WTL-FNQCIKRRCPSPRDID   93 (263)
T ss_pred             HHhccCCCCCcccceeeccccccccCceeCCCCEEEEEeCCCceecCCCccEEEecCCC-CCC-CCcEEeCCCcCCCCCC
Confidence            3448999999999998762     2347899999999999999986  77889999988 995 7999999999888888


Q ss_pred             CCeEEcCCCCCCCeEEEEcCCCceeeCceeeecCCCCCCCCCCceeeccCceecCcEEEEEcCCCcEEcCCCceeeccCC
Q psy11954        435 GGIVTTSGRRTGSVATYSCEPGFILFGSNVNIDCGRLTAIPYGSISYLNETTYLGSEVLYSCSRNYRLVGHPRRSCLESK  514 (881)
Q Consensus       435 ng~~~~~~~~~gs~~~y~C~~Gy~l~g~~~~i~C~~p~~~~nG~~~~~~~~~~~gs~v~y~C~~Gy~L~G~~~~tC~~~G  514 (881)
                      ||.+..                                           ..+.+|++|+|+|++||+|+|...++|+.+|
T Consensus        94 NG~~~~-------------------------------------------~~~~~G~~v~y~C~~Gy~l~G~~~~~C~~~~  130 (263)
T PHA02927         94 NGQLDI-------------------------------------------GGVDFGSSITYSCNSGYQLIGESKSYCELGS  130 (263)
T ss_pred             CCEEeC-------------------------------------------CCccCCCEEEEECCCCCEEcCCCeeEEEeCC
Confidence            876532                                           1245799999999999999999999999753


Q ss_pred             ----cccCCcccccccccccceeccccccccccccCCCCCCCCCeeEEEeccccccCceEEEecCCCCccceeeecCCCC
Q psy11954        515 ----VWSDTAPKCEGKATKDIKVCSNVAVDRREIRCPEPTLPAHSILSVTGNDRLYGRTLIKTADSASSVATYKIGALPT  590 (881)
Q Consensus       515 ----~Ws~~~P~C~~~~~~~~~~~~~~~~~~~~i~C~~p~~~~ng~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~p~  590 (881)
                          +|++.+|.|+                  .+.|+.|+.+.||.+..                               
T Consensus       131 ~g~~~Ws~~~P~C~------------------~~~C~~P~~~~nG~~~~-------------------------------  161 (263)
T PHA02927        131 TGSMVWNPEAPICE------------------SVKCQSPPSISNGRHNG-------------------------------  161 (263)
T ss_pred             CCcceECCCCCccc------------------cccCCCCCCCCCcEEcC-------------------------------
Confidence                7999999999                  78999999999987521                               


Q ss_pred             CCcceeeeeecCCccccceeeeccCCCCCcccccCCCEEEEEcCCCCeecCCCceEecCCCceecCCCeeecccCCCCCC
Q psy11954        591 LPAHSILSVTGNDRLYGRTLIKTADSASSVATYKIGALVKYRCERGYKVEGEPLSTCEDTGSWSGSVPECIYVDCGNPET  670 (881)
Q Consensus       591 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Gs~v~~~C~~GY~l~G~~~~tC~~~G~Ws~~~P~C~~v~C~~p~~  670 (881)
                                                  ....|.+|++|+|+|++||.|.|...++|+ +|+|+. +|+|+++.|+.|. 
T Consensus       162 ----------------------------~~~~y~~g~~v~y~C~~Gy~l~G~~~~~C~-~G~Ws~-~P~C~~v~C~~P~-  210 (263)
T PHA02927        162 ----------------------------YEDFYTDGSVVTYSCNSGYSLIGNSGVLCS-GGEWSD-PPTCQIVKCPHPT-  210 (263)
T ss_pred             ----------------------------CcccccCCCEEEEECCCCCEECCCCeeEEC-CCccCC-CCeEeEeECcCCC-
Confidence                                        013578899999999999999999999998 899997 7999999999875 


Q ss_pred             CCCceEEec-CCCeecCcEEEEEcCCCceecCCceeeeccCCcccCCCCceee
Q psy11954        671 VPNGGFTLT-SNATYYGTAVLYECDENYRLEGHARRLCLENGTWSSGLPTCKG  722 (881)
Q Consensus       671 ~~nG~~~~~-~~~~~~g~~v~y~C~~Gy~L~G~~~~~C~~~G~Ws~~~P~C~~  722 (881)
                      +.||.+... ...|.+|++|+|+|++||+|.|+++++|+++|+|++++|+|.+
T Consensus       211 i~ng~~~~~~k~~y~~g~~v~y~C~~Gy~l~G~~~~~C~~~g~Ws~~~P~C~~  263 (263)
T PHA02927        211 ISNGYLSSGFKRSYSYNDNVDFKCKYGYKLSGSSSSTCSPGNTWQPELPKCVR  263 (263)
T ss_pred             CCCCEEecCCCCccccCCEEEEECCCCCeEcCCCCeEECCCCEECCCCCeecC
Confidence            778988643 3457799999999999999999999999999999999999963

>PHA02927 secreted complement-binding protein; Provisional Back     alignment and domain information
>smart00607 FTP eel-Fucolectin Tachylectin-4 Pentaxrin-1 Domain Back     alignment and domain information
>PHA02954 EEV membrane glycoprotein; Provisional Back     alignment and domain information
>PHA02954 EEV membrane glycoprotein; Provisional Back     alignment and domain information
>PHA02639 EEV host range protein; Provisional Back     alignment and domain information
>PHA02639 EEV host range protein; Provisional Back     alignment and domain information
>PHA02831 EEV host range protein; Provisional Back     alignment and domain information
>PHA02831 EEV host range protein; Provisional Back     alignment and domain information
>PHA02817 EEV Host range protein; Provisional Back     alignment and domain information
>PHA02817 EEV Host range protein; Provisional Back     alignment and domain information
>cd00057 FA58C Substituted updates: Jan 31, 2002 Back     alignment and domain information
>cd03601 CLECT_TC14_like C-type lectin-like domain (CTLD) of the type found in lectins TC14, TC14-2, TC14-3, and TC14-4 from the budding tunicate Polyandrocarpa misakiensis and PfG6 from the Acorn worm Back     alignment and domain information
>PF00754 F5_F8_type_C: F5/8 type C domain; InterPro: IPR000421 Blood coagulation factors V and VIII contain a C-terminal, twice repeated, domain of about 150 amino acids, which is called F5/8 type C, FA58C, or C1/C2- like domain Back     alignment and domain information
>cd00033 CCP Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system Back     alignment and domain information
>smart00032 CCP Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR) Back     alignment and domain information
>PF00084 Sushi: Sushi domain (SCR repeat); InterPro: IPR000436 Sushi domains are also known as Complement control protein (CCP) modules, or short consensus repeats (SCR), exist in a wide variety of complement and adhesion proteins Back     alignment and domain information
>cd03591 CLECT_collectin_like C-type lectin-like domain (CTLD) of the type found in human collectins including lung surfactant proteins A and D, mannose- or mannan binding lectin (MBL), and CL-L1 (collectin liver 1) Back     alignment and domain information
>cd03592 CLECT_selectins_like C-type lectin-like domain (CTLD) of the type found in the type 1 transmembrane proteins: P(platlet)-, E(endothelial)-, and L(leukocyte)- selectins (sels) Back     alignment and domain information
>cd03603 CLECT_VCBS A bacterial subgroup of the C-type lectin-like (CTLD) domain; a subgroup of bacterial protein domains homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins Back     alignment and domain information
>cd03589 CLECT_CEL-1_like C-type lectin-like domain (CTLD) of the type found in CEL-1 from Cucumaria echinata and Echinoidin from Anthocidaris crassispina Back     alignment and domain information
>cd03598 CLECT_EMBP_like C-type lectin-like domain (CTLD) of the type found in the human proteins, eosinophil major basic protein (EMBP) and prepro major basic protein homolog (MBPH) Back     alignment and domain information
>PF00084 Sushi: Sushi domain (SCR repeat); InterPro: IPR000436 Sushi domains are also known as Complement control protein (CCP) modules, or short consensus repeats (SCR), exist in a wide variety of complement and adhesion proteins Back     alignment and domain information
>cd03588 CLECT_CSPGs C-type lectin-like domain (CTLD) of the type found in chondroitin sulfate proteoglycan core proteins Back     alignment and domain information
>cd00033 CCP Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system Back     alignment and domain information
>cd03596 CLECT_tetranectin_like C-type lectin-like domain (CTLD) of the type found in the tetranectin (TN), cartilage derived C-type lectin (CLECSF1), and stem cell growth factor (SCGF) Back     alignment and domain information
>smart00032 CCP Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR) Back     alignment and domain information
>cd03597 CLECT_attractin_like C-type lectin-like domain (CTLD) of the type found in human and mouse attractin (AtrN) and attractin-like protein (ALP) Back     alignment and domain information
>cd03590 CLECT_DC-SIGN_like C-type lectin-like domain (CTLD) of the type found in human dendritic cell (DC)-specific intercellular adhesion molecule 3-grabbing non-integrin (DC-SIGN) and the related receptor, DC-SIGN receptor (DC-SIGNR) Back     alignment and domain information
>cd03599 CLECT_DGCR2_like C-type lectin-like domain (CTLD) of the type found in DGCR2, an integral membrane protein deleted in DiGeorge Syndrome (DGS) Back     alignment and domain information
>cd03594 CLECT_REG-1_like C-type lectin-like domain (CTLD) of the type found in Human REG-1 (lithostathine), REG-4, and avian eggshell-specific proteins: ansocalcin, structhiocalcin-1(SCA-1), and -2(SCA-2) Back     alignment and domain information
>cd03600 CLECT_thrombomodulin_like C-type lectin-like domain (CTLD) of the type found in human thrombomodulin(TM), Endosialin, C14orf27, and C1qR Back     alignment and domain information
>cd03602 CLECT_1 C-type lectin (CTL)/C-type lectin-like (CTLD) domain subgroup 1; a subgroup of protein domains homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins Back     alignment and domain information
>cd03595 CLECT_chondrolectin_like C-type lectin-like domain (CTLD) of the type found in the human type-1A transmembrane proteins chondrolectin (CHODL) and layilin Back     alignment and domain information
>smart00231 FA58C Coagulation factor 5/8 C-terminal domain, discoidin domain Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>cd03593 CLECT_NK_receptors_like C-type lectin-like domain (CTLD) of the type found in natural killer cell receptors (NKRs) Back     alignment and domain information
>PHA02953 IEV and EEV membrane glycoprotein; Provisional Back     alignment and domain information
>smart00034 CLECT C-type lectin (CTL) or carbohydrate-recognition domain (CRD) Back     alignment and domain information
>PHA02642 C-type lectin-like protein; Provisional Back     alignment and domain information
>KOG4276|consensus Back     alignment and domain information
>cd00037 CLECT C-type lectin (CTL)/C-type lectin-like (CTLD) domain Back     alignment and domain information
>PF00059 Lectin_C: Lectin C-type domain; InterPro: IPR001304 Lectins occur in plants, animals, bacteria and viruses Back     alignment and domain information
>PHA03097 C-type lectin-like protein; Provisional Back     alignment and domain information
>PF07738 Sad1_UNC: Sad1 / UNC-like C-terminal ; InterPro: IPR012919 The Caenorhabditis elegans UNC-84 protein is a nuclear envelope protein that is involved in nuclear anchoring and migration during development Back     alignment and domain information
>cd08366 APC10 APC10 subunit of the anaphase-promoting complex (APC) that mediates substrate ubiquitination Back     alignment and domain information
>cd08159 APC10-like APC10-like DOC1 domains in E3 ubiquitin ligases that mediate substrate ubiquitination Back     alignment and domain information
>cd08667 APC10-ZZEF1 APC10/DOC1-like domain of uncharacterized Zinc finger ZZ-type and EF-hand domain-containing protein 1 (ZZEF1) and homologs Back     alignment and domain information
>PF14704 DERM: Dermatopontin Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information
>PHA02867 C-type lectin protein; Provisional Back     alignment and domain information
>smart00136 LamNT Laminin N-terminal domain (domain VI) Back     alignment and domain information
>PF00055 Laminin_N: Laminin N-terminal (Domain VI); InterPro: IPR008211 Laminin is a large molecular weight glycoprotein present only in basement membranes in almost every animal tissue Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query881
2q7z_A 1931 Solution Structure Of The 30 Scr Domains Of Human C 9e-25
2q7z_A 1931 Solution Structure Of The 30 Scr Domains Of Human C 5e-20
2q7z_A 1931 Solution Structure Of The 30 Scr Domains Of Human C 1e-13
2gsx_A951 Complement Receptor Type 2 Length = 951 1e-21
2gsx_A 951 Complement Receptor Type 2 Length = 951 5e-20
2gsx_A 951 Complement Receptor Type 2 Length = 951 7e-20
2gsx_A 951 Complement Receptor Type 2 Length = 951 6e-08
1haq_A 1213 Four Models Of Human Factor H Determined By Solutio 1e-14
1haq_A 1213 Four Models Of Human Factor H Determined By Solutio 1e-09
3gau_A 1213 Solution Structure Of Human Complement Factor H In 1e-14
3gau_A 1213 Solution Structure Of Human Complement Factor H In 1e-09
3cqo_A293 Crystal Structure Of A F-Lectin (Fucolectin) From M 3e-13
1k12_A158 Fucose Binding Lectin Length = 158 3e-12
1ntj_A320 Model Of Rat Crry Determined By Solution Scattering 9e-12
1ntj_A320 Model Of Rat Crry Determined By Solution Scattering 7e-11
1ntl_A551 Model Of Mouse Crry-Ig Determined By Solution Scatt 1e-11
1ntl_A 551 Model Of Mouse Crry-Ig Determined By Solution Scatt 2e-10
3o8e_B252 Structure Of Extracelllar Portion Of Cd46 In Comple 1e-11
3o8e_B252 Structure Of Extracelllar Portion Of Cd46 In Comple 3e-06
3iyp_F381 The Interaction Of Decay-Accelerating Factor With E 2e-11
2xrb_A290 Structure Of The N-Terminal Four Domains Of The Com 8e-11
2c8i_E316 Complex Of Echovirus Type 12 With Domains 1, 2, 3 A 1e-10
1ojv_A254 Decay Accelerating Factor (Cd55): The Structure Of 2e-10
1ok3_A254 Decay Accelerating Factor (cd55): The Structure Of 2e-10
2wii_C277 Complement C3b In Complex With Factor H Domains 1-4 4e-10
2wii_C277 Complement C3b In Complex With Factor H Domains 1-4 3e-04
2qfg_A312 Solution Structure Of The N-Terminal Scr-15 FRAGMEN 7e-10
2qfg_A 312 Solution Structure Of The N-Terminal Scr-15 FRAGMEN 4e-04
1c1z_A326 Crystal Structure Of Human Beta-2-Glycoprotein-I (A 7e-09
1c1z_A326 Crystal Structure Of Human Beta-2-Glycoprotein-I (A 2e-08
1qub_A319 Crystal Structure Of The Glycosylated Five-domain H 1e-08
1qub_A319 Crystal Structure Of The Glycosylated Five-domain H 2e-08
1m11_R243 Structural Model Of Human Decay-accelerating Factor 1e-08
3erb_A223 The Crystal Structure Of C2b, A Fragment Of Complem 2e-08
3erb_A223 The Crystal Structure Of C2b, A Fragment Of Complem 4e-05
4igd_A 406 Crystal Structure Of The Zymogen Catalytic Region O 7e-08
3gov_A155 Crystal Structure Of The Catalytic Region Of Human 8e-08
1nwv_A129 Solution Structure Of A Functionally Active Compone 1e-07
2rlq_A129 Nmr Structure Of Ccp Modules 2-3 Of Complement Fact 2e-07
1g40_A244 Crystal Structure Of A Complement Protein That Regu 2e-07
1g40_A244 Crystal Structure Of A Complement Protein That Regu 2e-06
1g40_A244 Crystal Structure Of A Complement Protein That Regu 4e-06
2rlp_A129 Nmr Structure Of Ccp Modules 1-2 Of Complement Fact 2e-07
1h04_P125 Human Cd55 Domains 3 & 4 Length = 125 4e-07
1h2p_P125 Human Cd55 Domains 3 & 4 Length = 125 6e-07
1h2p_P125 Human Cd55 Domains 3 & 4 Length = 125 4e-04
2ok5_A 752 Human Complement Factor B Length = 752 6e-07
2ok5_A 752 Human Complement Factor B Length = 752 3e-06
1upn_E129 Complex Of Echovirus Type 12 With Domains 3 And 4 O 6e-07
1upn_E129 Complex Of Echovirus Type 12 With Domains 3 And 4 O 4e-04
2xwb_F 732 Crystal Structure Of Complement C3b In Complex With 6e-07
2xwb_F 732 Crystal Structure Of Complement C3b In Complex With 3e-06
3hrz_D 741 Cobra Venom Factor (Cvf) In Complex With Human Fact 6e-07
3hrz_D 741 Cobra Venom Factor (Cvf) In Complex With Human Fact 3e-06
1h03_P125 Human Cd55 Domains 3 & 4 Length = 125 7e-07
1h03_P125 Human Cd55 Domains 3 & 4 Length = 125 4e-04
1gkg_A136 Structure Determination And Rational Mutagenesis Re 7e-07
1hfh_A120 Solution Structure Of A Pair Of Complement Modules 9e-07
1e5g_A120 Solution Structure Of Central Cp Module Pair Of A P 1e-06
2qfh_A333 Solution Structure Of The C-Terminal Scr-1620 FRAGM 1e-06
2qfh_A333 Solution Structure Of The C-Terminal Scr-1620 FRAGM 6e-06
2qy0_A159 Active Dimeric Structure Of The Catalytic Domain Of 2e-06
1gpz_A 399 The Crystal Structure Of The Zymogen Catalytic Doma 3e-06
1gpz_A 399 The Crystal Structure Of The Zymogen Catalytic Doma 6e-04
2aty_A376 Complement Receptor Chimaeric Conjugate Cr2-Ig Leng 8e-06
1zjk_A403 Crystal Structure Of The Zymogen Catalytic Region O 9e-06
1zjk_A 403 Crystal Structure Of The Zymogen Catalytic Region O 2e-05
4fxg_G154 Complement C4 In Complex With Masp-2 Length = 154 1e-05
4fxg_G154 Complement C4 In Complex With Masp-2 Length = 154 3e-05
1w2r_A142 Solution Structure Of Cr2 Scr 1-2 By X-Ray Scatteri 1e-05
1ghq_B134 Cr2-C3d Complex Structure Length = 134 1e-05
3oed_C135 The Structure Of The Complex Between Complement Rec 2e-05
1ly2_A130 Crystal Structure Of Unliganded Human Cd21 Scr1-Scr 2e-05
1gkn_A128 Structure Determination And Rational Mutagenesis Re 2e-05
2xr5_A166 Crystal Structure Of The Complex Of The Carbohydrat 9e-05
2b6b_D175 Cryo Em Structure Of Dengue Complexed With Crd Of D 1e-04
1k9i_A156 Complex Of Dc-Sign And Glcnac2man3 Length = 156 1e-04
1sl4_A155 Crystal Structure Of Dc-Sign Carbohydrate Recogniti 1e-04
4b2s_A127 Solution Structure Of Ccp Modules 11-12 Of Compleme 1e-04
1egg_A147 Structure Of A C-Type Carbohydrate-Recognition Doma 5e-04
4gwi_A153 His 62 Mutant Of The Lectin Binding Domain Of Lecti 6e-04
2xr6_A170 Crystal Structure Of The Complex Of The Carbohydrat 8e-04
>pdb|2Q7Z|A Chain A, Solution Structure Of The 30 Scr Domains Of Human Complement Receptor 1 Length = 1931 Back     alignment and structure 
Iteration: 1

 Score =  112 bits (280), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 165/714 (23%), Positives = 249/714 (34%), Gaps = 171/714 (23%)
Query: 266  LDYLHW-----ICQHNPANCGSPDRHVNTTFVGTVSTKLGSTISYACPEGNMLVGSATRT 320
            LD L W     +C+    +C +P   VN         ++GS I+Y+C  G+ L+G ++  
Sbjct: 496  LDNLVWSSPKDVCKRK--SCKTPPDPVNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAE 553
Query: 321  C----KEGFWTGVAPTCQYFQLQPMDVPNLVLYLFLSKLFRESYERLNVDCGKLEHIEHG 376
            C        W+   P CQ                              + CG    I +G
Sbjct: 554  CILSGNAAHWSTKPPICQ-----------------------------RIPCGLPPTIANG 584
Query: 377  TVTLETTRTTH-GAVAIYACHEN------YTLIGETRRVCGDG----GKWNGTEPQCLFD 425
                      H G+V  Y C+        + L+GE    C       G W+G  PQC+  
Sbjct: 585  DFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCIIP 644
Query: 426  WCAEPPQISGGIVTTSGRRTGS---VATYSCEPGFILFGSN------VN------IDCGR 470
                PP +  GI+ +  R   S   V  + C+PGF++ G        +N        C R
Sbjct: 645  NKCTPPNVENGILVSDNRSLFSLNEVVEFRCQPGFVMKGPRRVKCQALNKWEPELPSCSR 704
Query: 471  LTAIP----YGSISYLNETTY-LGSEVLYSCSRNYRLVGHPRRSCLESKVWSDTAPKCEG 525
            +   P    +   +  ++  +  G EV YSC   Y L G     C     WS  AP CE 
Sbjct: 705  VCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGYDLRGAASMRCTPQGDWSPAAPTCEV 764
Query: 526  KATKDIKVCSNVAVDRREIRCPEPTLPAHSILSVTGNDRLYGRT----LIKTADSA--SS 579
            K+  D        ++ R +      L A          +L G +    ++   +S   SS
Sbjct: 765  KSCDDFM---GQLLNGRVLFPVNLQLGAKVDFVCDEGFQLKGSSASYCVLAGMESLWNSS 821
Query: 580  VATYKIGALPTLPAHSILSVTGNDRLYGRTLIKTADSASSVATYKIGALVKYRC----ER 635
            V   +    P+ P      V  N R  G+ L            +  G  V Y C    +R
Sbjct: 822  VPVCEQIFCPSPP------VIPNGRHTGKPL----------EVFPFGKAVNYTCDPHPDR 865
Query: 636  G--YKVEGEPLSTC----EDTGSWSGSVPEC-IYVDCGNPETVPNGGFTLTSNATYY--G 686
            G  + + GE    C    +  G WS   P C I   C  P+          +NA+ +  G
Sbjct: 866  GTSFDLIGESTIRCTSDPQGNGVWSSPAPRCGILGHCQAPDHFLFAKLKTQTNASDFPIG 925
Query: 687  TAVLYECDENYRLEGHARRL---CLENGTWSSGLPTCKGNE------------------- 724
            T++ YEC    R E + R     CL+N  WSS    CK                      
Sbjct: 926  TSLKYEC----RPEYYGRPFSITCLDNLVWSSPKDVCKRKSCKTPPDPVNGMVHVITDIQ 981
Query: 725  ----------------GHARRLCLENGT---WSSGLPTCK--GCKTPKKSLTRPALSCLP 763
                            GH+   C+ +G    WS+  P C+   C  P        +S   
Sbjct: 982  VGSRINYSCTTGHRLIGHSSAECILSGNTAHWSTKPPICQRIPCGLPPTIANGDFIS-TN 1040
Query: 764  GKRFYY-------------HRGIFRLQNTQKVSYTRTCTKRGTWSGHIPTCKAIDCSHPG 810
             + F+Y              R +F L     +  T    + G WSG  P C   +   P 
Sbjct: 1041 RENFHYGSVVTYRCNLGSRGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCIIPNKCTPP 1100
Query: 811  SIDNGRVIIMNQTT-TYNSAVEYHCVPQYQRIGPYLRKCMEDGSWSGDEPRCEK 863
            +++NG ++  N++  + N  VE+ C P +   GP   KC     W  + P C +
Sbjct: 1101 NVENGILVSDNRSLFSLNEVVEFRCQPGFVMKGPRRVKCQALNKWEPELPSCSR 1154
>pdb|2Q7Z|A Chain A, Solution Structure Of The 30 Scr Domains Of Human Complement Receptor 1 Length = 1931 Back     alignment and structure
>pdb|2Q7Z|A Chain A, Solution Structure Of The 30 Scr Domains Of Human Complement Receptor 1 Length = 1931 Back     alignment and structure
>pdb|2GSX|A Chain A, Complement Receptor Type 2 Length = 951 Back     alignment and structure
>pdb|2GSX|A Chain A, Complement Receptor Type 2 Length = 951 Back     alignment and structure
>pdb|2GSX|A Chain A, Complement Receptor Type 2 Length = 951 Back     alignment and structure
>pdb|2GSX|A Chain A, Complement Receptor Type 2 Length = 951 Back     alignment and structure
>pdb|1HAQ|A Chain A, Four Models Of Human Factor H Determined By Solution Scattering Curve-Fitting And Homology Modelling Length = 1213 Back     alignment and structure
>pdb|1HAQ|A Chain A, Four Models Of Human Factor H Determined By Solution Scattering Curve-Fitting And Homology Modelling Length = 1213 Back     alignment and structure
>pdb|3GAU|A Chain A, Solution Structure Of Human Complement Factor H In 50 Mm Nacl Buffer Length = 1213 Back     alignment and structure
>pdb|3GAU|A Chain A, Solution Structure Of Human Complement Factor H In 50 Mm Nacl Buffer Length = 1213 Back     alignment and structure
>pdb|3CQO|A Chain A, Crystal Structure Of A F-Lectin (Fucolectin) From Morone Saxatilis (Striped Bass) Serum Length = 293 Back     alignment and structure
>pdb|1K12|A Chain A, Fucose Binding Lectin Length = 158 Back     alignment and structure
>pdb|1NTJ|A Chain A, Model Of Rat Crry Determined By Solution Scattering, Curve Fitting And Homology Modelling Length = 320 Back     alignment and structure
>pdb|1NTJ|A Chain A, Model Of Rat Crry Determined By Solution Scattering, Curve Fitting And Homology Modelling Length = 320 Back     alignment and structure
>pdb|1NTL|A Chain A, Model Of Mouse Crry-Ig Determined By Solution Scattering, Curve Fitting And Homology Modelling Length = 551 Back     alignment and structure
>pdb|1NTL|A Chain A, Model Of Mouse Crry-Ig Determined By Solution Scattering, Curve Fitting And Homology Modelling Length = 551 Back     alignment and structure
>pdb|3O8E|B Chain B, Structure Of Extracelllar Portion Of Cd46 In Complex With Adenovirus Type 11 Knob Length = 252 Back     alignment and structure
>pdb|3O8E|B Chain B, Structure Of Extracelllar Portion Of Cd46 In Complex With Adenovirus Type 11 Knob Length = 252 Back     alignment and structure
>pdb|3IYP|F Chain F, The Interaction Of Decay-Accelerating Factor With Echovirus 7 Length = 381 Back     alignment and structure
>pdb|2XRB|A Chain A, Structure Of The N-Terminal Four Domains Of The Complement Regulator Rat Crry Length = 290 Back     alignment and structure
>pdb|1OJV|A Chain A, Decay Accelerating Factor (Cd55): The Structure Of An Intact Human Complement Regulator. Length = 254 Back     alignment and structure
>pdb|1OK3|A Chain A, Decay Accelerating Factor (cd55): The Structure Of An Intact Human Complement Regulator. Length = 254 Back     alignment and structure
>pdb|2WII|C Chain C, Complement C3b In Complex With Factor H Domains 1-4 Length = 277 Back     alignment and structure
>pdb|2WII|C Chain C, Complement C3b In Complex With Factor H Domains 1-4 Length = 277 Back     alignment and structure
>pdb|2QFG|A Chain A, Solution Structure Of The N-Terminal Scr-15 FRAGMENT OF Complement Factor H Length = 312 Back     alignment and structure
>pdb|2QFG|A Chain A, Solution Structure Of The N-Terminal Scr-15 FRAGMENT OF Complement Factor H Length = 312 Back     alignment and structure
>pdb|1C1Z|A Chain A, Crystal Structure Of Human Beta-2-Glycoprotein-I (Apolipoprotein-H) Length = 326 Back     alignment and structure
>pdb|1C1Z|A Chain A, Crystal Structure Of Human Beta-2-Glycoprotein-I (Apolipoprotein-H) Length = 326 Back     alignment and structure
>pdb|1QUB|A Chain A, Crystal Structure Of The Glycosylated Five-domain Human Beta2- Glycoprotein I Purified From Blood Plasma Length = 319 Back     alignment and structure
>pdb|1QUB|A Chain A, Crystal Structure Of The Glycosylated Five-domain Human Beta2- Glycoprotein I Purified From Blood Plasma Length = 319 Back     alignment and structure
>pdb|1M11|R Chain R, Structural Model Of Human Decay-accelerating Factor Bound To Echovirus 7 From Cryo-electron Microscopy Length = 243 Back     alignment and structure
>pdb|3ERB|A Chain A, The Crystal Structure Of C2b, A Fragment Of Complement Component C2 Produced During C3-Convertase Formation Length = 223 Back     alignment and structure
>pdb|3ERB|A Chain A, The Crystal Structure Of C2b, A Fragment Of Complement Component C2 Produced During C3-Convertase Formation Length = 223 Back     alignment and structure
>pdb|4IGD|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-1 Length = 406 Back     alignment and structure
>pdb|3GOV|A Chain A, Crystal Structure Of The Catalytic Region Of Human Masp-1 Length = 155 Back     alignment and structure
>pdb|1NWV|A Chain A, Solution Structure Of A Functionally Active Component Of Decay Accelerating Factor Length = 129 Back     alignment and structure
>pdb|2RLQ|A Chain A, Nmr Structure Of Ccp Modules 2-3 Of Complement Factor H Length = 129 Back     alignment and structure
>pdb|1G40|A Chain A, Crystal Structure Of A Complement Protein That Regulates Both Pathways Of Complement Activation And Binds Heparan Sulfate Proteoglycans Length = 244 Back     alignment and structure
>pdb|1G40|A Chain A, Crystal Structure Of A Complement Protein That Regulates Both Pathways Of Complement Activation And Binds Heparan Sulfate Proteoglycans Length = 244 Back     alignment and structure
>pdb|1G40|A Chain A, Crystal Structure Of A Complement Protein That Regulates Both Pathways Of Complement Activation And Binds Heparan Sulfate Proteoglycans Length = 244 Back     alignment and structure
>pdb|2RLP|A Chain A, Nmr Structure Of Ccp Modules 1-2 Of Complement Factor H Length = 129 Back     alignment and structure
>pdb|1H04|P Chain P, Human Cd55 Domains 3 & 4 Length = 125 Back     alignment and structure
>pdb|1H2P|P Chain P, Human Cd55 Domains 3 & 4 Length = 125 Back     alignment and structure
>pdb|1H2P|P Chain P, Human Cd55 Domains 3 & 4 Length = 125 Back     alignment and structure
>pdb|2OK5|A Chain A, Human Complement Factor B Length = 752 Back     alignment and structure
>pdb|2OK5|A Chain A, Human Complement Factor B Length = 752 Back     alignment and structure
>pdb|1UPN|E Chain E, Complex Of Echovirus Type 12 With Domains 3 And 4 Of Its Receptor Decay Accelerating Factor (Cd55) By Cryo Electron Microscopy At 16 A Length = 129 Back     alignment and structure
>pdb|1UPN|E Chain E, Complex Of Echovirus Type 12 With Domains 3 And 4 Of Its Receptor Decay Accelerating Factor (Cd55) By Cryo Electron Microscopy At 16 A Length = 129 Back     alignment and structure
>pdb|2XWB|F Chain F, Crystal Structure Of Complement C3b In Complex With Factors B And D Length = 732 Back     alignment and structure
>pdb|2XWB|F Chain F, Crystal Structure Of Complement C3b In Complex With Factors B And D Length = 732 Back     alignment and structure
>pdb|3HRZ|D Chain D, Cobra Venom Factor (Cvf) In Complex With Human Factor B Length = 741 Back     alignment and structure
>pdb|3HRZ|D Chain D, Cobra Venom Factor (Cvf) In Complex With Human Factor B Length = 741 Back     alignment and structure
>pdb|1H03|P Chain P, Human Cd55 Domains 3 & 4 Length = 125 Back     alignment and structure
>pdb|1H03|P Chain P, Human Cd55 Domains 3 & 4 Length = 125 Back     alignment and structure
>pdb|1GKG|A Chain A, Structure Determination And Rational Mutagenesis Reveal Binding Surface Of Immune Adherence Receptor, Cr1 (Cd35) Length = 136 Back     alignment and structure
>pdb|1HFH|A Chain A, Solution Structure Of A Pair Of Complement Modules By Nuclear Magnetic Resonance Length = 120 Back     alignment and structure
>pdb|1E5G|A Chain A, Solution Structure Of Central Cp Module Pair Of A Pox Virus Complement Inhibitor Length = 120 Back     alignment and structure
>pdb|2QFH|A Chain A, Solution Structure Of The C-Terminal Scr-1620 FRAGMENT OF Complement Factor H Length = 333 Back     alignment and structure
>pdb|2QFH|A Chain A, Solution Structure Of The C-Terminal Scr-1620 FRAGMENT OF Complement Factor H Length = 333 Back     alignment and structure
>pdb|2QY0|A Chain A, Active Dimeric Structure Of The Catalytic Domain Of C1r Reveals Enzyme-product Like Contacts Length = 159 Back     alignment and structure
>pdb|1GPZ|A Chain A, The Crystal Structure Of The Zymogen Catalytic Domain Of Complement Protease C1r Length = 399 Back     alignment and structure
>pdb|1GPZ|A Chain A, The Crystal Structure Of The Zymogen Catalytic Domain Of Complement Protease C1r Length = 399 Back     alignment and structure
>pdb|2ATY|A Chain A, Complement Receptor Chimaeric Conjugate Cr2-Ig Length = 376 Back     alignment and structure
>pdb|1ZJK|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-2 Length = 403 Back     alignment and structure
>pdb|1ZJK|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-2 Length = 403 Back     alignment and structure
>pdb|4FXG|G Chain G, Complement C4 In Complex With Masp-2 Length = 154 Back     alignment and structure
>pdb|4FXG|G Chain G, Complement C4 In Complex With Masp-2 Length = 154 Back     alignment and structure
>pdb|1W2R|A Chain A, Solution Structure Of Cr2 Scr 1-2 By X-Ray Scattering Length = 142 Back     alignment and structure
>pdb|1GHQ|B Chain B, Cr2-C3d Complex Structure Length = 134 Back     alignment and structure
>pdb|3OED|C Chain C, The Structure Of The Complex Between Complement Receptor Cr2 And Its Ligand Complement Fragment C3d Length = 135 Back     alignment and structure
>pdb|1LY2|A Chain A, Crystal Structure Of Unliganded Human Cd21 Scr1-Scr2 (Complement Receptor Type 2) Length = 130 Back     alignment and structure
>pdb|1GKN|A Chain A, Structure Determination And Rational Mutagenesis Reveal Binding Surface Of Immune Adherence Receptor, Cr1 (Cd35) Length = 128 Back     alignment and structure
>pdb|2XR5|A Chain A, Crystal Structure Of The Complex Of The Carbohydrate Recognition Domain Of Human Dc-Sign With Pseudo Dimannoside Mimic Length = 166 Back     alignment and structure
>pdb|2B6B|D Chain D, Cryo Em Structure Of Dengue Complexed With Crd Of Dc-Sign Length = 175 Back     alignment and structure
>pdb|1K9I|A Chain A, Complex Of Dc-Sign And Glcnac2man3 Length = 156 Back     alignment and structure
>pdb|1SL4|A Chain A, Crystal Structure Of Dc-Sign Carbohydrate Recognition Domain Complexed With Man4 Length = 155 Back     alignment and structure
>pdb|4B2S|A Chain A, Solution Structure Of Ccp Modules 11-12 Of Complement Factor H Length = 127 Back     alignment and structure
>pdb|1EGG|A Chain A, Structure Of A C-Type Carbohydrate-Recognition Domain (Crd- 4) From The Macrophage Mannose Receptor Length = 147 Back     alignment and structure
>pdb|4GWI|A Chain A, His 62 Mutant Of The Lectin Binding Domain Of Lectinolysin Complexed With Lewis Y Length = 153 Back     alignment and structure
>pdb|2XR6|A Chain A, Crystal Structure Of The Complex Of The Carbohydrate Recognition Domain Of Human Dc-Sign With Pseudo Trimannoside Mimic Length = 170 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query881
2gsx_A 951 Complement receptor type 2; SCR domain, CCP domain 4e-70
2gsx_A951 Complement receptor type 2; SCR domain, CCP domain 3e-68
2gsx_A 951 Complement receptor type 2; SCR domain, CCP domain 6e-66
2gsx_A 951 Complement receptor type 2; SCR domain, CCP domain 4e-62
2gsx_A 951 Complement receptor type 2; SCR domain, CCP domain 1e-61
2gsx_A 951 Complement receptor type 2; SCR domain, CCP domain 4e-60
2gsx_A951 Complement receptor type 2; SCR domain, CCP domain 1e-32
1haq_A 1213 Complement factor H; immunology, glycoprotein, com 9e-63
1haq_A 1213 Complement factor H; immunology, glycoprotein, com 4e-57
1haq_A 1213 Complement factor H; immunology, glycoprotein, com 2e-56
1haq_A1213 Complement factor H; immunology, glycoprotein, com 8e-55
1haq_A 1213 Complement factor H; immunology, glycoprotein, com 2e-53
1haq_A 1213 Complement factor H; immunology, glycoprotein, com 2e-53
1haq_A 1213 Complement factor H; immunology, glycoprotein, com 1e-52
1haq_A1213 Complement factor H; immunology, glycoprotein, com 1e-47
1haq_A 1213 Complement factor H; immunology, glycoprotein, com 5e-46
1haq_A 1213 Complement factor H; immunology, glycoprotein, com 1e-43
1haq_A 1213 Complement factor H; immunology, glycoprotein, com 1e-40
1haq_A 1213 Complement factor H; immunology, glycoprotein, com 1e-32
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 3e-62
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 3e-60
2q7z_A1931 Complement receptor type 1; SCR domain, blood grou 2e-59
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 2e-58
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 6e-58
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 6e-56
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 9e-56
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 1e-55
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 1e-55
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 2e-55
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 2e-55
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 6e-55
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 8e-55
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 1e-54
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 6e-54
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 2e-53
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 2e-49
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 5e-49
2q7z_A1931 Complement receptor type 1; SCR domain, blood grou 1e-47
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 2e-46
2c8i_E316 CD55, complement decay-accelerating factor; picorn 3e-53
2c8i_E316 CD55, complement decay-accelerating factor; picorn 7e-43
2c8i_E316 CD55, complement decay-accelerating factor; picorn 2e-38
2c8i_E316 CD55, complement decay-accelerating factor; picorn 3e-38
2c8i_E316 CD55, complement decay-accelerating factor; picorn 5e-36
2c8i_E316 CD55, complement decay-accelerating factor; picorn 5e-35
2c8i_E 316 CD55, complement decay-accelerating factor; picorn 6e-26
2c8i_E316 CD55, complement decay-accelerating factor; picorn 4e-19
2c8i_E 316 CD55, complement decay-accelerating factor; picorn 5e-08
2c8i_E316 CD55, complement decay-accelerating factor; picorn 3e-05
1ntl_A551 CRRY-IG; immunology, complement, glycoprotein, SCR 1e-51
1ntl_A 551 CRRY-IG; immunology, complement, glycoprotein, SCR 9e-42
1ntl_A 551 CRRY-IG; immunology, complement, glycoprotein, SCR 6e-35
1ntl_A551 CRRY-IG; immunology, complement, glycoprotein, SCR 4e-32
1ntl_A 551 CRRY-IG; immunology, complement, glycoprotein, SCR 4e-25
1ntl_A551 CRRY-IG; immunology, complement, glycoprotein, SCR 3e-22
1qub_A319 Protein (human BETA2-glycoprotein I); short consen 1e-49
1qub_A319 Protein (human BETA2-glycoprotein I); short consen 6e-44
1qub_A319 Protein (human BETA2-glycoprotein I); short consen 5e-41
1qub_A319 Protein (human BETA2-glycoprotein I); short consen 5e-37
1qub_A319 Protein (human BETA2-glycoprotein I); short consen 9e-33
1qub_A 319 Protein (human BETA2-glycoprotein I); short consen 2e-29
1qub_A319 Protein (human BETA2-glycoprotein I); short consen 6e-20
3o8e_B252 Membrane cofactor protein; short consensus repeat, 5e-48
3o8e_B252 Membrane cofactor protein; short consensus repeat, 1e-39
3o8e_B252 Membrane cofactor protein; short consensus repeat, 8e-39
3o8e_B252 Membrane cofactor protein; short consensus repeat, 2e-30
3o8e_B252 Membrane cofactor protein; short consensus repeat, 2e-29
3o8e_B252 Membrane cofactor protein; short consensus repeat, 2e-28
3o8e_B252 Membrane cofactor protein; short consensus repeat, 4e-17
2xrb_A290 Complement regulatory protein CRRY; immune system, 9e-45
2xrb_A290 Complement regulatory protein CRRY; immune system, 7e-40
2xrb_A290 Complement regulatory protein CRRY; immune system, 7e-36
2xrb_A290 Complement regulatory protein CRRY; immune system, 2e-32
2xrb_A290 Complement regulatory protein CRRY; immune system, 7e-31
2xrb_A290 Complement regulatory protein CRRY; immune system, 4e-26
2xrb_A 290 Complement regulatory protein CRRY; immune system, 3e-22
2xrb_A 290 Complement regulatory protein CRRY; immune system, 7e-12
1ntj_A320 Complement receptor related protein; immunology, g 2e-44
1ntj_A320 Complement receptor related protein; immunology, g 4e-44
1ntj_A320 Complement receptor related protein; immunology, g 8e-39
1ntj_A320 Complement receptor related protein; immunology, g 7e-37
1ntj_A320 Complement receptor related protein; immunology, g 9e-34
1ntj_A 320 Complement receptor related protein; immunology, g 2e-24
1ntj_A 320 Complement receptor related protein; immunology, g 3e-06
2wii_C277 H factor 1, complement factor H; immune system, su 4e-43
2wii_C277 H factor 1, complement factor H; immune system, su 1e-40
2wii_C277 H factor 1, complement factor H; immune system, su 3e-36
2wii_C277 H factor 1, complement factor H; immune system, su 1e-35
2wii_C277 H factor 1, complement factor H; immune system, su 6e-28
2wii_C277 H factor 1, complement factor H; immune system, su 8e-28
2wii_C277 H factor 1, complement factor H; immune system, su 1e-15
3iyp_F381 Complement decay-accelerating factor; virus, recep 1e-42
3iyp_F381 Complement decay-accelerating factor; virus, recep 3e-38
3iyp_F381 Complement decay-accelerating factor; virus, recep 2e-37
3iyp_F381 Complement decay-accelerating factor; virus, recep 2e-34
3iyp_F 381 Complement decay-accelerating factor; virus, recep 7e-32
3iyp_F381 Complement decay-accelerating factor; virus, recep 4e-27
3iyp_F381 Complement decay-accelerating factor; virus, recep 6e-24
3iyp_F381 Complement decay-accelerating factor; virus, recep 8e-15
3iyp_F 381 Complement decay-accelerating factor; virus, recep 6e-08
1ok3_A254 CD55, CR, DAF, complement decay-accelerating facto 4e-42
1ok3_A254 CD55, CR, DAF, complement decay-accelerating facto 1e-38
1ok3_A254 CD55, CR, DAF, complement decay-accelerating facto 1e-33
1ok3_A254 CD55, CR, DAF, complement decay-accelerating facto 1e-33
1ok3_A254 CD55, CR, DAF, complement decay-accelerating facto 4e-31
1ok3_A254 CD55, CR, DAF, complement decay-accelerating facto 1e-26
1ok3_A254 CD55, CR, DAF, complement decay-accelerating facto 8e-19
1ok3_A 254 CD55, CR, DAF, complement decay-accelerating facto 1e-08
1ok3_A254 CD55, CR, DAF, complement decay-accelerating facto 2e-05
1rid_A244 Complement control protein; regulation, SCR, immun 8e-42
1rid_A244 Complement control protein; regulation, SCR, immun 4e-38
1rid_A244 Complement control protein; regulation, SCR, immun 1e-33
1rid_A244 Complement control protein; regulation, SCR, immun 1e-31
1rid_A244 Complement control protein; regulation, SCR, immun 2e-29
1rid_A244 Complement control protein; regulation, SCR, immun 9e-18
1rid_A 244 Complement control protein; regulation, SCR, immun 3e-09
3hrz_D 741 Complement factor B; serine protease, glycosilated 1e-35
3hrz_D 741 Complement factor B; serine protease, glycosilated 3e-33
3hrz_D 741 Complement factor B; serine protease, glycosilated 4e-31
3hrz_D 741 Complement factor B; serine protease, glycosilated 2e-29
3erb_A223 Complement C2; C3/C5 convertase, short consensus r 3e-32
3erb_A223 Complement C2; C3/C5 convertase, short consensus r 5e-31
3erb_A223 Complement C2; C3/C5 convertase, short consensus r 4e-29
3erb_A223 Complement C2; C3/C5 convertase, short consensus r 6e-27
3erb_A223 Complement C2; C3/C5 convertase, short consensus r 5e-21
3erb_A 223 Complement C2; C3/C5 convertase, short consensus r 1e-06
2j22_A148 Fucolectin-related protein; carbohydrate-binding p 3e-28
1k12_A158 Lectin; beta barrel, protein carbohydrate complex, 4e-28
3sw0_X188 H factor 1, complement factor H; innate immune res 8e-28
3sw0_X188 H factor 1, complement factor H; innate immune res 7e-26
3sw0_X188 H factor 1, complement factor H; innate immune res 6e-25
3sw0_X188 H factor 1, complement factor H; innate immune res 4e-15
3sw0_X188 H factor 1, complement factor H; innate immune res 3e-14
3sw0_X 188 H factor 1, complement factor H; innate immune res 2e-08
1h03_P125 Complement decay-accelerating factor; immune syste 4e-27
1h03_P125 Complement decay-accelerating factor; immune syste 3e-22
1h03_P125 Complement decay-accelerating factor; immune syste 2e-21
1h03_P125 Complement decay-accelerating factor; immune syste 4e-19
1h03_P125 Complement decay-accelerating factor; immune syste 4e-15
1h03_P125 Complement decay-accelerating factor; immune syste 4e-15
1h03_P125 Complement decay-accelerating factor; immune syste 2e-09
1h03_P125 Complement decay-accelerating factor; immune syste 5e-06
2j1v_A151 Fucolectin-related protein; carbohydrate-binding p 8e-26
1gkn_A128 Complement receptor type 1; module, SCR, structure 8e-26
1gkn_A128 Complement receptor type 1; module, SCR, structure 5e-21
1gkn_A128 Complement receptor type 1; module, SCR, structure 1e-19
1gkn_A128 Complement receptor type 1; module, SCR, structure 7e-18
1gkn_A128 Complement receptor type 1; module, SCR, structure 3e-12
1gkn_A128 Complement receptor type 1; module, SCR, structure 5e-12
1gkn_A128 Complement receptor type 1; module, SCR, structure 7e-09
1gkn_A128 Complement receptor type 1; module, SCR, structure 4e-08
3lei_A153 Platelet aggregation factor SM-HPAF; lectin domain 1e-24
1ly2_A130 CD21, complement receptor type 2; epstein BARR vir 9e-24
1ly2_A130 CD21, complement receptor type 2; epstein BARR vir 2e-20
1ly2_A130 CD21, complement receptor type 2; epstein BARR vir 6e-19
1ly2_A130 CD21, complement receptor type 2; epstein BARR vir 5e-17
1ly2_A130 CD21, complement receptor type 2; epstein BARR vir 1e-16
1ly2_A130 CD21, complement receptor type 2; epstein BARR vir 6e-14
1ly2_A130 CD21, complement receptor type 2; epstein BARR vir 8e-11
1ly2_A130 CD21, complement receptor type 2; epstein BARR vir 2e-05
2a55_A133 C4B-binding protein; complement, SCR, CCP module, 2e-23
2a55_A133 C4B-binding protein; complement, SCR, CCP module, 3e-18
2a55_A133 C4B-binding protein; complement, SCR, CCP module, 7e-17
2a55_A133 C4B-binding protein; complement, SCR, CCP module, 2e-16
2a55_A133 C4B-binding protein; complement, SCR, CCP module, 9e-16
2a55_A133 C4B-binding protein; complement, SCR, CCP module, 5e-08
2a55_A133 C4B-binding protein; complement, SCR, CCP module, 1e-07
2a55_A133 C4B-binding protein; complement, SCR, CCP module, 6e-07
2a55_A133 C4B-binding protein; complement, SCR, CCP module, 3e-06
1gkg_A136 Complement receptor type 1; module, SCR, structure 8e-23
1gkg_A136 Complement receptor type 1; module, SCR, structure 1e-20
1gkg_A136 Complement receptor type 1; module, SCR, structure 7e-19
1gkg_A136 Complement receptor type 1; module, SCR, structure 7e-16
1gkg_A136 Complement receptor type 1; module, SCR, structure 9e-16
1gkg_A136 Complement receptor type 1; module, SCR, structure 3e-12
1gkg_A136 Complement receptor type 1; module, SCR, structure 2e-11
3gov_A155 MAsp-1; complement, serine protease, beta barrel, 2e-22
3gov_A155 MAsp-1; complement, serine protease, beta barrel, 6e-19
3gov_A155 MAsp-1; complement, serine protease, beta barrel, 7e-19
3gov_A155 MAsp-1; complement, serine protease, beta barrel, 3e-17
3gov_A155 MAsp-1; complement, serine protease, beta barrel, 8e-15
3gov_A155 MAsp-1; complement, serine protease, beta barrel, 2e-13
3gov_A155 MAsp-1; complement, serine protease, beta barrel, 5e-12
3cqo_A293 FBP32; F-lectin, fucolectin, sugar binding protein 5e-20
3cqo_A293 FBP32; F-lectin, fucolectin, sugar binding protein 2e-13
2uwn_A187 H factor 1, human complement factor H; alternative 2e-19
2uwn_A187 H factor 1, human complement factor H; alternative 2e-18
2uwn_A187 H factor 1, human complement factor H; alternative 2e-18
2uwn_A187 H factor 1, human complement factor H; alternative 7e-18
2uwn_A187 H factor 1, human complement factor H; alternative 1e-17
2uwn_A187 H factor 1, human complement factor H; alternative 1e-10
2uwn_A187 H factor 1, human complement factor H; alternative 3e-10
2uwn_A187 H factor 1, human complement factor H; alternative 1e-09
2qy0_A159 Complement C1R subcomponent; serine protease, beta 3e-19
2qy0_A159 Complement C1R subcomponent; serine protease, beta 5e-18
2qy0_A159 Complement C1R subcomponent; serine protease, beta 2e-15
2qy0_A159 Complement C1R subcomponent; serine protease, beta 9e-15
2qy0_A159 Complement C1R subcomponent; serine protease, beta 6e-10
2qy0_A159 Complement C1R subcomponent; serine protease, beta 3e-08
3r62_A129 H factor 1, complement factor H; immunity, repeati 8e-19
3r62_A129 H factor 1, complement factor H; immunity, repeati 2e-15
3r62_A129 H factor 1, complement factor H; immunity, repeati 1e-14
3r62_A129 H factor 1, complement factor H; immunity, repeati 4e-12
3r62_A129 H factor 1, complement factor H; immunity, repeati 1e-10
3r62_A129 H factor 1, complement factor H; immunity, repeati 6e-09
3r62_A129 H factor 1, complement factor H; immunity, repeati 6e-05
2ehf_A73 CUB and sushi domain-containing protein 1; CUB and 2e-18
2ehf_A73 CUB and sushi domain-containing protein 1; CUB and 2e-17
2ehf_A73 CUB and sushi domain-containing protein 1; CUB and 6e-11
2ehf_A73 CUB and sushi domain-containing protein 1; CUB and 6e-11
2ehf_A73 CUB and sushi domain-containing protein 1; CUB and 2e-10
2ehf_A73 CUB and sushi domain-containing protein 1; CUB and 1e-08
2ehf_A73 CUB and sushi domain-containing protein 1; CUB and 1e-04
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 3e-18
3t5o_A 913 Complement component C6; macpf, MAC, membrane atta 1e-15
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 4e-11
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 4e-09
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 6e-08
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 2e-07
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 3e-07
1egg_A147 Macrophage mannose receptor; C-type lectin, sugar 1e-17
2h2t_B175 Low affinity immunoglobulin epsilon FC receptor ( 5e-17
2aty_A 376 Complement receptor chimeric conjugate CR2-IG; imm 3e-16
2aty_A376 Complement receptor chimeric conjugate CR2-IG; imm 6e-14
2aty_A376 Complement receptor chimeric conjugate CR2-IG; imm 4e-10
2aty_A376 Complement receptor chimeric conjugate CR2-IG; imm 3e-09
2aty_A376 Complement receptor chimeric conjugate CR2-IG; imm 2e-04
1byf_A125 TC14, protein (polyandrocarpa lectin); C-type lect 6e-16
3kqg_A182 Langerin, C-type lectin domain family 4 member K; 3e-15
1wmz_A140 Lectin CEL-I, N-acetyl-D-galactosamine-specific C- 4e-15
2yby_A124 Complement factor H; immune system, complement reg 4e-15
2yby_A124 Complement factor H; immune system, complement reg 7e-10
2yby_A124 Complement factor H; immune system, complement reg 2e-08
2yby_A124 Complement factor H; immune system, complement reg 1e-07
2yby_A124 Complement factor H; immune system, complement reg 2e-07
3c22_A156 C-type lectin domain family 4 member K; coiled coi 4e-15
2py2_A136 Antifreeze protein type II; type II antifreeze pro 5e-15
2afp_A129 Protein (SEA raven type II antifreeze protein); re 5e-15
2yra_A74 Seizure 6-like protein isoform 3; disulfide bond, 6e-15
2yra_A74 Seizure 6-like protein isoform 3; disulfide bond, 3e-14
2yra_A74 Seizure 6-like protein isoform 3; disulfide bond, 5e-13
2yra_A74 Seizure 6-like protein isoform 3; disulfide bond, 7e-12
2yra_A74 Seizure 6-like protein isoform 3; disulfide bond, 7e-11
2yra_A74 Seizure 6-like protein isoform 3; disulfide bond, 9e-07
2yra_A74 Seizure 6-like protein isoform 3; disulfide bond, 3e-05
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 1e-14
1zjk_A 403 Mannan-binding lectin serine protease 2; beta barr 4e-11
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 1e-05
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 2e-05
1zjk_A 403 Mannan-binding lectin serine protease 2; beta barr 2e-05
1zjk_A 403 Mannan-binding lectin serine protease 2; beta barr 8e-04
2zib_A133 Type II antifreeze protein; thermal hysteresis, le 2e-14
2msb_A115 Mannose-binding protein-A; lectin; HET: BMA MAN; 1 2e-14
3alu_A157 Lectin CEL-IV, C-type; C-type lectin, raffinose, s 3e-14
1rtm_1149 Mannose-binding protein-A; lectin; 1.80A {Rattus n 4e-14
1rdl_1113 SUB-MBP-C, mannose-binding protein-C; C-type lecti 6e-14
1jzn_A135 Galactose-specific lectin; C-type lectin, protein- 6e-14
1h8u_A117 MBP, eosinophil granule major basic protein 1; lec 7e-14
1hup_A141 Mannose-binding protein; alpha-helical coiled-coil 7e-14
1buu_A168 Protein (mannose-binding protein A); lectin, HOST 7e-14
1tdq_B130 Aggrecan core protein; extracellular matrix, lecti 2e-13
2ls8_A156 C-type lectin domain family 4 member D; structural 2e-13
1qdd_A144 Lithostathine; pancreatic stone inhibitor, metal b 2e-13
2vuv_A129 Codakine; sugar-binding protein, C-type, lectin, m 2e-13
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 3e-13
1pwb_A177 SP-D, PSP-D, pulmonary surfactant-associated prote 5e-13
1wk1_A150 Hypothetical protein YK1067A12; lectin C-type doma 7e-13
2xr6_A170 CD209 antigen; sugar binding protein, carbohydrate 1e-12
1tn3_A137 Tetranectin; plasminogen binding, kringle 4, C-typ 1e-12
2ox9_A140 Collectin placenta 1; C-type lectin, sugar binding 2e-12
1gpz_A 399 Complement C1R component; hydrolase, activation, i 2e-12
1gpz_A 399 Complement C1R component; hydrolase, activation, i 1e-08
1gpz_A 399 Complement C1R component; hydrolase, activation, i 5e-06
1uv0_A149 Pancreatitis-associated protein 1; lectin, C-type, 2e-12
3tvj_A86 Mannan-binding lectin serine protease 2 A chain; i 3e-12
3tvj_A86 Mannan-binding lectin serine protease 2 A chain; i 1e-11
3tvj_A86 Mannan-binding lectin serine protease 2 A chain; i 8e-10
3tvj_A86 Mannan-binding lectin serine protease 2 A chain; i 3e-06
3tvj_A86 Mannan-binding lectin serine protease 2 A chain; i 3e-05
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 3e-12
1htn_A182 Tetranectin; plasminogen binding, kringle 4, alpha 3e-12
2b6b_D175 CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahe 3e-12
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 3e-12
3pbf_A148 Pulmonary surfactant-associated protein A; collect 5e-12
2kv3_A131 Regenerating islet-derived protein 4; GISP, C-type 6e-12
1sl6_A184 C-type lectin DC-signr; sugar binding protein; HET 7e-12
1gz2_A142 Ovocleidin-17, OC-17 ovocleidin; structural protei 2e-11
2e3x_B134 Coagulation factor X-activating enzyme light CHAI; 9e-11
3ubu_A131 Agglucetin subunit alpha-1; platelet inhibiting, a 2e-10
1dv8_A128 Asialoglycoprotein receptor 1; C-type lectin CRD, 3e-10
1ukm_A134 EMS16 A chain, EMS16 subunit A; domain swapping, C 3e-10
1fvu_A133 Botrocetin alpha chain; VON WILLBRAND factor modul 6e-10
3bx4_A136 Aggretin alpha chain; toxin; 1.70A {Agkistrodon rh 1e-09
1j34_A129 Coagulation factor IX-binding protein A chain; mag 1e-09
1ypq_A135 Oxidised low density lipoprotein (lectin-like) rec 2e-09
3vpp_A132 C-type lectin domain family 9 member A; dendritic 3e-09
2c6u_A122 CLEC1B protein; lectin, rhodocytin, aggretin, C-ty 3e-09
1c3a_A135 Flavocetin-A: alpha subunit; C-type lectin-like do 4e-09
3c8j_A203 Natural killer cell receptor LY49C; MHC, virus, im 4e-09
1fvu_B125 Botrocetin beta chain; VON WILLBRAND factor modula 5e-09
1jwi_A131 Bitiscetin; domain swapping, C-type lectin, toxin; 5e-09
3bdw_A123 Natural killer cells antigen CD94; NK cells, recep 6e-09
2bpd_A142 Dectin-1; receptor, beta-glucan, fungal recognitio 6e-09
3gpr_C134 Rhodocetin subunit gamma; disulfide bond, lectin, 6e-09
3ff7_C112 Killer cell lectin-like receptor subfamily G membe 1e-08
1jwi_B125 Platelet aggregation inducer; domain swapping, C-t 1e-08
3ubu_B126 Agglucetin subunit beta-2; platelet inhibiting, ag 1e-08
1umr_A135 Convulxin alpha, CVX alpha; lectin, C-type lectin, 2e-08
3ff9_A115 Killer cell lectin-like receptor subfamily G membe 2e-08
1sb2_B129 Rhodocetin beta subunit; C-type lectin, domain swa 2e-08
1oz7_B123 Echicetin B-chain; platelet aggregation, dimer, to 3e-08
3m9z_A139 Killer cell lectin-like receptor subfamily B MEMB; 3e-08
1j34_B123 Coagulation factor IX-binding protein B chain; mag 4e-08
1sb2_A133 Rhodocetin alpha subunit; C-type lectin, domain sw 4e-08
2e3x_C122 Coagulation factor X-activating enzyme light CHAI; 5e-08
2yhf_A118 C-type lectin domain family 5 member A; immune sys 6e-08
3bx4_B146 Aggretin beta chain; toxin; 1.70A {Agkistrodon rho 6e-08
4aqb_A361 Mannan-binding lectin serine protease 1; blood clo 7e-08
4aqb_A361 Mannan-binding lectin serine protease 1; blood clo 7e-06
4aqb_A361 Mannan-binding lectin serine protease 1; blood clo 1e-05
4aqb_A361 Mannan-binding lectin serine protease 1; blood clo 9e-05
3hup_A130 Early activation antigen CD69; C-type lectin-like 7e-08
1oz7_A131 Echicetin A-chain; platelet aggregation, dimer, to 1e-07
3g8k_A130 Lectin-related NK cell receptor LY49L1; natural ki 1e-07
1umr_C125 Convulxin beta, CVX beta; lectin, C-type lectin, p 1e-07
3g8l_A190 Lectin-related NK cell receptor LY49L1; natural ki 1e-07
1c3a_B125 Flavocetin-A: beta subunit; C-type lectin-like dom 1e-07
4a42_A149 GH89_CBM32-4, alpha-N-acetylglucosaminidase family 1e-07
3bdw_B120 NKG2-A/NKG2-B type II integral membrane protein; N 1e-07
1hq8_A123 NKG2-D; homodimer, CIS-proline, apoptosis; 1.95A { 2e-07
1fm5_A199 Early activation antigen CD69; C-type lectin-like 2e-07
1mpu_A138 NKG2-D type II integral membrane protein; C-type l 3e-07
3gpr_D124 Rhodocetin subunit delta; disulfide bond, lectin, 5e-07
1ukm_B128 EMS16 B chain, EMS16 subunit B; domain swapping, C 8e-07
3rs1_A122 C-type lectin domain family 2 member I; C-type lec 3e-06
1srz_A68 Gamma-aminobutyric acid type B receptor, subunit 1 3e-06
1srz_A68 Gamma-aminobutyric acid type B receptor, subunit 1 7e-05
1srz_A68 Gamma-aminobutyric acid type B receptor, subunit 1 2e-04
4a3z_A161 GH89_CBM32, alpha-N-acetylglucosaminidase family p 3e-06
1elv_A 333 Complement C1S component; trypsin-like serin prote 2e-05
1elv_A333 Complement C1S component; trypsin-like serin prote 3e-04
4a4a_A914 Alpha-N-acetylglucosaminidase family protein; hydr 9e-05
1md8_A 329 C1R complement serine protease; innate immunity, a 3e-04
>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 Back     alignment and structure
 Score =  249 bits (636), Expect = 4e-70
 Identities = 124/659 (18%), Positives = 191/659 (28%), Gaps = 113/659 (17%)

Query: 272 ICQHNPANCGSPDRHVNTTFVGTVSTKLGSTISYACPEGNMLVGSATRTC-KEGFWTGVA 330
              +  ++C  P         G+   + G ++++AC     + G+ +  C     W    
Sbjct: 63  EYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKSVWCQANNMWGPTR 122

Query: 331 PTCQYFQLQPMDVPNLVLYLFLSKLFRESYERLNVDCGKLEHIEHGTVTLETTRT-THGA 389
                                             ++C  L  I +G  T E   +   G 
Sbjct: 123 LPTCV-------------------------SVFPLECPALPMIHNGHHTSENVGSIAPGL 157

Query: 390 VAIYACHENYTLIGETRRVCGDGGKWNGTEPQCLFDWCAEPPQISGGIVTTSGR-RTGSV 448
              Y+C   Y L+GE    C   GKW+   P C    C    +   G V      R G  
Sbjct: 158 SVTYSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGKVKEPPILRVGVT 217

Query: 449 ATYSCEPGFILFGSNV-------------------NIDCGRLTAIPYGSISYLNETTY-L 488
           A + C+ G+ L G                       I C     I  G     +      
Sbjct: 218 ANFFCDEGYRLQGPPSSRCVIAGQGVAWTKMPVCEEIFCPSPPPILNGRHIGNSLANVSY 277

Query: 489 GSEVLYSC------SRNYRLVGHPRRSCL----ESKVWSDTAPKCEGKATKDIKVCSNVA 538
           GS V Y+C        N+ L+G     C     ++  WS  AP+CE              
Sbjct: 278 GSIVTYTCDPDPEEGVNFILIGESTLRCTVDSQKTGTWSGPAPRCE-------------- 323

Query: 539 VDRREIRCPEPTLPAHSILSVTGNDRLYGRTLIKTADSASSVATYKIGALPTLPAHSILS 598
           +    ++CP P +    ++S   +   Y                +      TL     + 
Sbjct: 324 LSTSAVQCPHPQILRGRMVSGQKDRYTYN-----------DTVIFACMFGFTLKGSKQIR 372

Query: 599 VTGNDRLYGRTLIKTAD------------SASSVATYKIGALVKYRCERGYKVEGEPLST 646
                       +   +                +  +  G  +KY C  GY + GE    
Sbjct: 373 CNAQGTWEPSAPVCEKECQAPPNILNGQKEDRHMVRFDPGTSIKYSCNPGYVLVGEESIQ 432

Query: 647 CEDTGSWSGSVPECIYVDCGNPETVPNGGFTLTSNATYYGTAVLYECDENYRLEGHARRL 706
           C   G W+  VP+C    C                  +    V   C E Y+L G   + 
Sbjct: 433 CTSEGVWTPPVPQCKVAACEATGRQLLT----KPQHQFVRPDVNSSCGEGYKLSGSVYQE 488

Query: 707 CLENGTWSSGLPTCKGNEGHARRLCLENGTWSSGLPTCKGCKTPKKSLTRPALSCLPGKR 766
           C     W   +  CK        +   NG  +                T    +C PG  
Sbjct: 489 CQGTIPWFMEIRLCKEITCPPPPVI-YNGAHTGS------SLEDFPYGTTVTYTCNPG-- 539

Query: 767 FYYHRGIFRLQNTQKVSYTRTCTKRGTWSGHIPTCKA----IDCSHPGSIDNGRVIIMNQ 822
                  F L     +  T    +RGTWSG  P CK     + CSH    +  ++     
Sbjct: 540 -PERGVEFSLIGESTIRCTSNDQERGTWSGPAPLCKLSLLAVQCSHVHIANGYKISGKEA 598

Query: 823 TTTYNSAVEYHCVPQYQRIGPYLRKCMEDGSWSGDEPRCEKRFNSGIPGRSRRSPINSF 881
              YN  V + C   +   G    +C  D +W  + P CEK     +    +  P  S 
Sbjct: 599 PYFYNDTVTFKCYSGFTLKGSSQIRCKADNTWDPEIPVCEKETCQHVRQSLQELPAGSR 657
>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 Back     alignment and structure
>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 Back     alignment and structure
>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 Back     alignment and structure
>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 Back     alignment and structure
>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 Back     alignment and structure
>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 Back     alignment and structure
>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Length = 551 Back     alignment and structure
>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Length = 551 Back     alignment and structure
>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Length = 551 Back     alignment and structure
>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Length = 551 Back     alignment and structure
>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Length = 551 Back     alignment and structure
>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Length = 551 Back     alignment and structure
>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Length = 319 Back     alignment and structure
>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Length = 319 Back     alignment and structure
>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Length = 319 Back     alignment and structure
>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Length = 319 Back     alignment and structure
>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Length = 319 Back     alignment and structure
>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Length = 319 Back     alignment and structure
>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Length = 319 Back     alignment and structure
>3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Length = 252 Back     alignment and structure
>3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Length = 252 Back     alignment and structure
>3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Length = 252 Back     alignment and structure
>3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Length = 252 Back     alignment and structure
>3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Length = 252 Back     alignment and structure
>3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Length = 252 Back     alignment and structure
>3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Length = 252 Back     alignment and structure
>2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A Length = 290 Back     alignment and structure
>2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A Length = 290 Back     alignment and structure
>2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A Length = 290 Back     alignment and structure
>2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A Length = 290 Back     alignment and structure
>2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A Length = 290 Back     alignment and structure
>2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A Length = 290 Back     alignment and structure
>2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A Length = 290 Back     alignment and structure
>2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A Length = 290 Back     alignment and structure
>1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} Length = 320 Back     alignment and structure
>1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} Length = 320 Back     alignment and structure
>1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} Length = 320 Back     alignment and structure
>1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} Length = 320 Back     alignment and structure
>1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} Length = 320 Back     alignment and structure
>1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} Length = 320 Back     alignment and structure
>1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} Length = 320 Back     alignment and structure
>2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Length = 277 Back     alignment and structure
>2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Length = 277 Back     alignment and structure
>2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Length = 277 Back     alignment and structure
>2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Length = 277 Back     alignment and structure
>2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Length = 277 Back     alignment and structure
>2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Length = 277 Back     alignment and structure
>2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Length = 277 Back     alignment and structure
>3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Length = 381 Back     alignment and structure
>3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Length = 381 Back     alignment and structure
>3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Length = 381 Back     alignment and structure
>3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Length = 381 Back     alignment and structure
>3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Length = 381 Back     alignment and structure
>3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Length = 381 Back     alignment and structure
>3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Length = 381 Back     alignment and structure
>3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Length = 381 Back     alignment and structure
>3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Length = 381 Back     alignment and structure
>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Length = 254 Back     alignment and structure
>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Length = 254 Back     alignment and structure
>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Length = 254 Back     alignment and structure
>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Length = 254 Back     alignment and structure
>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Length = 254 Back     alignment and structure
>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Length = 254 Back     alignment and structure
>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Length = 254 Back     alignment and structure
>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Length = 254 Back     alignment and structure
>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Length = 254 Back     alignment and structure
>1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Length = 244 Back     alignment and structure
>1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Length = 244 Back     alignment and structure
>1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Length = 244 Back     alignment and structure
>1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Length = 244 Back     alignment and structure
>1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Length = 244 Back     alignment and structure
>1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Length = 244 Back     alignment and structure
>1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Length = 244 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 Back     alignment and structure
>3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Length = 223 Back     alignment and structure
>3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Length = 223 Back     alignment and structure
>3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Length = 223 Back     alignment and structure
>3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Length = 223 Back     alignment and structure
>3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Length = 223 Back     alignment and structure
>3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Length = 223 Back     alignment and structure
>2j22_A Fucolectin-related protein; carbohydrate-binding protein, carbohydrate binding protein; 1.8A {Streptococcus pneumoniae} Length = 148 Back     alignment and structure
>1k12_A Lectin; beta barrel, protein carbohydrate complex, sugar binding protein; HET: FUC; 1.90A {Anguilla anguilla} SCOP: b.18.1.15 Length = 158 Back     alignment and structure
>3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Length = 188 Back     alignment and structure
>3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Length = 188 Back     alignment and structure
>3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Length = 188 Back     alignment and structure
>3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Length = 188 Back     alignment and structure
>3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Length = 188 Back     alignment and structure
>3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Length = 188 Back     alignment and structure
>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Length = 125 Back     alignment and structure
>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Length = 125 Back     alignment and structure
>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Length = 125 Back     alignment and structure
>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Length = 125 Back     alignment and structure
>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Length = 125 Back     alignment and structure
>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Length = 125 Back     alignment and structure
>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Length = 125 Back     alignment and structure
>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Length = 125 Back     alignment and structure
>2j1v_A Fucolectin-related protein; carbohydrate-binding protein, carbohydrate binding protein; HET: NAG GAL FUC; 1.45A {Streptococcus pneumoniae} PDB: 2j1r_A* 2j1t_A* 2j1u_A* 2j1s_A* Length = 151 Back     alignment and structure
>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Length = 128 Back     alignment and structure
>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Length = 128 Back     alignment and structure
>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Length = 128 Back     alignment and structure
>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Length = 128 Back     alignment and structure
>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Length = 128 Back     alignment and structure
>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Length = 128 Back     alignment and structure
>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Length = 128 Back     alignment and structure
>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Length = 128 Back     alignment and structure
>3lei_A Platelet aggregation factor SM-HPAF; lectin domain of lectinolysin, fucose, blood clotting, nicke; HET: FUC; 1.90A {Streptococcus mitis} PDB: 3leg_A* 3le0_A* 3lek_A* Length = 153 Back     alignment and structure
>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Length = 130 Back     alignment and structure
>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Length = 130 Back     alignment and structure
>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Length = 130 Back     alignment and structure
>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Length = 130 Back     alignment and structure
>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Length = 130 Back     alignment and structure
>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Length = 130 Back     alignment and structure
>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Length = 130 Back     alignment and structure
>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Length = 130 Back     alignment and structure
>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A Length = 136 Back     alignment and structure
>1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A Length = 136 Back     alignment and structure
>1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A Length = 136 Back     alignment and structure
>1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A Length = 136 Back     alignment and structure
>1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A Length = 136 Back     alignment and structure
>1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A Length = 136 Back     alignment and structure
>1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A Length = 136 Back     alignment and structure
>3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A Length = 155 Back     alignment and structure
>3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A Length = 155 Back     alignment and structure
>3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A Length = 155 Back     alignment and structure
>3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A Length = 155 Back     alignment and structure
>3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A Length = 155 Back     alignment and structure
>3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A Length = 155 Back     alignment and structure
>3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A Length = 155 Back     alignment and structure
>3cqo_A FBP32; F-lectin, fucolectin, sugar binding protein; HET: FUC; 2.32A {Morone saxatilis} Length = 293 Back     alignment and structure
>3cqo_A FBP32; F-lectin, fucolectin, sugar binding protein; HET: FUC; 2.32A {Morone saxatilis} Length = 293 Back     alignment and structure
>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Length = 187 Back     alignment and structure
>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Length = 187 Back     alignment and structure
>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Length = 187 Back     alignment and structure
>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Length = 187 Back     alignment and structure
>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Length = 187 Back     alignment and structure
>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Length = 187 Back     alignment and structure
>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Length = 187 Back     alignment and structure
>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Length = 187 Back     alignment and structure
>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} Length = 159 Back     alignment and structure
>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} Length = 159 Back     alignment and structure
>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} Length = 159 Back     alignment and structure
>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} Length = 159 Back     alignment and structure
>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} Length = 159 Back     alignment and structure
>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} Length = 159 Back     alignment and structure
>3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C Length = 129 Back     alignment and structure
>3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C Length = 129 Back     alignment and structure
>3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C Length = 129 Back     alignment and structure
>3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C Length = 129 Back     alignment and structure
>3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C Length = 129 Back     alignment and structure
>3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C Length = 129 Back     alignment and structure
>3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C Length = 129 Back     alignment and structure
>2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Length = 913 Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Length = 913 Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Length = 913 Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Length = 913 Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Length = 913 Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Length = 913 Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Length = 913 Back     alignment and structure
>1egg_A Macrophage mannose receptor; C-type lectin, sugar binding protein; 2.30A {Homo sapiens} SCOP: d.169.1.1 PDB: 1egi_A Length = 147 Back     alignment and structure
>2h2t_B Low affinity immunoglobulin epsilon FC receptor ( IGE receptor) (FC-epsilon-RII)...; C-type lectin, calcium-bound, lectin domain; 1.30A {Homo sapiens} PDB: 2h2r_A 1t8c_A 1t8d_A Length = 175 Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Length = 376 Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Length = 376 Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Length = 376 Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Length = 376 Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Length = 376 Back     alignment and structure
>1byf_A TC14, protein (polyandrocarpa lectin); C-type lectin, galactose-specific, sugar binding protein; 2.00A {Polyandrocarpa misakiensis} SCOP: d.169.1.1 PDB: 1tlg_A* Length = 125 Back     alignment and structure
>3kqg_A Langerin, C-type lectin domain family 4 member K; trimer, NECK and CRD, coiled coil, immune system; 2.30A {Homo sapiens} Length = 182 Back     alignment and structure
>1wmz_A Lectin CEL-I, N-acetyl-D-galactosamine-specific C-type; C-type lectin, N-acetylgalactosamine, invertebrate, sugar binding protein; HET: NGA A2G; 1.70A {Cucumaria echinata} SCOP: d.169.1.1 PDB: 1wmy_A* Length = 140 Back     alignment and structure
>2yby_A Complement factor H; immune system, complement regulation, innate immunity, infec; 1.58A {Mus musculus} Length = 124 Back     alignment and structure
>2yby_A Complement factor H; immune system, complement regulation, innate immunity, infec; 1.58A {Mus musculus} Length = 124 Back     alignment and structure
>2yby_A Complement factor H; immune system, complement regulation, innate immunity, infec; 1.58A {Mus musculus} Length = 124 Back     alignment and structure
>2yby_A Complement factor H; immune system, complement regulation, innate immunity, infec; 1.58A {Mus musculus} Length = 124 Back     alignment and structure
>2yby_A Complement factor H; immune system, complement regulation, innate immunity, infec; 1.58A {Mus musculus} Length = 124 Back     alignment and structure
>3c22_A C-type lectin domain family 4 member K; coiled coil, glycoprotein, membrane, signal-anchor, transmembrane, immune system, sugar binding protein; 1.50A {Homo sapiens} PDB: 3p5g_A* 3p5d_A* 3p5f_A* 3p5e_A* 3p5h_A* 3p5i_A* 3p7g_A* 3p7f_A* 3p7h_A* 3bc7_A* 3bbs_A* 3bc6_A* Length = 156 Back     alignment and structure
>2py2_A Antifreeze protein type II; type II antifreeze protein; 1.70A {Clupea harengus} Length = 136 Back     alignment and structure
>2afp_A Protein (SEA raven type II antifreeze protein); recombinant SEA raven protein, solution backbone fold, C- type lectin; NMR {Hemitripterus americanus} SCOP: d.169.1.1 Length = 129 Back     alignment and structure
>2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 Back     alignment and structure
>2zib_A Type II antifreeze protein; thermal hysteresis, lectin; 1.34A {Brachyopsis rostratus} Length = 133 Back     alignment and structure
>2msb_A Mannose-binding protein-A; lectin; HET: BMA MAN; 1.70A {Rattus rattus} SCOP: d.169.1.1 PDB: 1msb_A 1ytt_A* Length = 115 Back     alignment and structure
>3alu_A Lectin CEL-IV, C-type; C-type lectin, raffinose, sugar binding protein; HET: RAF; 1.65A {Cucumaria echinata} PDB: 3als_A* 3alt_A* Length = 157 Back     alignment and structure
>1rtm_1 Mannose-binding protein-A; lectin; 1.80A {Rattus norvegicus} SCOP: d.169.1.1 h.1.1.1 PDB: 1kwu_A* 1kwv_A* 1kwt_A* 1kwx_A* 1kwy_A* 1kx1_A* 1kww_A 1kwz_A* 1kx0_A* 3kmb_1* 1kmb_1* 2kmb_1* 4kmb_1* 1afb_1* 1afa_1* 1afd_1 1bch_1* 1bcj_1* 1fif_A 1fih_A* Length = 149 Back     alignment and structure
>1rdl_1 SUB-MBP-C, mannose-binding protein-C; C-type lectin, calcium-binding protein; HET: MMA; 1.70A {Rattus rattus} SCOP: d.169.1.1 PDB: 1rdj_1* 1rdk_1* 1rdi_1* 1rdm_1* 1rdn_1* 1rdo_1 1bv4_A 1kza_1* 1kzb_1* 1kzc_1* 1kzd_1* 1kze_1* Length = 113 Back     alignment and structure
>1jzn_A Galactose-specific lectin; C-type lectin, protein-disaccharide complex, sugar binding P; HET: BGC GAL; 2.20A {Crotalus atrox} SCOP: d.169.1.1 PDB: 1muq_A* Length = 135 Back     alignment and structure
>1h8u_A MBP, eosinophil granule major basic protein 1; lectin, eosinophil granule protein, EMBP; 1.8A {Homo sapiens} SCOP: d.169.1.1 PDB: 2brs_A* Length = 117 Back     alignment and structure
>1hup_A Mannose-binding protein; alpha-helical coiled-coil, C-type lectin; 2.50A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 Length = 141 Back     alignment and structure
>1buu_A Protein (mannose-binding protein A); lectin, HOST defense, metalloprotein, sugar binding protein; 1.90A {Rattus norvegicus} SCOP: d.169.1.1 h.1.1.1 Length = 168 Back     alignment and structure
>1tdq_B Aggrecan core protein; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: d.169.1.1 Length = 130 Back     alignment and structure
>2ls8_A C-type lectin domain family 4 member D; structural genomics, NEW YORK structural genomics research consortium, nysgrc, PSI-biology, immune system; NMR {Homo sapiens} Length = 156 Back     alignment and structure
>1qdd_A Lithostathine; pancreatic stone inhibitor, metal binding protein; HET: SIA NDG GAL; 1.30A {Homo sapiens} SCOP: d.169.1.1 PDB: 1lit_A Length = 144 Back     alignment and structure
>2vuv_A Codakine; sugar-binding protein, C-type, lectin, mannose, invertebrate; HET: CIT; 1.3A {Codakia orbicularis} PDB: 2vuz_A* Length = 129 Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Length = 157 Back     alignment and structure
>1pwb_A SP-D, PSP-D, pulmonary surfactant-associated protein D; collectin, C-type lectin, alpha-helical coiled coil, carbohydrate recognition domain; HET: GLC; 1.40A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 PDB: 1pw9_A* 3ikn_A* 3ikp_A* 3ikq_A* 3ikr_A* 2rie_A* 2ggx_A* 2ggu_A* 2ork_A* 2orj_A* 2ria_A* 2rib_A* 2ric_A* 2rid_A* 2os9_A* 3dbz_A 3g81_A* 3g83_A* 1b08_A 3g84_A* ... Length = 177 Back     alignment and structure
>1wk1_A Hypothetical protein YK1067A12; lectin C-type domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Caenorhabditis elegans} SCOP: d.169.1.1 Length = 150 Back     alignment and structure
>2xr6_A CD209 antigen; sugar binding protein, carbohydrate binding, mannose; HET: MAN 07B; 1.35A {Homo sapiens} PDB: 1sl4_A* 2it6_A* 1k9i_A* 2xr5_A* 1sl5_A* 2it5_A* 1xph_A 1k9j_A* Length = 170 Back     alignment and structure
>1tn3_A Tetranectin; plasminogen binding, kringle 4, C-type lectin, carbohydrate recognition domain; 2.00A {Homo sapiens} SCOP: d.169.1.1 PDB: 1rjh_A 3l9j_C Length = 137 Back     alignment and structure
>2ox9_A Collectin placenta 1; C-type lectin, sugar binding protein; HET: GAL NAG FUC; 1.95A {Mus musculus} PDB: 2ox8_A Length = 140 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 Back     alignment and structure
>1uv0_A Pancreatitis-associated protein 1; lectin, C-type, secreted, inflammatory response, acute phase; 1.78A {Homo sapiens} SCOP: d.169.1.1 PDB: 2go0_A Length = 149 Back     alignment and structure
>3tvj_A Mannan-binding lectin serine protease 2 A chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 86 Back     alignment and structure
>3tvj_A Mannan-binding lectin serine protease 2 A chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 86 Back     alignment and structure
>3tvj_A Mannan-binding lectin serine protease 2 A chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 86 Back     alignment and structure
>3tvj_A Mannan-binding lectin serine protease 2 A chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 86 Back     alignment and structure
>3tvj_A Mannan-binding lectin serine protease 2 A chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 86 Back     alignment and structure
>1htn_A Tetranectin; plasminogen binding, kringle 4, alpha-helical coiled coil, C-type lectin, carbohydrate recognition domain; 2.80A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 Length = 182 Back     alignment and structure
>2b6b_D CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahedral virus, virus-recepto; 25.00A {Homo sapiens} SCOP: d.169.1.1 Length = 175 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Length = 162 Back     alignment and structure
>3pbf_A Pulmonary surfactant-associated protein A; collectin, carbohydrate binding, lectin, mannose, sugar BIND protein; 1.80A {Rattus norvegicus} PDB: 1r14_A* 1r13_A* 3paq_A* 3par_A 3pak_A Length = 148 Back     alignment and structure
>2kv3_A Regenerating islet-derived protein 4; GISP, C-type lectin, REG IV, disulfide bond, glycoPro lectin, secreted, sugar binding protein; NMR {Homo sapiens} Length = 131 Back     alignment and structure
>1sl6_A C-type lectin DC-signr; sugar binding protein; HET: GAL NDG FUC; 2.25A {Homo sapiens} SCOP: d.169.1.1 PDB: 1xar_A Length = 184 Back     alignment and structure
>1gz2_A Ovocleidin-17, OC-17 ovocleidin; structural protein, CTLD, eggshell structural protein, phosphoprotein, sugar-binding protein, glycoprotein; HET: SEP; 1.5A {Gallus gallus} SCOP: d.169.1.1 Length = 142 Back     alignment and structure
>2e3x_B Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} Length = 134 Back     alignment and structure
>3ubu_A Agglucetin subunit alpha-1; platelet inhibiting, agkisacucetin, dimer, toxin, C-type LEC GPIB inhibitor, GPIB binding; 1.91A {Deinagkistrodon acutus} Length = 131 Back     alignment and structure
>1dv8_A Asialoglycoprotein receptor 1; C-type lectin CRD, signaling protein; 2.30A {Homo sapiens} SCOP: d.169.1.1 Length = 128 Back     alignment and structure
>1ukm_A EMS16 A chain, EMS16 subunit A; domain swapping, C-type lectin, toxin; HET: NAG; 1.90A {Echis multisquamatus} SCOP: d.169.1.1 PDB: 1v7p_A* Length = 134 Back     alignment and structure
>1fvu_A Botrocetin alpha chain; VON WILLBRAND factor modulator, C-type lectin, metal- binding, loop exchanged dimer, toxin; 1.80A {Bothrops jararaca} SCOP: d.169.1.1 PDB: 1ijk_B 1u0n_B 1u0o_A Length = 133 Back     alignment and structure
>3bx4_A Aggretin alpha chain; toxin; 1.70A {Agkistrodon rhodostoma} PDB: 2vrp_A Length = 136 Back     alignment and structure
>1j34_A Coagulation factor IX-binding protein A chain; magnesium ION, calcium ION, GLA domain, protein binding/blood clotting complex; HET: CGU; 1.55A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1bj3_A* 1j35_A* 1x2t_A* 1x2w_A 1ixx_A 1y17_A 1wt9_A 1iod_A* Length = 129 Back     alignment and structure
>1ypq_A Oxidised low density lipoprotein (lectin-like) receptor 1; oxidized low density lipoprotein receptor, LOX-1, CTLD, C- type lectin like domain; 1.40A {Homo sapiens} SCOP: d.169.1.1 PDB: 1ypu_A 1yxk_A 3vlg_A 1ypo_A 1yxj_A Length = 135 Back     alignment and structure
>3vpp_A C-type lectin domain family 9 member A; dendritic cell, C-type lectin-like domain, membrane, immune; 1.64A {Homo sapiens} Length = 132 Back     alignment and structure
>2c6u_A CLEC1B protein; lectin, rhodocytin, aggretin, C-type lectin-like, platelets, thrombosis; 1.6A {Homo sapiens} Length = 122 Back     alignment and structure
>1c3a_A Flavocetin-A: alpha subunit; C-type lectin-like domains, membrane protein; 2.50A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1v4l_A Length = 135 Back     alignment and structure
>3c8j_A Natural killer cell receptor LY49C; MHC, virus, immune system; 2.60A {Mus musculus} SCOP: d.169.1.1 PDB: 3c8k_D 1p4l_D 1ja3_A 1p1z_D Length = 203 Back     alignment and structure
>1fvu_B Botrocetin beta chain; VON WILLBRAND factor modulator, C-type lectin, metal- binding, loop exchanged dimer, toxin; 1.80A {Bothrops jararaca} SCOP: d.169.1.1 PDB: 1ijk_C 1u0n_C 1u0o_B Length = 125 Back     alignment and structure
>1jwi_A Bitiscetin; domain swapping, C-type lectin, toxin; 2.00A {Bitis arietans} SCOP: d.169.1.1 PDB: 1uex_A Length = 131 Back     alignment and structure
>3bdw_A Natural killer cells antigen CD94; NK cells, receptor, glycoprotein, lectin, signal-A transmembrane, immune system receptor; 2.50A {Homo sapiens} SCOP: d.169.1.1 PDB: 3cdg_J 1b6e_A 3cii_G Length = 123 Back     alignment and structure
>2bpd_A Dectin-1; receptor, beta-glucan, fungal recognition, C-type lectin-like domain, CTLD, carbohydrate; 1.5A {Mus musculus} PDB: 2bph_A 2bpe_A 2cl8_A* Length = 142 Back     alignment and structure
>3gpr_C Rhodocetin subunit gamma; disulfide bond, lectin, secreted, toxin, cell adhesion; 3.20A {Calloselasma rhodostoma} Length = 134 Back     alignment and structure
>3ff7_C Killer cell lectin-like receptor subfamily G member 1; KLRG1-cadherin complex, calcium, cell adhesion, cell junction, cell membrane; 1.80A {Homo sapiens} Length = 112 Back     alignment and structure
>1jwi_B Platelet aggregation inducer; domain swapping, C-type lectin, toxin; 2.00A {Bitis arietans} SCOP: d.169.1.1 PDB: 1uex_B Length = 125 Back     alignment and structure
>3ubu_B Agglucetin subunit beta-2; platelet inhibiting, agkisacucetin, dimer, toxin, C-type LEC GPIB inhibitor, GPIB binding; 1.91A {Deinagkistrodon acutus} Length = 126 Back     alignment and structure
>1umr_A Convulxin alpha, CVX alpha; lectin, C-type lectin, platelet, sugar-binding protein, activator, snake venom; 2.40A {Crotalus durissus terrificus} SCOP: d.169.1.1 PDB: 1uos_A Length = 135 Back     alignment and structure
>3ff9_A Killer cell lectin-like receptor subfamily G member 1; natural killer cell receptor KLTG1, glycoprotein, membrane, phosphoprotein, signal-anchor; 1.80A {Mus musculus} PDB: 3ff8_C Length = 115 Back     alignment and structure
>1sb2_B Rhodocetin beta subunit; C-type lectin, domain swapping, toxin; 1.90A {Calloselasma rhodostoma} SCOP: d.169.1.1 PDB: 3gpr_B Length = 129 Back     alignment and structure
>1oz7_B Echicetin B-chain; platelet aggregation, dimer, toxin; 2.40A {Echis carinatus} SCOP: d.169.1.1 Length = 123 Back     alignment and structure
>3m9z_A Killer cell lectin-like receptor subfamily B MEMB; C-type lectin-like domain, domain swapping, disulfide bond, transmembrane protein; 1.70A {Mus musculus} PDB: 3t3a_A Length = 139 Back     alignment and structure
>1j34_B Coagulation factor IX-binding protein B chain; magnesium ION, calcium ION, GLA domain, protein binding/blood clotting complex; HET: CGU; 1.55A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1bj3_B 1ixx_B* 1j35_B* 1x2t_B* 1x2w_B 1wt9_B 1iod_B 1y17_B Length = 123 Back     alignment and structure
>1sb2_A Rhodocetin alpha subunit; C-type lectin, domain swapping, toxin; 1.90A {Calloselasma rhodostoma} SCOP: d.169.1.1 PDB: 3gpr_A Length = 133 Back     alignment and structure
>2e3x_C Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} Length = 122 Back     alignment and structure
>2yhf_A C-type lectin domain family 5 member A; immune system; 1.90A {Homo sapiens} Length = 118 Back     alignment and structure
>3bx4_B Aggretin beta chain; toxin; 1.70A {Agkistrodon rhodostoma} PDB: 2vrp_B Length = 146 Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Length = 361 Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Length = 361 Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Length = 361 Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Length = 361 Back     alignment and structure
>3hup_A Early activation antigen CD69; C-type lectin-like domain, disulfide bond, glycoprotein, LEC membrane, phosphoprotein, signal-anchor, transmembrane; 1.37A {Homo sapiens} PDB: 1e87_A 1e8i_A 3cck_A Length = 130 Back     alignment and structure
>1oz7_A Echicetin A-chain; platelet aggregation, dimer, toxin; 2.40A {Echis carinatus} SCOP: d.169.1.1 Length = 131 Back     alignment and structure
>1umr_C Convulxin beta, CVX beta; lectin, C-type lectin, platelet, sugar-binding protein, activator, snake venom; 2.40A {Crotalus durissus terrificus} SCOP: d.169.1.1 PDB: 1uos_B Length = 125 Back     alignment and structure
>3g8l_A Lectin-related NK cell receptor LY49L1; natural killer cell receptor, immune system; 2.50A {Mus musculus} Length = 190 Back     alignment and structure
>1c3a_B Flavocetin-A: beta subunit; C-type lectin-like domains, membrane protein; 2.50A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1v4l_B Length = 125 Back     alignment and structure
>4a42_A GH89_CBM32-4, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: MSE; 1.55A {Clostridium perfringens} Length = 149 Back     alignment and structure
>3bdw_B NKG2-A/NKG2-B type II integral membrane protein; NK cells, receptor, glycoprotein, lectin, signal-A transmembrane, immune system receptor; 2.50A {Homo sapiens} PDB: 3cdg_K 3cii_H Length = 120 Back     alignment and structure
>1hq8_A NKG2-D; homodimer, CIS-proline, apoptosis; 1.95A {Mus musculus} SCOP: d.169.1.1 PDB: 1jsk_A 1kcg_A* Length = 123 Back     alignment and structure
>1fm5_A Early activation antigen CD69; C-type lectin-like domain, natural killer cell receptor, lectin, C-type lectin, immune system; 2.27A {Homo sapiens} SCOP: d.169.1.1 Length = 199 Back     alignment and structure
>1mpu_A NKG2-D type II integral membrane protein; C-type lectin-like domain, immune system; 2.50A {Homo sapiens} SCOP: d.169.1.1 PDB: 1hyr_B Length = 138 Back     alignment and structure
>3gpr_D Rhodocetin subunit delta; disulfide bond, lectin, secreted, toxin, cell adhesion; 3.20A {Calloselasma rhodostoma} Length = 124 Back     alignment and structure
>1ukm_B EMS16 B chain, EMS16 subunit B; domain swapping, C-type lectin, toxin; HET: NAG; 1.90A {Echis multisquamatus} SCOP: d.169.1.1 PDB: 1v7p_B* Length = 128 Back     alignment and structure
>3rs1_A C-type lectin domain family 2 member I; C-type lectin-like, ligand of NK receptor, natural killer CE receptors, surface of activated T lymphocytes; 1.94A {Mus musculus} Length = 122 Back     alignment and structure
>1srz_A Gamma-aminobutyric acid type B receptor, subunit 1; GABA(B) receptor, CIS-trans isomerization, CCP module, sushi domain; NMR {Rattus norvegicus} SCOP: g.18.1.1 PDB: 1ss2_A Length = 68 Back     alignment and structure
>1srz_A Gamma-aminobutyric acid type B receptor, subunit 1; GABA(B) receptor, CIS-trans isomerization, CCP module, sushi domain; NMR {Rattus norvegicus} SCOP: g.18.1.1 PDB: 1ss2_A Length = 68 Back     alignment and structure
>1srz_A Gamma-aminobutyric acid type B receptor, subunit 1; GABA(B) receptor, CIS-trans isomerization, CCP module, sushi domain; NMR {Rattus norvegicus} SCOP: g.18.1.1 PDB: 1ss2_A Length = 68 Back     alignment and structure
>4a3z_A GH89_CBM32, alpha-N-acetylglucosaminidase family protein; hydrolase, family 32 carbohydrate-binding module; HET: MSE; 1.55A {Clostridium perfringens} PDB: 4a6o_A* Length = 161 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 Back     alignment and structure
>4a4a_A Alpha-N-acetylglucosaminidase family protein; hydrolase, 2 hydrolase, family 89 glycoside hydrolase, mucin carbohydrate-active enzyme; HET: NDG GAL; 1.90A {Clostridium perfringens} PDB: 2vcc_A 2vc9_A* 2vcb_A* 2vca_A Length = 914 Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Length = 329 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query881
2gsx_A 951 Complement receptor type 2; SCR domain, CCP domain 100.0
2gsx_A 951 Complement receptor type 2; SCR domain, CCP domain 100.0
1haq_A1213 Complement factor H; immunology, glycoprotein, com 100.0
1haq_A 1213 Complement factor H; immunology, glycoprotein, com 100.0
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 100.0
2q7z_A 1931 Complement receptor type 1; SCR domain, blood grou 100.0
1ntj_A320 Complement receptor related protein; immunology, g 100.0
2c8i_E316 CD55, complement decay-accelerating factor; picorn 100.0
2c8i_E316 CD55, complement decay-accelerating factor; picorn 100.0
1ntj_A320 Complement receptor related protein; immunology, g 100.0
1qub_A319 Protein (human BETA2-glycoprotein I); short consen 100.0
1qub_A319 Protein (human BETA2-glycoprotein I); short consen 100.0
1ntl_A 551 CRRY-IG; immunology, complement, glycoprotein, SCR 100.0
1ntl_A551 CRRY-IG; immunology, complement, glycoprotein, SCR 100.0
3o8e_B252 Membrane cofactor protein; short consensus repeat, 100.0
3o8e_B252 Membrane cofactor protein; short consensus repeat, 100.0
2wii_C277 H factor 1, complement factor H; immune system, su 100.0
1ok3_A254 CD55, CR, DAF, complement decay-accelerating facto 100.0
2wii_C277 H factor 1, complement factor H; immune system, su 100.0
1ok3_A254 CD55, CR, DAF, complement decay-accelerating facto 100.0
3iyp_F381 Complement decay-accelerating factor; virus, recep 100.0
3iyp_F381 Complement decay-accelerating factor; virus, recep 100.0
2xrb_A290 Complement regulatory protein CRRY; immune system, 100.0
2xrb_A290 Complement regulatory protein CRRY; immune system, 100.0
1rid_A244 Complement control protein; regulation, SCR, immun 100.0
1rid_A244 Complement control protein; regulation, SCR, immun 100.0
2j22_A148 Fucolectin-related protein; carbohydrate-binding p 100.0
2j1v_A151 Fucolectin-related protein; carbohydrate-binding p 100.0
1k12_A158 Lectin; beta barrel, protein carbohydrate complex, 100.0
4gwi_A153 Lectinolysin, platelet aggregation factor SM-HPAF; 100.0
3erb_A223 Complement C2; C3/C5 convertase, short consensus r 99.97
3erb_A223 Complement C2; C3/C5 convertase, short consensus r 99.97
3lei_A153 Platelet aggregation factor SM-HPAF; lectin domain 99.97
3cqo_A293 FBP32; F-lectin, fucolectin, sugar binding protein 99.95
3sw0_X188 H factor 1, complement factor H; innate immune res 99.95
2uwn_A187 H factor 1, human complement factor H; alternative 99.95
2uwn_A187 H factor 1, human complement factor H; alternative 99.95
3sw0_X188 H factor 1, complement factor H; innate immune res 99.94
3hrz_D 741 Complement factor B; serine protease, glycosilated 99.94
3hrz_D 741 Complement factor B; serine protease, glycosilated 99.94
3cqo_A293 FBP32; F-lectin, fucolectin, sugar binding protein 99.93
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 99.9
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 99.9
3gov_A155 MAsp-1; complement, serine protease, beta barrel, 99.88
3gov_A155 MAsp-1; complement, serine protease, beta barrel, 99.87
2qy0_A159 Complement C1R subcomponent; serine protease, beta 99.87
1gkn_A128 Complement receptor type 1; module, SCR, structure 99.86
2qy0_A159 Complement C1R subcomponent; serine protease, beta 99.86
1ly2_A130 CD21, complement receptor type 2; epstein BARR vir 99.86
1gkn_A128 Complement receptor type 1; module, SCR, structure 99.86
1ly2_A130 CD21, complement receptor type 2; epstein BARR vir 99.85
1gkg_A136 Complement receptor type 1; module, SCR, structure 99.85
1h03_P125 Complement decay-accelerating factor; immune syste 99.85
1h03_P125 Complement decay-accelerating factor; immune syste 99.85
1gkg_A136 Complement receptor type 1; module, SCR, structure 99.84
2aty_A376 Complement receptor chimeric conjugate CR2-IG; imm 99.83
2a55_A133 C4B-binding protein; complement, SCR, CCP module, 99.83
2aty_A376 Complement receptor chimeric conjugate CR2-IG; imm 99.82
2a55_A133 C4B-binding protein; complement, SCR, CCP module, 99.82
4a42_A149 GH89_CBM32-4, alpha-N-acetylglucosaminidase family 99.79
4a3z_A161 GH89_CBM32, alpha-N-acetylglucosaminidase family p 99.78
3r62_A129 H factor 1, complement factor H; immunity, repeati 99.75
3r62_A129 H factor 1, complement factor H; immunity, repeati 99.75
2yby_A124 Complement factor H; immune system, complement reg 99.73
2yby_A124 Complement factor H; immune system, complement reg 99.72
4ayi_A125 H factor 1, complement factor H; immune system, an 99.71
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 99.69
4ayi_A125 H factor 1, complement factor H; immune system, an 99.69
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 99.63
2ehf_A73 CUB and sushi domain-containing protein 1; CUB and 99.59
2b5i_D217 Interleukin-2 receptor alpha chain; four-helix bun 99.54
2ehf_A73 CUB and sushi domain-containing protein 1; CUB and 99.51
2yra_A74 Seizure 6-like protein isoform 3; disulfide bond, 99.5
2b5i_D217 Interleukin-2 receptor alpha chain; four-helix bun 99.47
2j1a_A150 Hyaluronidase, CBM32; protein-carbohydrate interac 99.47
1gpz_A399 Complement C1R component; hydrolase, activation, i 99.46
4a4a_A914 Alpha-N-acetylglucosaminidase family protein; hydr 99.44
3ggl_A169 Putative chitobiase; X-RAY, structure genomics, NE 99.43
1gpz_A399 Complement C1R component; hydrolase, activation, i 99.43
2yra_A74 Seizure 6-like protein isoform 3; disulfide bond, 99.41
3f2z_A159 Uncharacterized protein BF3579; the present C-term 99.4
1srz_A68 Gamma-aminobutyric acid type B receptor, subunit 1 99.36
3tvj_A86 Mannan-binding lectin serine protease 2 A chain; i 99.36
2jda_A145 Yecbm32; hypothetical protein, carbohydrate- bindi 99.35
4a41_A161 GH89_CBM32-5, alpha-N-acetylglucosaminidase family 99.35
2v72_A143 CBM32, EXO-alpha-sialidase; galactose, bacterial p 99.35
3eyp_A469 Putative alpha-L-fucosidase; structural genomics, 99.3
1srz_A68 Gamma-aminobutyric acid type B receptor, subunit 1 99.26
3tvj_A86 Mannan-binding lectin serine protease 2 A chain; i 99.24
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 99.12
2py2_A136 Antifreeze protein type II; type II antifreeze pro 99.11
1h8u_A117 MBP, eosinophil granule major basic protein 1; lec 99.1
2msb_A115 Mannose-binding protein-A; lectin; HET: BMA MAN; 1 99.09
1rdl_1113 SUB-MBP-C, mannose-binding protein-C; C-type lecti 99.07
4aqb_A361 Mannan-binding lectin serine protease 1; blood clo 99.07
2zib_A133 Type II antifreeze protein; thermal hysteresis, le 99.06
3alu_A157 Lectin CEL-IV, C-type; C-type lectin, raffinose, s 99.06
2v5d_A737 O-GLCNACASE NAGJ; family 32 carbohydrate binding m 99.05
3bn6_A158 Lactadherin; anticoagulation, anti-coagulation, an 99.05
3kqg_A182 Langerin, C-type lectin domain family 4 member K; 99.04
1byf_A125 TC14, protein (polyandrocarpa lectin); C-type lect 99.03
1w8o_A601 Bacterial sialidase; 3D-structure, glycosidase, hy 99.03
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 99.03
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 99.02
1tdq_B130 Aggrecan core protein; extracellular matrix, lecti 99.02
1egg_A147 Macrophage mannose receptor; C-type lectin, sugar 99.01
1rtm_1149 Mannose-binding protein-A; lectin; 1.80A {Rattus n 99.0
1jzn_A135 Galactose-specific lectin; C-type lectin, protein- 99.0
2h2t_B175 Low affinity immunoglobulin epsilon FC receptor ( 99.0
1wk1_A150 Hypothetical protein YK1067A12; lectin C-type doma 98.99
1wmz_A140 Lectin CEL-I, N-acetyl-D-galactosamine-specific C- 98.99
2ox9_A140 Collectin placenta 1; C-type lectin, sugar binding 98.98
1buu_A168 Protein (mannose-binding protein A); lectin, HOST 98.98
1hup_A141 Mannose-binding protein; alpha-helical coiled-coil 98.98
1tn3_A137 Tetranectin; plasminogen binding, kringle 4, C-typ 98.96
1qdd_A144 Lithostathine; pancreatic stone inhibitor, metal b 98.95
3ues_A478 Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydr 98.95
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.95
3c22_A156 C-type lectin domain family 4 member K; coiled coi 98.94
1gz2_A142 Ovocleidin-17, OC-17 ovocleidin; structural protei 98.93
1htn_A182 Tetranectin; plasminogen binding, kringle 4, alpha 98.92
3pbf_A148 Pulmonary surfactant-associated protein A; collect 98.92
4aqb_A361 Mannan-binding lectin serine protease 1; blood clo 98.92
2kv3_A131 Regenerating islet-derived protein 4; GISP, C-type 98.91
2afp_A129 Protein (SEA raven type II antifreeze protein); re 98.9
1uv0_A149 Pancreatitis-associated protein 1; lectin, C-type, 98.89
2b6b_D175 CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahe 98.89
1dv8_A128 Asialoglycoprotein receptor 1; C-type lectin CRD, 98.88
1pwb_A177 SP-D, PSP-D, pulmonary surfactant-associated prote 98.88
1ypq_A135 Oxidised low density lipoprotein (lectin-like) rec 98.88
1sl6_A184 C-type lectin DC-signr; sugar binding protein; HET 98.84
1c3a_A135 Flavocetin-A: alpha subunit; C-type lectin-like do 98.82
2xr6_A170 CD209 antigen; sugar binding protein, carbohydrate 98.82
4deq_A218 Neuropilin-1, vascular endothelial growth factor; 98.81
2c6u_A122 CLEC1B protein; lectin, rhodocytin, aggretin, C-ty 98.81
1ukm_A134 EMS16 A chain, EMS16 subunit A; domain swapping, C 98.81
2ls8_A156 C-type lectin domain family 4 member D; structural 98.3
3bx4_A136 Aggretin alpha chain; toxin; 1.70A {Agkistrodon rh 98.8
1hq8_A123 NKG2-D; homodimer, CIS-proline, apoptosis; 1.95A { 98.79
2bpd_A142 Dectin-1; receptor, beta-glucan, fungal recognitio 98.78
1fvu_A133 Botrocetin alpha chain; VON WILLBRAND factor modul 98.78
2wuh_A178 Discoidin domain receptor 2; receptor-peptide comp 98.78
3vpp_A132 C-type lectin domain family 9 member A; dendritic 98.77
2qqi_A318 Neuropilin-1; VEGF receptor, semaphorin receptor, 98.75
1mpu_A138 NKG2-D type II integral membrane protein; C-type l 98.75
1fvu_B125 Botrocetin beta chain; VON WILLBRAND factor modula 98.74
2qqi_A318 Neuropilin-1; VEGF receptor, semaphorin receptor, 98.74
1umr_A135 Convulxin alpha, CVX alpha; lectin, C-type lectin, 98.74
1czt_A160 Protein (coagulation factor V); membrane-binding, 98.72
2e3x_B134 Coagulation factor X-activating enzyme light CHAI; 98.72
2vuv_A129 Codakine; sugar-binding protein, C-type, lectin, m 98.71
2e3x_C122 Coagulation factor X-activating enzyme light CHAI; 98.71
1oz7_A131 Echicetin A-chain; platelet aggregation, dimer, to 98.7
1j34_A129 Coagulation factor IX-binding protein A chain; mag 98.7
2vm9_A257 Discoidin-2, discoidin II; DDR, lectin, aggregatio 98.7
1sb2_A133 Rhodocetin alpha subunit; C-type lectin, domain sw 98.7
2yc2_A139 IFT25, intraflagellar transport protein 25; transp 98.7
3hny_M159 Coagulation factor VIII; blood clotting, acute pha 98.69
1ukm_B128 EMS16 B chain, EMS16 subunit B; domain swapping, C 98.69
3bdw_A123 Natural killer cells antigen CD94; NK cells, recep 98.68
1oz7_B123 Echicetin B-chain; platelet aggregation, dimer, to 98.67
1jwi_B125 Platelet aggregation inducer; domain swapping, C-t 98.67
1umr_C125 Convulxin beta, CVX beta; lectin, C-type lectin, p 98.66
1j34_B123 Coagulation factor IX-binding protein B chain; mag 98.66
3gpr_C134 Rhodocetin subunit gamma; disulfide bond, lectin, 98.66
3ubu_A131 Agglucetin subunit alpha-1; platelet inhibiting, a 98.65
3g8k_A130 Lectin-related NK cell receptor LY49L1; natural ki 98.65
2qqj_A325 Neuropilin-2; VEGF receptor, semaphorin receptor, 98.64
2yfu_A155 Carbohydrate binding family 6; sugar binding prote 98.64
3bx4_B146 Aggretin beta chain; toxin; 1.70A {Agkistrodon rho 98.63
2zxq_A1376 Endo-alpha-N-acetylgalactosaminidase; broken TIM b 98.63
1c3a_B125 Flavocetin-A: beta subunit; C-type lectin-like dom 98.62
3ubu_B126 Agglucetin subunit beta-2; platelet inhibiting, ag 98.61
1sb2_B129 Rhodocetin beta subunit; C-type lectin, domain swa 98.59
2qqm_A450 Neuropilin-1; VEGF receptor, semaphorin receptor, 98.57
1jwi_A131 Bitiscetin; domain swapping, C-type lectin, toxin; 98.57
1tvg_A153 LOC51668 protein; cell cycle, structural genomics, 98.56
3hnm_A172 Putative chitobiase; PSI-2, protein structure init 98.55
3ff7_C112 Killer cell lectin-like receptor subfamily G membe 98.55
2w1s_A192 Hyaluronoglucosaminidase; hexosaminidase, family 3 98.51
3bdw_B120 NKG2-A/NKG2-B type II integral membrane protein; N 98.47
3rs1_A122 C-type lectin domain family 2 member I; C-type lec 98.46
2qqj_A325 Neuropilin-2; VEGF receptor, semaphorin receptor, 98.44
3gpr_D124 Rhodocetin subunit delta; disulfide bond, lectin, 98.43
2yhf_A118 C-type lectin domain family 5 member A; immune sys 98.43
3gdb_A937 Endo-D, putative uncharacterized protein SPR0440; 98.41
3ff9_A115 Killer cell lectin-like receptor subfamily G membe 98.39
3c8j_A203 Natural killer cell receptor LY49C; MHC, virus, im 98.37
3hup_A130 Early activation antigen CD69; C-type lectin-like 98.34
3g8l_A190 Lectin-related NK cell receptor LY49L1; natural ki 98.32
3m9z_A139 Killer cell lectin-like receptor subfamily B MEMB; 98.27
2qqo_A460 Neuropilin-2; VEGF receptor, semaphorin receptor, 98.21
2qqk_A579 Neuropilin-2; VEGF receptor, semaphorin receptor, 98.21
2qqm_A450 Neuropilin-1; VEGF receptor, semaphorin receptor, 98.21
1fm5_A199 Early activation antigen CD69; C-type lectin-like 98.14
2qqk_A579 Neuropilin-2; VEGF receptor, semaphorin receptor, 98.05
2qqo_A460 Neuropilin-2; VEGF receptor, semaphorin receptor, 98.04
4ag4_A351 Epithelial discoidin domain-containing receptor 1; 98.02
4gz9_A577 Neuropilin-1, A5 protein; multi-domain, cell-CELL 98.01
1sdd_B647 Coagulation factor V; copper-binding protein, cofa 98.01
2r7e_B770 Coagulation factor VIII; ceruloplasmin fold, cuppe 98.01
1sdd_B647 Coagulation factor V; copper-binding protein, cofa 97.95
4gz9_A577 Neuropilin-1, A5 protein; multi-domain, cell-CELL 97.93
2r7e_B770 Coagulation factor VIII; ceruloplasmin fold, cuppe 97.9
2wn3_A254 Discoidin-1 subunit A; type-H lectin, cell adhesio 97.88
2psm_F78 Interleukin-15 receptor alpha chain; cytokine, gly 97.81
2psm_F78 Interleukin-15 receptor alpha chain; cytokine, gly 97.66
1elv_A 333 Complement C1S component; trypsin-like serin prote 97.36
1elv_A 333 Complement C1S component; trypsin-like serin prote 97.19
2cho_A716 Glucosaminidase, hexosaminiase; O-GLCNACASE, hydro 96.98
2z3q_B107 Interleukin-15 receptor alpha chain; protein-prote 96.81
2z3q_B107 Interleukin-15 receptor alpha chain; protein-prote 96.74
4f4o_C 347 Haptoglobin; globin fold, serine protease fold, co 96.17
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 95.83
1jhj_A171 APC10; beta sandwich, jellyroll, cell cycle; 1.60A 95.37
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 95.11
1md8_A 329 C1R complement serine protease; innate immunity, a 94.97
1md8_A329 C1R complement serine protease; innate immunity, a 94.28
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 89.51
3gza_A443 Putative alpha-L-fucosidase; NP_812709.1, structur 89.32
2y38_A403 Laminin subunit alpha-5; structural protein, cell 82.68
>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=7.3e-70  Score=679.82  Aligned_cols=536  Identities=26%  Similarity=0.527  Sum_probs=442.8

Q ss_pred             CCCCCCCCcceeeEee-cccccCCCeEEEECCCCceeeCCceeEeC-C----CcccCCCCcccccccCCCCCCcceeeee
Q psy11954        278 ANCGSPDRHVNTTFVG-TVSTKLGSTISYACPEGNMLVGSATRTCK-E----GFWTGVAPTCQYFQLQPMDVPNLVLYLF  351 (881)
Q Consensus       278 ~~C~~p~~~~ng~~~~-~~~~~~gs~v~y~C~~Gy~l~G~~~~~C~-~----G~Ws~~~P~C~~~~~~p~~~~~~~~~~~  351 (881)
                      +.|+.|+.+.||.+.. ...|.+|++|+|+|+.||+|+|..+++|+ +    |.|+...|.|+....             
T Consensus         1 i~C~~Pp~i~nG~~~~~~~~~~~G~~v~y~C~~Gy~l~G~~~~~C~~~~~~~g~Ws~~~P~C~~~~~-------------   67 (951)
T 2gsx_A            1 ISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNK-------------   67 (951)
T ss_pred             CcCCCCCCCCCCcEeccCCcccCCCEEEEECCCCcEEeCCCceEEeCCCCcccEECCCCceeEeccc-------------
Confidence            4699999999999875 45899999999999999999999999999 3    679998999986100             


Q ss_pred             hhhhhhhccccccccCCCCCcCCCceEEecCCcccCCcEEEEEeCCCcEEeCcceEEecCCCcccC-CCCccccc---cc
Q psy11954        352 LSKLFRESYERLNVDCGKLEHIEHGTVTLETTRTTHGAVAIYACHENYTLIGETRRVCGDGGKWNG-TEPQCLFD---WC  427 (881)
Q Consensus       352 ~~~~~~~~~~~~~~~C~~~~~~~nG~~~~~~~~~~~g~~~~~~C~~Gy~l~G~~~~~C~~~G~Ws~-~~P~C~~~---~C  427 (881)
                                  .+.|+.| .++||.+......|.+|++|+|+|++||.|.|..+++|+++|+|++ ..|.|+++   .|
T Consensus        68 ------------~~~C~~p-~~~~g~~~~~~~~~~~g~~v~~~C~~Gy~l~g~~~~~C~~~g~Ws~~~~p~C~~~~~~~C  134 (951)
T 2gsx_A           68 ------------YSSCPEP-IVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKSVWCQANNMWGPTRLPTCVSVFPLEC  134 (951)
T ss_pred             ------------cccCCCC-cCCCCeEeccCCCccCCCEEEEEeCCCceEcCCCceEECCCCccCCCCCCCcccCccCcC
Confidence                        1468765 4566665433356889999999999999999999999999999998 58999987   89


Q ss_pred             CCCCCcCCCeEEcC---CCCCCCeEEEEcCCCceeeCcee-----------------eecCCCCCCCCCCceeeccCcee
Q psy11954        428 AEPPQISGGIVTTS---GRRTGSVATYSCEPGFILFGSNV-----------------NIDCGRLTAIPYGSISYLNETTY  487 (881)
Q Consensus       428 ~~p~~~~ng~~~~~---~~~~gs~~~y~C~~Gy~l~g~~~-----------------~i~C~~p~~~~nG~~~~~~~~~~  487 (881)
                      +.|+.+.||.+...   .+.+|++++|+|+.||.|.|...                 .+.|+.|+.+.||.+... ..+.
T Consensus       135 ~~~~~~~~g~~~~~~~~~~~~G~~v~y~C~~GY~l~g~~~~~C~~~G~Ws~~~p~C~~~~C~~~~~~~nG~v~~~-~~~~  213 (951)
T 2gsx_A          135 PALPMIHNGHHTSENVGSIAPGLSVTYSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGKVKEP-PILR  213 (951)
T ss_pred             cCCCcCCcceEecccCcccCCCCEEEEECCCCccCCCcccEEeCCCCeECCCCCccccccCCCCCCCCCCcEeCC-CCcc
Confidence            99999999998753   57889999999999999998743                 378988889999999764 4578


Q ss_pred             cCcEEEEEcCCCcEEcCCCceeeccCC---cccCCcccccccccccceeccccccccccccCCCCCCCCCeeEEEec-cc
Q psy11954        488 LGSEVLYSCSRNYRLVGHPRRSCLESK---VWSDTAPKCEGKATKDIKVCSNVAVDRREIRCPEPTLPAHSILSVTG-ND  563 (881)
Q Consensus       488 ~gs~v~y~C~~Gy~L~G~~~~tC~~~G---~Ws~~~P~C~~~~~~~~~~~~~~~~~~~~i~C~~p~~~~ng~~~~~~-~~  563 (881)
                      +|++|+|+|++||.|.|...++|+.+|   .|+ ..|+|+                  .+.|+.|+.+.||.+.... ..
T Consensus       214 ~g~~~~~~C~~Gy~l~g~~~~~C~~~G~~~~W~-~~P~C~------------------~i~C~~p~~i~nG~~~~~~~~~  274 (951)
T 2gsx_A          214 VGVTANFFCDEGYRLQGPPSSRCVIAGQGVAWT-KMPVCE------------------EIFCPSPPPILNGRHIGNSLAN  274 (951)
T ss_pred             cCCEEEEEcCCCCEECccccEEEEcCCCccccC-CCCcCC------------------cCcCCCCCCcCCCceeccccCc
Confidence            999999999999999999999999999   997 789999                  7899999999999877643 45


Q ss_pred             cccCceEEEecCCCCcc-ceeeecCCCCCCcceeeeeec----CCccccc---------------eeee-ccCCCCCccc
Q psy11954        564 RLYGRTLIKTADSASSV-ATYKIGALPTLPAHSILSVTG----NDRLYGR---------------TLIK-TADSASSVAT  622 (881)
Q Consensus       564 ~~~g~~~~~~~~~~~~~-~~~~~~~~p~~~~~~~~~~~~----~~~~~~~---------------~~~~-~~~~~~~~~~  622 (881)
                      ..||+++.+.|+.+... ..+..      .....+.|..    ++.|.+.               +.+. .+........
T Consensus       275 ~~~g~~v~y~C~~g~~~~~~y~l------~G~~~~~C~~~~~~~g~Ws~~~P~C~~~~~~~~C~~P~~~~~~~~~~~~~~  348 (951)
T 2gsx_A          275 VSYGSIVTYTCDPDPEEGVNFIL------IGESTLRCTVDSQKTGTWSGPAPRCELSTSAVQCPHPQILRGRMVSGQKDR  348 (951)
T ss_pred             ccCCCEEEEEcCCCCCCcceEEe------cCCceEEeccCCCCCCcCCCCCCcccccccceecCCCCCCCCcEeecCCCc
Confidence            67899999999887100 00110      0011122222    1222211               0011 1111123467


Q ss_pred             ccCCCEEEEEcCCCCeecCCCceEecCCCceecCCCeeecccCCCCCCCCCceEEecCC-CeecCcEEEEEcCCCceecC
Q psy11954        623 YKIGALVKYRCERGYKVEGEPLSTCEDTGSWSGSVPECIYVDCGNPETVPNGGFTLTSN-ATYYGTAVLYECDENYRLEG  701 (881)
Q Consensus       623 ~~~Gs~v~~~C~~GY~l~G~~~~tC~~~G~Ws~~~P~C~~v~C~~p~~~~nG~~~~~~~-~~~~g~~v~y~C~~Gy~L~G  701 (881)
                      |.+|++|+|+|++||.|.|+..++|+++|+|++..|+|+++ |+.|+.+.||.+..... .|.+|++|+|+|++||.|.|
T Consensus       349 y~~g~~v~f~C~~Gy~l~G~~~~~C~~~G~Ws~~~P~C~~~-C~~p~~~~ng~~~~~~~~~~~~g~~v~~~C~~Gy~l~G  427 (951)
T 2gsx_A          349 YTYNDTVIFACMFGFTLKGSKQIRCNAQGTWEPSAPVCEKE-CQAPPNILNGQKEDRHMVRFDPGTSIKYSCNPGYVLVG  427 (951)
T ss_pred             cccCCEEEEEcCCCCEEcCCCceEECCCCcCCCCCcccccc-cCCCCcccCCeEecCCCcccCCCCEEEEEcCCCCEECC
Confidence            89999999999999999999999999999999999999998 99999999999876432 35579999999999999999


Q ss_pred             CceeeeccCCcccCCCCceeec--------------------------------ccCceeeeecCCeecCCCCccc--CC
Q psy11954        702 HARRLCLENGTWSSGLPTCKGN--------------------------------EGHARRLCLENGTWSSGLPTCK--GC  747 (881)
Q Consensus       702 ~~~~~C~~~G~Ws~~~P~C~~~--------------------------------~g~~~~~C~~~g~ws~~~p~C~--~C  747 (881)
                      +..++|+++|+|++..|+|+.+                                .|...++|+.+|.|++..|+|+  .|
T Consensus       428 ~~~~~C~~~G~Ws~~~p~C~~~~C~~~~~~~~~~~~~~~~~~~~~~~C~~Gy~l~G~~~~~C~~~g~Ws~~~p~C~~i~C  507 (951)
T 2gsx_A          428 EESIQCTSEGVWTPPVPQCKVAACEATGRQLLTKPQHQFVRPDVNSSCGEGYKLSGSVYQECQGTIPWFMEIRLCKEITC  507 (951)
T ss_pred             CCCeEECCCCcCCCCCCccceeeCCCCCcccccCCCCceecCeEEEEcCCCcEEcCCCeeEccCcccccCCCceecceeC
Confidence            9999999999999999999762                                2556789999999999999997  89


Q ss_pred             CCCCccc---c---CCCCccCCCeEEE-ccCC------ceeeccccCceeEEEEc----cCCeeecCCCccc----cccC
Q psy11954        748 KTPKKSL---T---RPALSCLPGKRFY-YHRG------IFRLQNTQKVSYTRTCT----KRGTWSGHIPTCK----AIDC  806 (881)
Q Consensus       748 ~~p~~~~---~---~~~~~~~g~~v~~-C~~G------y~l~G~~~~~~~~~~C~----~~G~Ws~~~p~C~----~v~C  806 (881)
                      ++|+.+.   +   ....|.+|++|+| |++|      |.|.|+     .+++|+    ++|.|++..|+|+    .+.|
T Consensus       508 ~~pp~i~nG~~~~~~~~~~~~g~~v~y~C~~g~~~~~~y~l~G~-----~~~~C~~~~~~~G~Ws~~~P~C~~~~~~~~C  582 (951)
T 2gsx_A          508 PPPPVIYNGAHTGSSLEDFPYGTTVTYTCNPGPERGVEFSLIGE-----STIRCTSNDQERGTWSGPAPLCKLSLLAVQC  582 (951)
T ss_pred             CCCCCCCCCeEeCCCCCccccCCEEEEEcCCCCCCCceEEEecC-----ceEEecccCCCCccCcCCCceeecCCCccCC
Confidence            9988771   1   1235889999999 9999      999999     999999    8999999999996    7899


Q ss_pred             CCCCCCCCceEEEccCcccCCCEEEEEcCCCCEEcCCCeeEeCCCCeecCCCCceeccCCCCCCC
Q psy11954        807 SHPGSIDNGRVIIMNQTTTYNSAVEYHCVPQYQRIGPYLRKCMEDGSWSGDEPRCEKRFNSGIPG  871 (881)
Q Consensus       807 ~~p~~~~nG~~~~~~~~~~~g~~v~f~C~~Gy~l~G~~~~~C~~~G~Ws~~~P~C~~~~~~~~~~  871 (881)
                      +.|..+.++.+......+.||++|+|+|++||.|.|+.+++|++||+|++.+|+|+++.|..+..
T Consensus       583 ~~p~~~~~~~~~~~~~~~~~g~~v~~~C~~Gy~l~G~~~~~C~~~g~Ws~~~P~C~~~~C~~~~~  647 (951)
T 2gsx_A          583 SHVHIANGYKISGKEAPYFYNDTVTFKCYSGFTLKGSSQIRCKADNTWDPEIPVCEKETCQHVRQ  647 (951)
T ss_pred             cCCCCCCCceEeCCCCcccCCCEEEEEeCCCCEEcCCCceEECCCCCCCCCCCcceecccCCCCC
Confidence            99987766666555556889999999999999999999999999999999999999998876643
>2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Back     alignment and structure
>1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Back     alignment and structure
>2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Back     alignment and structure
>1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} Back     alignment and structure
>1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} Back     alignment and structure
>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Back     alignment and structure
>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Back     alignment and structure
>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Back     alignment and structure
>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Back     alignment and structure
>3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Back     alignment and structure
>3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Back     alignment and structure
>2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Back     alignment and structure
>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Back     alignment and structure
>2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Back     alignment and structure
>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Back     alignment and structure
>3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Back     alignment and structure
>3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Back     alignment and structure
>2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A Back     alignment and structure
>2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A Back     alignment and structure
>1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Back     alignment and structure
>1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Back     alignment and structure
>2j22_A Fucolectin-related protein; carbohydrate-binding protein, carbohydrate binding protein; 1.8A {Streptococcus pneumoniae} Back     alignment and structure
>2j1v_A Fucolectin-related protein; carbohydrate-binding protein, carbohydrate binding protein; HET: NAG GAL FUC; 1.45A {Streptococcus pneumoniae} PDB: 2j1r_A* 2j1t_A* 2j1u_A* 2j1s_A* Back     alignment and structure
>1k12_A Lectin; beta barrel, protein carbohydrate complex, sugar binding protein; HET: FUC; 1.90A {Anguilla anguilla} SCOP: b.18.1.15 Back     alignment and structure
>4gwi_A Lectinolysin, platelet aggregation factor SM-HPAF; cholesterol-dependent cytolysins, lewis antigens, F-type LEC glycan binding; HET: BDZ; 1.60A {Streptococcus mitis} PDB: 4gwj_A* 3lei_A* 3leg_A* 3le0_A* 3lek_A* Back     alignment and structure
>3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Back     alignment and structure
>3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Back     alignment and structure
>3lei_A Platelet aggregation factor SM-HPAF; lectin domain of lectinolysin, fucose, blood clotting, nicke; HET: FUC; 1.90A {Streptococcus mitis} PDB: 3leg_A* 3le0_A* 3lek_A* Back     alignment and structure
>3cqo_A FBP32; F-lectin, fucolectin, sugar binding protein; HET: FUC; 2.32A {Morone saxatilis} Back     alignment and structure
>3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Back     alignment and structure
>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Back     alignment and structure
>2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Back     alignment and structure
>3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>3cqo_A FBP32; F-lectin, fucolectin, sugar binding protein; HET: FUC; 2.32A {Morone saxatilis} Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A Back     alignment and structure
>3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A Back     alignment and structure
>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} Back     alignment and structure
>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Back     alignment and structure
>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} Back     alignment and structure
>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Back     alignment and structure
>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Back     alignment and structure
>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Back     alignment and structure
>1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A Back     alignment and structure
>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Back     alignment and structure
>1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Back     alignment and structure
>1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Back     alignment and structure
>4a42_A GH89_CBM32-4, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: MSE; 1.55A {Clostridium perfringens} Back     alignment and structure
>4a3z_A GH89_CBM32, alpha-N-acetylglucosaminidase family protein; hydrolase, family 32 carbohydrate-binding module; HET: MSE; 1.55A {Clostridium perfringens} PDB: 4a6o_A* Back     alignment and structure
>3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C Back     alignment and structure
>3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C Back     alignment and structure
>2yby_A Complement factor H; immune system, complement regulation, innate immunity, infec; 1.58A {Mus musculus} Back     alignment and structure
>2yby_A Complement factor H; immune system, complement regulation, innate immunity, infec; 1.58A {Mus musculus} Back     alignment and structure
>4ayi_A H factor 1, complement factor H; immune system, antigens; 2.31A {Homo sapiens} PDB: 4aye_A 4ayd_A 4aym_A 2w80_A 2w81_A 2jgw_A 2jgx_A Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>4ayi_A H factor 1, complement factor H; immune system, antigens; 2.31A {Homo sapiens} PDB: 4aye_A 4ayd_A 4aym_A 2w80_A 2w81_A 2jgw_A 2jgx_A Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2b5i_D Interleukin-2 receptor alpha chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 3nfp_I 3iu3_I 1z92_B 2erj_A* Back     alignment and structure
>2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2b5i_D Interleukin-2 receptor alpha chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 3nfp_I 3iu3_I 1z92_B 2erj_A* Back     alignment and structure
>2j1a_A Hyaluronidase, CBM32; protein-carbohydrate interaction, glycoside hydrolase, GH84C, hydrolase; HET: GAL; 1.49A {Clostridium perfringens} PDB: 2j1e_A* 2j7m_A* Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>4a4a_A Alpha-N-acetylglucosaminidase family protein; hydrolase, 2 hydrolase, family 89 glycoside hydrolase, mucin carbohydrate-active enzyme; HET: NDG GAL; 1.90A {Clostridium perfringens} PDB: 2vcc_A 2vc9_A* 2vcb_A* 2vca_A Back     alignment and structure
>3ggl_A Putative chitobiase; X-RAY, structure genomics, NESG, BTR324A, Q8A9F0_bactn, BT_0865, PSI-2, protein structure initiative; 3.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3f2z_A Uncharacterized protein BF3579; the present C-terminal domain is predominantly composed of B strands., structural genomics, PSI-2; 1.30A {Bacteroides fragilis} PDB: 2kd7_A Back     alignment and structure
>1srz_A Gamma-aminobutyric acid type B receptor, subunit 1; GABA(B) receptor, CIS-trans isomerization, CCP module, sushi domain; NMR {Rattus norvegicus} SCOP: g.18.1.1 PDB: 1ss2_A Back     alignment and structure
>3tvj_A Mannan-binding lectin serine protease 2 A chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Back     alignment and structure
>2jda_A Yecbm32; hypothetical protein, carbohydrate- binding module, sugar-binding protein, pectin, plant cell WALL, galacturonic acid; 1.35A {Yersinia enterocolitica} PDB: 2jd9_A Back     alignment and structure
>4a41_A GH89_CBM32-5, alpha-N-acetylglucosaminidase family protein; hydrolase, family 89 glycoside hydrolase, family 32 carbohyd binding module; HET: GAL; 1.55A {Clostridium perfringens} PDB: 4a44_A* 4a45_A* 4aax_A* Back     alignment and structure
>2v72_A CBM32, EXO-alpha-sialidase; galactose, bacterial pathogen, carbohydrate-binding module, sugar-binding protein; HET: GAL; 2.25A {Clostridium perfringens} Back     alignment and structure
>3eyp_A Putative alpha-L-fucosidase; structural genomics, hydrolase, lipoprotein, PSI-2, protein initiative; 1.90A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1srz_A Gamma-aminobutyric acid type B receptor, subunit 1; GABA(B) receptor, CIS-trans isomerization, CCP module, sushi domain; NMR {Rattus norvegicus} SCOP: g.18.1.1 PDB: 1ss2_A Back     alignment and structure
>3tvj_A Mannan-binding lectin serine protease 2 A chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2py2_A Antifreeze protein type II; type II antifreeze protein; 1.70A {Clupea harengus} Back     alignment and structure
>1h8u_A MBP, eosinophil granule major basic protein 1; lectin, eosinophil granule protein, EMBP; 1.8A {Homo sapiens} SCOP: d.169.1.1 PDB: 2brs_A* Back     alignment and structure
>2msb_A Mannose-binding protein-A; lectin; HET: BMA MAN; 1.70A {Rattus rattus} SCOP: d.169.1.1 PDB: 1msb_A 1ytt_A* Back     alignment and structure
>1rdl_1 SUB-MBP-C, mannose-binding protein-C; C-type lectin, calcium-binding protein; HET: MMA; 1.70A {Rattus rattus} SCOP: d.169.1.1 PDB: 1rdj_1* 1rdk_1* 1rdi_1* 1rdm_1* 1rdn_1* 1rdo_1 1bv4_A 1kza_1* 1kzb_1* 1kzc_1* 1kzd_1* 1kze_1* Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Back     alignment and structure
>2zib_A Type II antifreeze protein; thermal hysteresis, lectin; 1.34A {Brachyopsis rostratus} Back     alignment and structure
>3alu_A Lectin CEL-IV, C-type; C-type lectin, raffinose, sugar binding protein; HET: RAF; 1.65A {Cucumaria echinata} PDB: 3als_A* 3alt_A* Back     alignment and structure
>2v5d_A O-GLCNACASE NAGJ; family 32 carbohydrate binding module, glycosidase, GH84, GH84C, CBM32, hydrolase, coiled coil; 3.30A {Clostridium perfringens} Back     alignment and structure
>3bn6_A Lactadherin; anticoagulation, anti-coagulation, anticoagulant, anti- coagulant, membrane binding, phosphatidyl-serine binding; 1.67A {Bos taurus} PDB: 2pqs_A Back     alignment and structure
>3kqg_A Langerin, C-type lectin domain family 4 member K; trimer, NECK and CRD, coiled coil, immune system; 2.30A {Homo sapiens} Back     alignment and structure
>1byf_A TC14, protein (polyandrocarpa lectin); C-type lectin, galactose-specific, sugar binding protein; 2.00A {Polyandrocarpa misakiensis} SCOP: d.169.1.1 PDB: 1tlg_A* Back     alignment and structure
>1w8o_A Bacterial sialidase; 3D-structure, glycosidase, hydrolase, beta- propeller; HET: LBT CIT; 1.70A {Micromonospora viridifaciens} SCOP: b.1.18.2 b.18.1.1 b.68.1.1 PDB: 1w8n_A* 1eut_A 1euu_A* 1wcq_A* 2bzd_A* 2ber_A* 1eur_A 1eus_A* Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>1tdq_B Aggrecan core protein; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: d.169.1.1 Back     alignment and structure
>1egg_A Macrophage mannose receptor; C-type lectin, sugar binding protein; 2.30A {Homo sapiens} SCOP: d.169.1.1 PDB: 1egi_A Back     alignment and structure
>1rtm_1 Mannose-binding protein-A; lectin; 1.80A {Rattus norvegicus} SCOP: d.169.1.1 h.1.1.1 PDB: 1kwu_A* 1kwv_A* 1kwt_A* 1kwx_A* 1kwy_A* 1kx1_A* 1kww_A 1kwz_A* 1kx0_A* 3kmb_1* 1kmb_1* 2kmb_1* 4kmb_1* 1afb_1* 1afa_1* 1afd_1 1bch_1* 1bcj_1* 1fif_A 1fih_A* Back     alignment and structure
>1jzn_A Galactose-specific lectin; C-type lectin, protein-disaccharide complex, sugar binding P; HET: BGC GAL; 2.20A {Crotalus atrox} SCOP: d.169.1.1 PDB: 1muq_A* Back     alignment and structure
>2h2t_B Low affinity immunoglobulin epsilon FC receptor ( IGE receptor) (FC-epsilon-RII)...; C-type lectin, calcium-bound, lectin domain; 1.30A {Homo sapiens} PDB: 2h2r_A 1t8c_A 1t8d_A Back     alignment and structure
>1wk1_A Hypothetical protein YK1067A12; lectin C-type domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Caenorhabditis elegans} SCOP: d.169.1.1 Back     alignment and structure
>1wmz_A Lectin CEL-I, N-acetyl-D-galactosamine-specific C-type; C-type lectin, N-acetylgalactosamine, invertebrate, sugar binding protein; HET: NGA A2G; 1.70A {Cucumaria echinata} SCOP: d.169.1.1 PDB: 1wmy_A* Back     alignment and structure
>2ox9_A Collectin placenta 1; C-type lectin, sugar binding protein; HET: GAL NAG FUC; 1.95A {Mus musculus} PDB: 2ox8_A Back     alignment and structure
>1buu_A Protein (mannose-binding protein A); lectin, HOST defense, metalloprotein, sugar binding protein; 1.90A {Rattus norvegicus} SCOP: d.169.1.1 h.1.1.1 Back     alignment and structure
>1hup_A Mannose-binding protein; alpha-helical coiled-coil, C-type lectin; 2.50A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 Back     alignment and structure
>1tn3_A Tetranectin; plasminogen binding, kringle 4, C-type lectin, carbohydrate recognition domain; 2.00A {Homo sapiens} SCOP: d.169.1.1 PDB: 1rjh_A 3l9j_C Back     alignment and structure
>1qdd_A Lithostathine; pancreatic stone inhibitor, metal binding protein; HET: SIA NDG GAL; 1.30A {Homo sapiens} SCOP: d.169.1.1 PDB: 1lit_A Back     alignment and structure
>3ues_A Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydrolase inhibitor complex; HET: DFU; 1.60A {Bifidobacterium longum subsp} PDB: 3mo4_A* 3uet_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3c22_A C-type lectin domain family 4 member K; coiled coil, glycoprotein, membrane, signal-anchor, transmembrane, immune system, sugar binding protein; 1.50A {Homo sapiens} PDB: 3p5g_A* 3p5d_A* 3p5f_A* 3p5e_A* 3p5h_A* 3p5i_A* 3p7g_A* 3p7f_A* 3p7h_A* 3bc7_A* 3bbs_A* 3bc6_A* Back     alignment and structure
>1gz2_A Ovocleidin-17, OC-17 ovocleidin; structural protein, CTLD, eggshell structural protein, phosphoprotein, sugar-binding protein, glycoprotein; HET: SEP; 1.5A {Gallus gallus} SCOP: d.169.1.1 Back     alignment and structure
>1htn_A Tetranectin; plasminogen binding, kringle 4, alpha-helical coiled coil, C-type lectin, carbohydrate recognition domain; 2.80A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 Back     alignment and structure
>3pbf_A Pulmonary surfactant-associated protein A; collectin, carbohydrate binding, lectin, mannose, sugar BIND protein; 1.80A {Rattus norvegicus} PDB: 1r14_A* 1r13_A* 3paq_A* 3par_A 3pak_A Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Back     alignment and structure
>2kv3_A Regenerating islet-derived protein 4; GISP, C-type lectin, REG IV, disulfide bond, glycoPro lectin, secreted, sugar binding protein; NMR {Homo sapiens} Back     alignment and structure
>2afp_A Protein (SEA raven type II antifreeze protein); recombinant SEA raven protein, solution backbone fold, C- type lectin; NMR {Hemitripterus americanus} SCOP: d.169.1.1 Back     alignment and structure
>1uv0_A Pancreatitis-associated protein 1; lectin, C-type, secreted, inflammatory response, acute phase; 1.78A {Homo sapiens} SCOP: d.169.1.1 PDB: 2go0_A Back     alignment and structure
>2b6b_D CD209 antigen; cryo EM dengue CRD DC-SIGN, icosahedral virus, virus-recepto; 25.00A {Homo sapiens} SCOP: d.169.1.1 Back     alignment and structure
>1dv8_A Asialoglycoprotein receptor 1; C-type lectin CRD, signaling protein; 2.30A {Homo sapiens} SCOP: d.169.1.1 Back     alignment and structure
>1pwb_A SP-D, PSP-D, pulmonary surfactant-associated protein D; collectin, C-type lectin, alpha-helical coiled coil, carbohydrate recognition domain; HET: GLC; 1.40A {Homo sapiens} SCOP: d.169.1.1 h.1.1.1 PDB: 1pw9_A* 3ikn_A* 3ikp_A* 3ikq_A* 3ikr_A* 2rie_A* 2ggx_A* 2ggu_A* 2ork_A* 2orj_A* 2ria_A* 2rib_A* 2ric_A* 2rid_A* 2os9_A* 3dbz_A 3g81_A* 3g83_A* 1b08_A 3g84_A* ... Back     alignment and structure
>1ypq_A Oxidised low density lipoprotein (lectin-like) receptor 1; oxidized low density lipoprotein receptor, LOX-1, CTLD, C- type lectin like domain; 1.40A {Homo sapiens} SCOP: d.169.1.1 PDB: 1ypu_A 1yxk_A 3vlg_A 1ypo_A 1yxj_A Back     alignment and structure
>1sl6_A C-type lectin DC-signr; sugar binding protein; HET: GAL NDG FUC; 2.25A {Homo sapiens} SCOP: d.169.1.1 PDB: 1xar_A Back     alignment and structure
>1c3a_A Flavocetin-A: alpha subunit; C-type lectin-like domains, membrane protein; 2.50A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1v4l_A Back     alignment and structure
>2xr6_A CD209 antigen; sugar binding protein, carbohydrate binding, mannose; HET: MAN 07B; 1.35A {Homo sapiens} PDB: 1sl4_A* 2it6_A* 1k9i_A* 2xr5_A* 1sl5_A* 2it5_A* 1xph_A 1k9j_A* Back     alignment and structure
>4deq_A Neuropilin-1, vascular endothelial growth factor; coagulation factor domain, heparin binding domain, angiogene protein binding-cytokine complex; 2.65A {Homo sapiens} PDB: 1kmx_A 1vgh_A 2vgh_A Back     alignment and structure
>2c6u_A CLEC1B protein; lectin, rhodocytin, aggretin, C-type lectin-like, platelets, thrombosis; 1.6A {Homo sapiens} Back     alignment and structure
>1ukm_A EMS16 A chain, EMS16 subunit A; domain swapping, C-type lectin, toxin; HET: NAG; 1.90A {Echis multisquamatus} SCOP: d.169.1.1 PDB: 1v7p_A* Back     alignment and structure
>2ls8_A C-type lectin domain family 4 member D; structural genomics, NEW YORK structural genomics research consortium, nysgrc, PSI-biology, immune system; NMR {Homo sapiens} Back     alignment and structure
>3bx4_A Aggretin alpha chain; toxin; 1.70A {Agkistrodon rhodostoma} PDB: 2vrp_A Back     alignment and structure
>1hq8_A NKG2-D; homodimer, CIS-proline, apoptosis; 1.95A {Mus musculus} SCOP: d.169.1.1 PDB: 1jsk_A 1kcg_A* Back     alignment and structure
>2bpd_A Dectin-1; receptor, beta-glucan, fungal recognition, C-type lectin-like domain, CTLD, carbohydrate; 1.5A {Mus musculus} PDB: 2bph_A 2bpe_A 2cl8_A* Back     alignment and structure
>1fvu_A Botrocetin alpha chain; VON WILLBRAND factor modulator, C-type lectin, metal- binding, loop exchanged dimer, toxin; 1.80A {Bothrops jararaca} SCOP: d.169.1.1 PDB: 1ijk_B 1u0n_B 1u0o_A Back     alignment and structure
>2wuh_A Discoidin domain receptor 2; receptor-peptide complex, transferase, nucleotide-binding, tyrosine-protein kinase; 1.60A {Homo sapiens} PDB: 2z4f_A Back     alignment and structure
>3vpp_A C-type lectin domain family 9 member A; dendritic cell, C-type lectin-like domain, membrane, immune; 1.64A {Homo sapiens} Back     alignment and structure
>2qqi_A Neuropilin-1; VEGF receptor, semaphorin receptor, angiogenesis, developmen protein, differentiation, glycoprotein, heparan sulfate, ME neurogenesis; 1.80A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 PDB: 2orz_A 2orx_A 2qqn_A 3i97_A* 1kex_A Back     alignment and structure
>1mpu_A NKG2-D type II integral membrane protein; C-type lectin-like domain, immune system; 2.50A {Homo sapiens} SCOP: d.169.1.1 PDB: 1hyr_B Back     alignment and structure
>1fvu_B Botrocetin beta chain; VON WILLBRAND factor modulator, C-type lectin, metal- binding, loop exchanged dimer, toxin; 1.80A {Bothrops jararaca} SCOP: d.169.1.1 PDB: 1ijk_C 1u0n_C 1u0o_B Back     alignment and structure
>2qqi_A Neuropilin-1; VEGF receptor, semaphorin receptor, angiogenesis, developmen protein, differentiation, glycoprotein, heparan sulfate, ME neurogenesis; 1.80A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 PDB: 2orz_A 2orx_A 2qqn_A 3i97_A* 1kex_A Back     alignment and structure
>1umr_A Convulxin alpha, CVX alpha; lectin, C-type lectin, platelet, sugar-binding protein, activator, snake venom; 2.40A {Crotalus durissus terrificus} SCOP: d.169.1.1 PDB: 1uos_A Back     alignment and structure
>1czt_A Protein (coagulation factor V); membrane-binding, discoidin family, calcium- independent, blood clotting; 1.87A {Homo sapiens} SCOP: b.18.1.2 PDB: 1czs_A 1czv_A Back     alignment and structure
>2e3x_B Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} Back     alignment and structure
>2vuv_A Codakine; sugar-binding protein, C-type, lectin, mannose, invertebrate; HET: CIT; 1.3A {Codakia orbicularis} PDB: 2vuz_A* Back     alignment and structure
>2e3x_C Coagulation factor X-activating enzyme light CHAI; disintegrin, metalloproteinase, C-type lectin, hydrolase, BL clotting, toxin; HET: NAG MAN GM6; 2.91A {Daboia russellii siamensis} Back     alignment and structure
>1oz7_A Echicetin A-chain; platelet aggregation, dimer, toxin; 2.40A {Echis carinatus} SCOP: d.169.1.1 Back     alignment and structure
>1j34_A Coagulation factor IX-binding protein A chain; magnesium ION, calcium ION, GLA domain, protein binding/blood clotting complex; HET: CGU; 1.55A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1bj3_A* 1j35_A* 1x2t_A* 1x2w_A 1ixx_A 1y17_A 1wt9_A 1iod_A* Back     alignment and structure
>2vm9_A Discoidin-2, discoidin II; DDR, lectin, aggregation, cell adhesion; 1.75A {Dictyostelium discoideum} PDB: 2vmc_A* 2vmd_A* 2vme_A* Back     alignment and structure
>1sb2_A Rhodocetin alpha subunit; C-type lectin, domain swapping, toxin; 1.90A {Calloselasma rhodostoma} SCOP: d.169.1.1 PDB: 3gpr_A Back     alignment and structure
>2yc2_A IFT25, intraflagellar transport protein 25; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_A Back     alignment and structure
>3hny_M Coagulation factor VIII; blood clotting, acute phase, blood coagulation, calcium, DIS mutation, disulfide bond, glycoprotein, hemophilia; 1.07A {Homo sapiens} SCOP: b.18.1.2 PDB: 3hnb_M 3hob_M 1d7p_M 1iqd_C 1cfg_A 1fac_A Back     alignment and structure
>1ukm_B EMS16 B chain, EMS16 subunit B; domain swapping, C-type lectin, toxin; HET: NAG; 1.90A {Echis multisquamatus} SCOP: d.169.1.1 PDB: 1v7p_B* Back     alignment and structure
>3bdw_A Natural killer cells antigen CD94; NK cells, receptor, glycoprotein, lectin, signal-A transmembrane, immune system receptor; 2.50A {Homo sapiens} SCOP: d.169.1.1 PDB: 3cdg_J 1b6e_A 3cii_G Back     alignment and structure
>1oz7_B Echicetin B-chain; platelet aggregation, dimer, toxin; 2.40A {Echis carinatus} SCOP: d.169.1.1 Back     alignment and structure
>1jwi_B Platelet aggregation inducer; domain swapping, C-type lectin, toxin; 2.00A {Bitis arietans} SCOP: d.169.1.1 PDB: 1uex_B Back     alignment and structure
>1umr_C Convulxin beta, CVX beta; lectin, C-type lectin, platelet, sugar-binding protein, activator, snake venom; 2.40A {Crotalus durissus terrificus} SCOP: d.169.1.1 PDB: 1uos_B Back     alignment and structure
>1j34_B Coagulation factor IX-binding protein B chain; magnesium ION, calcium ION, GLA domain, protein binding/blood clotting complex; HET: CGU; 1.55A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1bj3_B 1ixx_B* 1j35_B* 1x2t_B* 1x2w_B 1wt9_B 1iod_B 1y17_B Back     alignment and structure
>3gpr_C Rhodocetin subunit gamma; disulfide bond, lectin, secreted, toxin, cell adhesion; 3.20A {Calloselasma rhodostoma} Back     alignment and structure
>3ubu_A Agglucetin subunit alpha-1; platelet inhibiting, agkisacucetin, dimer, toxin, C-type LEC GPIB inhibitor, GPIB binding; 1.91A {Deinagkistrodon acutus} Back     alignment and structure
>2qqj_A Neuropilin-2; VEGF receptor, semaphorin receptor, developmental protein, differentiation, glycoprotein, membrane, neurogenesis, transmembrane; 1.95A {Homo sapiens} Back     alignment and structure
>2yfu_A Carbohydrate binding family 6; sugar binding protein; 1.65A {Clostridium thermocellum} PDB: 2y8j_A* 2y9i_A* 2y9s_A 2yb7_A* 2y8m_A 2yfz_A* 2yg0_A* Back     alignment and structure
>3bx4_B Aggretin beta chain; toxin; 1.70A {Agkistrodon rhodostoma} PDB: 2vrp_B Back     alignment and structure
>2zxq_A Endo-alpha-N-acetylgalactosaminidase; broken TIM barrel, glycosidase, hydrolase; 2.00A {Bifidobacterium longum} Back     alignment and structure
>1c3a_B Flavocetin-A: beta subunit; C-type lectin-like domains, membrane protein; 2.50A {Trimeresurus flavoviridis} SCOP: d.169.1.1 PDB: 1v4l_B Back     alignment and structure
>3ubu_B Agglucetin subunit beta-2; platelet inhibiting, agkisacucetin, dimer, toxin, C-type LEC GPIB inhibitor, GPIB binding; 1.91A {Deinagkistrodon acutus} Back     alignment and structure
>1sb2_B Rhodocetin beta subunit; C-type lectin, domain swapping, toxin; 1.90A {Calloselasma rhodostoma} SCOP: d.169.1.1 PDB: 3gpr_B Back     alignment and structure
>2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 Back     alignment and structure
>1jwi_A Bitiscetin; domain swapping, C-type lectin, toxin; 2.00A {Bitis arietans} SCOP: d.169.1.1 PDB: 1uex_A Back     alignment and structure
>1tvg_A LOC51668 protein; cell cycle, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 1.60A {Homo sapiens} SCOP: b.18.1.9 PDB: 1xpw_A Back     alignment and structure
>3hnm_A Putative chitobiase; PSI-2, protein structure initiative, northeast structural genomics consortium, NESG, BTR319D.BT_411; 3.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ff7_C Killer cell lectin-like receptor subfamily G member 1; KLRG1-cadherin complex, calcium, cell adhesion, cell junction, cell membrane; 1.80A {Homo sapiens} SCOP: d.169.1.0 Back     alignment and structure
>2w1s_A Hyaluronoglucosaminidase; hexosaminidase, family 32 carbohydrate binding module, toxin, secreted, virulence, hydrolase, glycosidase; HET: MSE BTB; 1.45A {Clostridium perfringens} PDB: 2w1q_A* 2w1u_A* 2wdb_A* Back     alignment and structure
>3bdw_B NKG2-A/NKG2-B type II integral membrane protein; NK cells, receptor, glycoprotein, lectin, signal-A transmembrane, immune system receptor; 2.50A {Homo sapiens} PDB: 3cdg_K 3cii_H Back     alignment and structure
>3rs1_A C-type lectin domain family 2 member I; C-type lectin-like, ligand of NK receptor, natural killer CE receptors, surface of activated T lymphocytes; 1.94A {Mus musculus} Back     alignment and structure
>2qqj_A Neuropilin-2; VEGF receptor, semaphorin receptor, developmental protein, differentiation, glycoprotein, membrane, neurogenesis, transmembrane; 1.95A {Homo sapiens} Back     alignment and structure
>3gpr_D Rhodocetin subunit delta; disulfide bond, lectin, secreted, toxin, cell adhesion; 3.20A {Calloselasma rhodostoma} Back     alignment and structure
>2yhf_A C-type lectin domain family 5 member A; immune system; 1.90A {Homo sapiens} Back     alignment and structure
>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Back     alignment and structure
>3ff9_A Killer cell lectin-like receptor subfamily G member 1; natural killer cell receptor KLTG1, glycoprotein, membrane, phosphoprotein, signal-anchor; 1.80A {Mus musculus} SCOP: d.169.1.0 PDB: 3ff8_C Back     alignment and structure
>3c8j_A Natural killer cell receptor LY49C; MHC, virus, immune system; 2.60A {Mus musculus} SCOP: d.169.1.1 PDB: 3c8k_D 1p4l_D 1ja3_A 1p1z_D Back     alignment and structure
>3hup_A Early activation antigen CD69; C-type lectin-like domain, disulfide bond, glycoprotein, LEC membrane, phosphoprotein, signal-anchor, transmembrane; 1.37A {Homo sapiens} SCOP: d.169.1.1 PDB: 1e87_A 1e8i_A 3cck_A Back     alignment and structure
>3g8l_A Lectin-related NK cell receptor LY49L1; natural killer cell receptor, immune system; 2.50A {Mus musculus} Back     alignment and structure
>3m9z_A Killer cell lectin-like receptor subfamily B MEMB; C-type lectin-like domain, domain swapping, disulfide bond, transmembrane protein; 1.70A {Mus musculus} SCOP: d.169.1.0 PDB: 3t3a_A Back     alignment and structure
>2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} Back     alignment and structure
>2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Back     alignment and structure
>2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 Back     alignment and structure
>1fm5_A Early activation antigen CD69; C-type lectin-like domain, natural killer cell receptor, lectin, C-type lectin, immune system; 2.27A {Homo sapiens} SCOP: d.169.1.1 Back     alignment and structure
>2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Back     alignment and structure
>2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} Back     alignment and structure
>4ag4_A Epithelial discoidin domain-containing receptor 1; immune system-transferase complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>4gz9_A Neuropilin-1, A5 protein; multi-domain, cell-CELL signaling, plexin, semaphorin, VEGF, glycosilated, transmembrane, signaling protein; HET: NAG BMA; 2.70A {Mus musculus} PDB: 4gza_H Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>4gz9_A Neuropilin-1, A5 protein; multi-domain, cell-CELL signaling, plexin, semaphorin, VEGF, glycosilated, transmembrane, signaling protein; HET: NAG BMA; 2.70A {Mus musculus} PDB: 4gza_H Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>2wn3_A Discoidin-1 subunit A; type-H lectin, cell adhesion, discoidin domain, lectin; HET: NGA GAL 1PG; 1.59A {Dictyostelium discoideum} PDB: 2w94_A* 2wn2_A* 2w95_A* Back     alignment and structure
>2psm_F Interleukin-15 receptor alpha chain; cytokine, glycoprotein, secreted, alternative splicing, endoplasmic reticulum, golgi apparatus, membrane; 2.19A {Mus musculus} SCOP: g.18.1.1 Back     alignment and structure
>2psm_F Interleukin-15 receptor alpha chain; cytokine, glycoprotein, secreted, alternative splicing, endoplasmic reticulum, golgi apparatus, membrane; 2.19A {Mus musculus} SCOP: g.18.1.1 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>2cho_A Glucosaminidase, hexosaminiase; O-GLCNACASE, hydrolase, N-acetylglucosamine; 1.85A {Bacteroides thetaiotaomicron} SCOP: a.246.1.1 c.1.8.10 d.92.2.3 PDB: 2chn_A 2vvn_A* 2vvs_A* 2x0h_A* 2xm2_A* 2w4x_A* 2w66_A* 2w67_A* 2wca_A* 2xj7_A* 2xm1_A* 2j47_A* 2jiw_A* 2wzh_A* 2wzi_A* 2j4g_A* Back     alignment and structure
>2z3q_B Interleukin-15 receptor alpha chain; protein-protein complex, cytokine/cytokine receptor complex; 1.85A {Homo sapiens} SCOP: g.18.1.1 PDB: 2z3r_B 2ers_A Back     alignment and structure
>2z3q_B Interleukin-15 receptor alpha chain; protein-protein complex, cytokine/cytokine receptor complex; 1.85A {Homo sapiens} SCOP: g.18.1.1 PDB: 2z3r_B 2ers_A Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>1jhj_A APC10; beta sandwich, jellyroll, cell cycle; 1.60A {Homo sapiens} SCOP: b.18.1.9 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3gza_A Putative alpha-L-fucosidase; NP_812709.1, structural genomic center for structural genomics, JCSG; HET: MSE EPE; 1.60A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 881
d1k12a_158 b.18.1.15 (A:) Fucose binding lectin {European eel 7e-22
d2ok5a361 g.18.1.1 (A:77-137) Complement factor B {Human (Ho 5e-14
d2ok5a361 g.18.1.1 (A:77-137) Complement factor B {Human (Ho 2e-13
d2ok5a361 g.18.1.1 (A:77-137) Complement factor B {Human (Ho 4e-12
d2ok5a361 g.18.1.1 (A:77-137) Complement factor B {Human (Ho 7e-12
d2ok5a361 g.18.1.1 (A:77-137) Complement factor B {Human (Ho 1e-08
d2ok5a361 g.18.1.1 (A:77-137) Complement factor B {Human (Ho 4e-08
d1h03p263 g.18.1.1 (P:67-129) Complement decay-accelerating 2e-13
d1h03p263 g.18.1.1 (P:67-129) Complement decay-accelerating 3e-11
d1h03p263 g.18.1.1 (P:67-129) Complement decay-accelerating 2e-10
d1h03p263 g.18.1.1 (P:67-129) Complement decay-accelerating 3e-10
d1h03p263 g.18.1.1 (P:67-129) Complement decay-accelerating 1e-07
d1h03p263 g.18.1.1 (P:67-129) Complement decay-accelerating 1e-05
d1h03p263 g.18.1.1 (P:67-129) Complement decay-accelerating 0.001
d1quba460 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human ( 2e-13
d1quba460 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human ( 2e-10
d1quba460 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human ( 5e-10
d1quba460 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human ( 2e-09
d1quba460 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human ( 4e-06
d1quba460 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human ( 8e-06
d1quba460 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human ( 0.001
d1g40a459 g.18.1.1 (A:185-243) Complement control protein {V 2e-13
d1g40a459 g.18.1.1 (A:185-243) Complement control protein {V 2e-10
d1g40a459 g.18.1.1 (A:185-243) Complement control protein {V 2e-09
d1g40a459 g.18.1.1 (A:185-243) Complement control protein {V 4e-09
d1g40a459 g.18.1.1 (A:185-243) Complement control protein {V 1e-08
d1g40a459 g.18.1.1 (A:185-243) Complement control protein {V 3e-06
d1ly2a263 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Hu 6e-13
d1ly2a263 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Hu 4e-09
d1ly2a263 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Hu 1e-07
d1ly2a263 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Hu 3e-07
d1ly2a263 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Hu 3e-07
d1ly2a263 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Hu 4e-07
d2ok5a262 g.18.1.1 (A:138-199) Complement factor B {Human (H 9e-13
d2ok5a262 g.18.1.1 (A:138-199) Complement factor B {Human (H 5e-12
d2ok5a262 g.18.1.1 (A:138-199) Complement factor B {Human (H 4e-10
d2ok5a262 g.18.1.1 (A:138-199) Complement factor B {Human (H 7e-10
d2ok5a262 g.18.1.1 (A:138-199) Complement factor B {Human (H 1e-08
d2ok5a262 g.18.1.1 (A:138-199) Complement factor B {Human (H 7e-08
d1ly2a167 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Huma 2e-12
d1ly2a167 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Huma 1e-11
d1ly2a167 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Huma 8e-10
d1ly2a167 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Huma 4e-09
d1ly2a167 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Huma 2e-08
d1ly2a167 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Huma 3e-05
d1ly2a167 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Huma 0.002
d1g40a358 g.18.1.1 (A:127-184) Complement control protein {V 4e-12
d1g40a358 g.18.1.1 (A:127-184) Complement control protein {V 2e-10
d1g40a358 g.18.1.1 (A:127-184) Complement control protein {V 9e-10
d1g40a358 g.18.1.1 (A:127-184) Complement control protein {V 4e-09
d1g40a358 g.18.1.1 (A:127-184) Complement control protein {V 2e-08
d1g40a358 g.18.1.1 (A:127-184) Complement control protein {V 2e-04
d1g40a358 g.18.1.1 (A:127-184) Complement control protein {V 0.001
d2o39c264 g.18.1.1 (C:63-126) CD46 (membrane cofactor protei 5e-12
d2o39c264 g.18.1.1 (C:63-126) CD46 (membrane cofactor protei 5e-12
d2o39c264 g.18.1.1 (C:63-126) CD46 (membrane cofactor protei 1e-10
d2o39c264 g.18.1.1 (C:63-126) CD46 (membrane cofactor protei 5e-10
d2o39c264 g.18.1.1 (C:63-126) CD46 (membrane cofactor protei 3e-07
d2o39c264 g.18.1.1 (C:63-126) CD46 (membrane cofactor protei 1e-05
d1ppqa_68 g.18.1.1 (A:) Complement receptor 1, cr1 {Human (H 7e-12
d1ppqa_68 g.18.1.1 (A:) Complement receptor 1, cr1 {Human (H 2e-11
d1ppqa_68 g.18.1.1 (A:) Complement receptor 1, cr1 {Human (H 6e-09
d1ppqa_68 g.18.1.1 (A:) Complement receptor 1, cr1 {Human (H 1e-08
d1ppqa_68 g.18.1.1 (A:) Complement receptor 1, cr1 {Human (H 5e-08
d1ppqa_68 g.18.1.1 (A:) Complement receptor 1, cr1 {Human (H 9e-05
d1quba363 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human ( 8e-12
d1quba363 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human ( 8e-09
d1quba363 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human ( 1e-08
d1quba363 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human ( 3e-08
d1quba363 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human ( 2e-04
d1quba363 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human ( 3e-04
d1quba363 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human ( 0.002
d1quba258 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (H 9e-12
d1quba258 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (H 2e-11
d1quba258 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (H 5e-10
d1quba258 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (H 1e-09
d1quba258 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (H 2e-08
d1quba258 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (H 5e-07
d1hcca_59 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 1e-11
d1hcca_59 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 3e-10
d1hcca_59 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 6e-10
d1hcca_59 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 4e-09
d1hcca_59 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 6e-08
d1hcca_59 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 3e-05
d1hcca_59 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 3e-04
d1h03p162 g.18.1.1 (P:5-66) Complement decay-accelerating fa 1e-11
d1h03p162 g.18.1.1 (P:5-66) Complement decay-accelerating fa 4e-11
d1h03p162 g.18.1.1 (P:5-66) Complement decay-accelerating fa 5e-10
d1h03p162 g.18.1.1 (P:5-66) Complement decay-accelerating fa 2e-09
d1h03p162 g.18.1.1 (P:5-66) Complement decay-accelerating fa 2e-08
d1h03p162 g.18.1.1 (P:5-66) Complement decay-accelerating fa 2e-05
d1h03p162 g.18.1.1 (P:5-66) Complement decay-accelerating fa 0.001
d1hfia_62 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 2e-11
d1hfia_62 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 3e-09
d1hfia_62 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 5e-08
d1hfia_62 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 1e-07
d1hfia_62 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 2e-07
d1hfia_62 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 3e-05
d1hfia_62 g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum 9e-04
d1g40a262 g.18.1.1 (A:65-126) Complement control protein {Va 7e-11
d1g40a262 g.18.1.1 (A:65-126) Complement control protein {Va 1e-09
d1g40a262 g.18.1.1 (A:65-126) Complement control protein {Va 3e-08
d1g40a262 g.18.1.1 (A:65-126) Complement control protein {Va 5e-08
d1g40a262 g.18.1.1 (A:65-126) Complement control protein {Va 8e-08
d1g40a262 g.18.1.1 (A:65-126) Complement control protein {Va 4e-05
d1g40a262 g.18.1.1 (A:65-126) Complement control protein {Va 2e-04
d1gpza268 g.18.1.1 (A:290-357) Complement C1R protease domai 2e-10
d1gpza268 g.18.1.1 (A:290-357) Complement C1R protease domai 5e-10
d1gpza268 g.18.1.1 (A:290-357) Complement C1R protease domai 3e-07
d1gpza268 g.18.1.1 (A:290-357) Complement C1R protease domai 3e-05
d1gpza268 g.18.1.1 (A:290-357) Complement C1R protease domai 4e-04
d1gpza268 g.18.1.1 (A:290-357) Complement C1R protease domai 0.003
d1srza_68 g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norve 3e-10
d1srza_68 g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norve 1e-08
d1srza_68 g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norve 5e-08
d1srza_68 g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norve 2e-07
d1srza_68 g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norve 4e-06
d1srza_68 g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norve 4e-06
d1ok3a164 g.18.1.1 (A:1-64) Complement decay-accelerating fa 3e-10
d1ok3a164 g.18.1.1 (A:1-64) Complement decay-accelerating fa 6e-10
d1ok3a164 g.18.1.1 (A:1-64) Complement decay-accelerating fa 7e-08
d1ok3a164 g.18.1.1 (A:1-64) Complement decay-accelerating fa 2e-06
d1ok3a164 g.18.1.1 (A:1-64) Complement decay-accelerating fa 1e-04
d1ok3a164 g.18.1.1 (A:1-64) Complement decay-accelerating fa 0.004
d1elva268 g.18.1.1 (A:342-409) Complement C1S protease domai 3e-10
d1elva268 g.18.1.1 (A:342-409) Complement C1S protease domai 8e-09
d1elva268 g.18.1.1 (A:342-409) Complement C1S protease domai 7e-08
d1elva268 g.18.1.1 (A:342-409) Complement C1S protease domai 7e-08
d1elva268 g.18.1.1 (A:342-409) Complement C1S protease domai 3e-05
d1elva268 g.18.1.1 (A:342-409) Complement C1S protease domai 0.003
d1md8a276 g.18.1.1 (A:358-433) Complement C1R protease domai 8e-10
d1md8a276 g.18.1.1 (A:358-433) Complement C1R protease domai 2e-09
d1md8a276 g.18.1.1 (A:358-433) Complement C1R protease domai 2e-06
d1md8a276 g.18.1.1 (A:358-433) Complement C1R protease domai 2e-05
d1gkga270 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 7e-09
d1gkga270 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 7e-08
d1gkga270 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 5e-06
d1gkga270 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 8e-06
d1gkga270 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 7e-04
d1gkga270 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 0.002
d1q3xa275 g.18.1.1 (A:366-440) Mannan-binding lectin serine 7e-09
d1q3xa275 g.18.1.1 (A:366-440) Mannan-binding lectin serine 4e-08
d1q3xa275 g.18.1.1 (A:366-440) Mannan-binding lectin serine 1e-05
d1q3xa275 g.18.1.1 (A:366-440) Mannan-binding lectin serine 3e-05
d1quba162 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Hom 8e-09
d1quba162 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Hom 8e-09
d1quba162 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Hom 3e-08
d1quba162 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Hom 6e-07
d1quba162 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Hom 7e-05
d1quba162 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Hom 6e-04
d1gkna164 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {H 2e-08
d1gkna164 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {H 2e-07
d1gkna164 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {H 1e-05
d1gkna164 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {H 3e-05
d1gkna164 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {H 3e-04
d1ok3a264 g.18.1.1 (A:65-128) Complement decay-accelerating 3e-08
d1ok3a264 g.18.1.1 (A:65-128) Complement decay-accelerating 4e-07
d1ok3a264 g.18.1.1 (A:65-128) Complement decay-accelerating 3e-05
d1ok3a264 g.18.1.1 (A:65-128) Complement decay-accelerating 5e-05
d1ok3a264 g.18.1.1 (A:65-128) Complement decay-accelerating 1e-04
d1ok3a264 g.18.1.1 (A:65-128) Complement decay-accelerating 4e-04
d1h8ua_115 d.169.1.1 (A:) Eosinophil major basic protein {Hum 3e-08
d1w8oa2142 b.18.1.1 (A:506-647) Sialidase, C-terminal domain 5e-08
d2o39c162 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, 7e-08
d2o39c162 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, 6e-06
d2o39c162 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, 0.001
d2o39c162 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, 0.002
d1t8da1143 d.169.1.1 (A:1-143) Low affinity immunoglobulin ep 2e-07
d1ypqa1131 d.169.1.1 (A:140-270) Oxidised low density lipopro 3e-07
d2z3qb178 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit 3e-07
d2z3qb178 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit 5e-07
d2z3qb178 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit 6e-07
d2z3qb178 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit 1e-04
d2z3qb178 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit 0.002
d2z3qb178 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit 0.004
d1egga_136 d.169.1.1 (A:) Macrophage mannose receptor, CRD4 { 3e-06
d1zjka253 g.18.1.1 (A:311-363) Complement C1R protease domai 3e-06
d1zjka253 g.18.1.1 (A:311-363) Complement C1R protease domai 3e-05
d1zjka253 g.18.1.1 (A:311-363) Complement C1R protease domai 4e-05
d1zjka253 g.18.1.1 (A:311-363) Complement C1R protease domai 6e-04
d1zjka253 g.18.1.1 (A:311-363) Complement C1R protease domai 0.001
d2afpa_129 d.169.1.1 (A:) Type II antifreeze protein {Sea rav 5e-06
d1qdda_144 d.169.1.1 (A:) Lithostathine, inhibitor of stone f 9e-06
d1uv0a_140 d.169.1.1 (A:) Pancreatitis-associated protein 1 { 1e-05
d1jzna_135 d.169.1.1 (A:) Galactose-specific C-type lectin {W 1e-05
d3c8ja1122 d.169.1.1 (A:138-259) NK cell receptor {Mouse (Mus 1e-05
d1qo3c_133 d.169.1.1 (C:) NK cell receptor {Mouse (Mus muscul 2e-05
d1pwba1121 d.169.1.1 (A:235-355) Surfactant protein, lectin d 2e-05
d1hq8a_123 d.169.1.1 (A:) NK cell-activating receptor nkg2d { 2e-05
d2msba_112 d.169.1.1 (A:) Mannose-binding protein A, C-lectin 9e-05
d1tn3a_137 d.169.1.1 (A:) Tetranectin {Human (Homo sapiens) [ 1e-04
d1fvua_133 d.169.1.1 (A:) Snake coagglutinin alpha chain {Jar 1e-04
d1e87a_117 d.169.1.1 (A:) CD69 {Human (Homo sapiens) [TaxId: 2e-04
d1wmza_140 d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata [T 2e-04
d1g1ta1118 d.169.1.1 (A:1-118) E-selectin, C-lectin domain {H 2e-04
d1r13a1119 d.169.1.1 (A:110-228) Surfactant protein, lectin d 3e-04
d1v7pa_134 d.169.1.1 (A:) Snake coagglutinin alpha chain {Sna 4e-04
d1g1sa1118 d.169.1.1 (A:1-118) P-selectin, C-lectin domain {H 4e-04
d3bdwa1121 d.169.1.1 (A:59-179) CD94 {Human (Homo sapiens) [T 7e-04
d1wk1a_150 d.169.1.1 (A:) Hypothetical protein F28B4.3 {Caeno 8e-04
d1j34a_129 d.169.1.1 (A:) Snake coagglutinin alpha chain {Hab 0.001
d1tdqb_126 d.169.1.1 (B:) Aggrecan core protein {Rat (Rattus 0.002
d1rdl1_111 d.169.1.1 (1:) Mannose-binding protein A, C-lectin 0.002
d1jwib_123 d.169.1.1 (B:) Snake coagglutinin beta chain {Puff 0.003
d1k3ia2162 b.18.1.1 (A:-12-150) Galactose oxidase, N-terminal 0.004
d1umra_135 d.169.1.1 (A:) Snake coagglutinin alpha chain {Sou 0.004
>d1k12a_ b.18.1.15 (A:) Fucose binding lectin {European eel (Anguilla anguilla) [TaxId: 7936]} Length = 158 Back     information, alignment and structure

class: All beta proteins
fold: Galactose-binding domain-like
superfamily: Galactose-binding domain-like
family: Fucose binding lectin
domain: Fucose binding lectin
species: European eel (Anguilla anguilla) [TaxId: 7936]

 Score = 91.0 bits (225), Expect = 7e-22
 Identities = 53/177 (29%), Positives = 78/177 (44%), Gaps = 36/177 (20%)

Query: 18  SGTNVALRRPTNQSSTIRGA-----PSSNANDGELTTVHDGKRCTETQKEVSPWWQVDLL 72
           +  NVA+R    QS+ +RG       +SNA DG   +      CT +  + +PWW+VDLL
Sbjct: 7   TQENVAVRGKATQSAQLRGEHAANSEASNAIDGNRDSNFYHGSCTHSSGQANPWWRVDLL 66

Query: 73  RPYPIRIVRITTRGCCGHQPLQDLEIRVGNSTDLQKNPLCAWFPGTLGHQPLQDLEIRVG 132
           + Y I  V IT RG C  + +   EI +G                               
Sbjct: 67  QVYTITSVTITNRGDCCGERISGAEINIGQH----------------------------- 97

Query: 133 NSTDLQKNPLCAWFPGTLEEGITKSFTCARTLVGQNVFIQLVGVEGSLSLCEVEIFT 189
            +++   NP C+   G++  G TK+F C   ++G+ V   L   E SL LCEVE+  
Sbjct: 98  LASNGVNNPECSVI-GSMATGETKTFHCPAPMIGRYVVTYLPTSE-SLHLCEVEVNV 152
>d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 59 Back     information, alignment and structure
>d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 59 Back     information, alignment and structure
>d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 59 Back     information, alignment and structure
>d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 59 Back     information, alignment and structure
>d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 59 Back     information, alignment and structure
>d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 59 Back     information, alignment and structure
>d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1g40a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 58 Back     information, alignment and structure
>d1g40a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 58 Back     information, alignment and structure
>d1g40a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 58 Back     information, alignment and structure
>d1g40a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 58 Back     information, alignment and structure
>d1g40a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 58 Back     information, alignment and structure
>d1g40a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 58 Back     information, alignment and structure
>d1g40a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 58 Back     information, alignment and structure
>d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ppqa_ g.18.1.1 (A:) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1ppqa_ g.18.1.1 (A:) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1ppqa_ g.18.1.1 (A:) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1ppqa_ g.18.1.1 (A:) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1ppqa_ g.18.1.1 (A:) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1ppqa_ g.18.1.1 (A:) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1g40a2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 62 Back     information, alignment and structure
>d1g40a2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 62 Back     information, alignment and structure
>d1g40a2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 62 Back     information, alignment and structure
>d1g40a2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 62 Back     information, alignment and structure
>d1g40a2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 62 Back     information, alignment and structure
>d1g40a2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 62 Back     information, alignment and structure
>d1g40a2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 62 Back     information, alignment and structure
>d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1srza_ g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1srza_ g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1srza_ g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1srza_ g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1srza_ g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1srza_ g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1ok3a1 g.18.1.1 (A:1-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ok3a1 g.18.1.1 (A:1-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ok3a1 g.18.1.1 (A:1-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ok3a1 g.18.1.1 (A:1-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ok3a1 g.18.1.1 (A:1-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ok3a1 g.18.1.1 (A:1-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1md8a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1md8a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1md8a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1md8a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1gkga2 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1gkga2 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1gkga2 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1gkga2 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1gkga2 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1gkga2 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1q3xa2 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1q3xa2 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1q3xa2 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1q3xa2 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1quba1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1quba1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1quba1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1quba1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1quba1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1quba1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1gkna1 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1gkna1 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1gkna1 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1gkna1 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1gkna1 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ok3a2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ok3a2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ok3a2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ok3a2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ok3a2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1ok3a2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1h8ua_ d.169.1.1 (A:) Eosinophil major basic protein {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1w8oa2 b.18.1.1 (A:506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens [TaxId: 1881]} Length = 142 Back     information, alignment and structure
>d2o39c1 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2o39c1 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2o39c1 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2o39c1 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1t8da1 d.169.1.1 (A:1-143) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d1ypqa1 d.169.1.1 (A:140-270) Oxidised low density lipoprotein {Human (Homo sapiens) [TaxId: 9606]} Length = 131 Back     information, alignment and structure
>d2z3qb1 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2z3qb1 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2z3qb1 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2z3qb1 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2z3qb1 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2z3qb1 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d1egga_ d.169.1.1 (A:) Macrophage mannose receptor, CRD4 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 Back     information, alignment and structure
>d1zjka2 g.18.1.1 (A:311-363) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1zjka2 g.18.1.1 (A:311-363) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1zjka2 g.18.1.1 (A:311-363) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1zjka2 g.18.1.1 (A:311-363) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1zjka2 g.18.1.1 (A:311-363) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2afpa_ d.169.1.1 (A:) Type II antifreeze protein {Sea raven (Hemitripterus americanus) [TaxId: 8094]} Length = 129 Back     information, alignment and structure
>d1qdda_ d.169.1.1 (A:) Lithostathine, inhibitor of stone formation {Human (Homo sapiens) [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1uv0a_ d.169.1.1 (A:) Pancreatitis-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1jzna_ d.169.1.1 (A:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox) [TaxId: 8730]} Length = 135 Back     information, alignment and structure
>d3c8ja1 d.169.1.1 (A:138-259) NK cell receptor {Mouse (Mus musculus), ly49-c [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1qo3c_ d.169.1.1 (C:) NK cell receptor {Mouse (Mus musculus), ly49-a [TaxId: 10090]} Length = 133 Back     information, alignment and structure
>d1pwba1 d.169.1.1 (A:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d1hq8a_ d.169.1.1 (A:) NK cell-activating receptor nkg2d {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d2msba_ d.169.1.1 (A:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1tn3a_ d.169.1.1 (A:) Tetranectin {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1fvua_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]} Length = 133 Back     information, alignment and structure
>d1e87a_ d.169.1.1 (A:) CD69 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wmza_ d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata [TaxId: 40245]} Length = 140 Back     information, alignment and structure
>d1g1ta1 d.169.1.1 (A:1-118) E-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1r13a1 d.169.1.1 (A:110-228) Surfactant protein, lectin domain {Rat (Rattus norvegicus), SP-A [TaxId: 10116]} Length = 119 Back     information, alignment and structure
>d1v7pa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Snake (Echis multisquamatus), Ems16 [TaxId: 93050]} Length = 134 Back     information, alignment and structure
>d1g1sa1 d.169.1.1 (A:1-118) P-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d3bdwa1 d.169.1.1 (A:59-179) CD94 {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d1wk1a_ d.169.1.1 (A:) Hypothetical protein F28B4.3 {Caenorhabditis elegans [TaxId: 6239]} Length = 150 Back     information, alignment and structure
>d1j34a_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]} Length = 129 Back     information, alignment and structure
>d1tdqb_ d.169.1.1 (B:) Aggrecan core protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 126 Back     information, alignment and structure
>d1rdl1_ d.169.1.1 (1:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 Back     information, alignment and structure
>d1jwib_ d.169.1.1 (B:) Snake coagglutinin beta chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]} Length = 123 Back     information, alignment and structure
>d1k3ia2 b.18.1.1 (A:-12-150) Galactose oxidase, N-terminal domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 162 Back     information, alignment and structure
>d1umra_ d.169.1.1 (A:) Snake coagglutinin alpha chain {South american rattlesnake (Crotalus durissus terrificus), convulxin [TaxId: 8732]} Length = 135 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query881
d1k12a_158 Fucose binding lectin {European eel (Anguilla angu 99.96
d1w8oa2142 Sialidase, C-terminal domain {Micromonospora virid 99.47
d2ok5a361 Complement factor B {Human (Homo sapiens) [TaxId: 99.46
d1quba258 beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 99.44
d1tvga_136 Placental protein 25, pp25 {Human (Homo sapiens) [ 99.43
d1ppqa_68 Complement receptor 1, cr1 {Human (Homo sapiens) [ 99.42
d1gpza268 Complement C1R protease domains {Human (Homo sapie 99.41
d1quba460 beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 99.41
d2ok5a262 Complement factor B {Human (Homo sapiens) [TaxId: 99.41
d1ly2a167 Complement receptor 2, cr2 {Human (Homo sapiens) [ 99.41
d2o39c264 CD46 (membrane cofactor protein, MCP) {Human (Homo 99.41
d1g40a358 Complement control protein {Vaccinia virus [TaxId: 99.4
d1ly2a263 Complement receptor 2, cr2 {Human (Homo sapiens) [ 99.37
d1quba363 beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 99.37
d2ok5a361 Complement factor B {Human (Homo sapiens) [TaxId: 99.37
d1k3ia2162 Galactose oxidase, N-terminal domain {Fungi (Fusar 99.36
d1quba162 beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 99.35
d1hcca_59 Factor H, 15th and 16th modules {Human (Homo sapie 99.35
d1h03p263 Complement decay-accelerating factor (Daf, CD55) { 99.35
d1hfia_62 Factor H, 15th and 16th modules {Human (Homo sapie 99.34
d1q3xa275 Mannan-binding lectin serine protease 2 (MASP-2) d 99.34
d1g40a262 Complement control protein {Vaccinia virus [TaxId: 99.34
d1quba460 beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 99.33
d1g40a358 Complement control protein {Vaccinia virus [TaxId: 99.32
d1ppqa_68 Complement receptor 1, cr1 {Human (Homo sapiens) [ 99.32
d1ly2a167 Complement receptor 2, cr2 {Human (Homo sapiens) [ 99.31
d1quba258 beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 99.31
d1h03p162 Complement decay-accelerating factor (Daf, CD55) { 99.31
d2o39c264 CD46 (membrane cofactor protein, MCP) {Human (Homo 99.31
d1md8a276 Complement C1R protease domains {Human (Homo sapie 99.31
d1quba363 beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 99.3
d1gpza268 Complement C1R protease domains {Human (Homo sapie 99.3
d1elva268 Complement C1S protease domain {Human (Homo sapien 99.3
d1hcca_59 Factor H, 15th and 16th modules {Human (Homo sapie 99.28
d1gkga270 Complement receptor 1, cr1 {Human (Homo sapiens) [ 99.28
d2ok5a262 Complement factor B {Human (Homo sapiens) [TaxId: 99.28
d1g40a459 Complement control protein {Vaccinia virus [TaxId: 99.27
d1ok3a264 Complement decay-accelerating factor (Daf, CD55) { 99.27
d1ly2a263 Complement receptor 2, cr2 {Human (Homo sapiens) [ 99.27
d1hfia_62 Factor H, 15th and 16th modules {Human (Homo sapie 99.24
d1quba162 beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 99.24
d1h03p263 Complement decay-accelerating factor (Daf, CD55) { 99.24
d1md8a276 Complement C1R protease domains {Human (Homo sapie 99.22
d1ok3a164 Complement decay-accelerating factor (Daf, CD55) { 99.21
d1h03p162 Complement decay-accelerating factor (Daf, CD55) { 99.21
d1q3xa275 Mannan-binding lectin serine protease 2 (MASP-2) d 99.2
d1g40a262 Complement control protein {Vaccinia virus [TaxId: 99.2
d1elva268 Complement C1S protease domain {Human (Homo sapien 99.17
d1gkna164 Complement receptor 1, cr1 {Human (Homo sapiens) [ 99.16
d1g40a459 Complement control protein {Vaccinia virus [TaxId: 99.16
d1gkga270 Complement receptor 1, cr1 {Human (Homo sapiens) [ 99.16
d1zjka253 Complement C1R protease domains {Human (Homo sapie 99.14
d1srza_68 GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 99.14
d1ok3a264 Complement decay-accelerating factor (Daf, CD55) { 99.14
d1ok3a164 Complement decay-accelerating factor (Daf, CD55) { 99.09
d2z3qb178 Interleukin-15 receptor subunit alpha {Human (Homo 99.09
d2o39c162 CD46 (membrane cofactor protein, MCP) {Human (Homo 99.09
d2msba_112 Mannose-binding protein A, C-lectin domain {Rat (R 99.09
d2z3qb178 Interleukin-15 receptor subunit alpha {Human (Homo 99.08
d1wmza_140 Lectin CEL-I {Cucumaria echinata [TaxId: 40245]} 99.08
d1rdl1_111 Mannose-binding protein A, C-lectin domain {Rat (R 99.07
d1h8ua_115 Eosinophil major basic protein {Human (Homo sapien 99.07
d1gkna164 Complement receptor 1, cr1 {Human (Homo sapiens) [ 99.05
d1srza_68 GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 99.04
d1jzna_135 Galactose-specific C-type lectin {Western diamondb 99.01
d1zjka253 Complement C1R protease domains {Human (Homo sapie 98.98
d2o39c162 CD46 (membrane cofactor protein, MCP) {Human (Homo 98.95
d1egga_136 Macrophage mannose receptor, CRD4 {Human (Homo sap 98.93
d1r13a1119 Surfactant protein, lectin domain {Rat (Rattus nor 98.89
d1hupa1117 Mannose-binding protein A, C-lectin domain {Human 98.88
d1pwba1121 Surfactant protein, lectin domain {Human (Homo sap 98.87
d1tdqb_126 Aggrecan core protein {Rat (Rattus norvegicus) [Ta 98.83
d1t8da1143 Low affinity immunoglobulin epsilon Fc receptor {H 98.83
d1wk1a_150 Hypothetical protein F28B4.3 {Caenorhabditis elega 98.82
d1tn3a_137 Tetranectin {Human (Homo sapiens) [TaxId: 9606]} 98.78
d1gz2a_139 Ovocleidin-17 {Chicken (Gallus gallus) [TaxId: 903 98.77
d2qqia1156 C2 domain of factor VIII {Human (Homo sapiens) [Ta 98.77
d1qdda_144 Lithostathine, inhibitor of stone formation {Human 98.77
d1fvua_133 Snake coagglutinin alpha chain {Jararaca (Bothrops 98.75
d2afpa_129 Type II antifreeze protein {Sea raven (Hemitripter 98.74
d1g1sa1118 P-selectin, C-lectin domain {Human (Homo sapiens) 98.71
d1gqpa_194 APC10/DOC1 subunit of the anaphase-promoting compl 98.68
d1jhja_161 APC10/DOC1 subunit of the anaphase-promoting compl 98.68
d1sddb3162 C2 domain of factor V {Cow (Bos taurus) [TaxId: 99 98.68
d1j34a_129 Snake coagglutinin alpha chain {Habu snake (Trimer 98.67
d1c3ab_125 Snake coagglutinin beta chain {Habu snake (Trimere 98.64
d1g1ta1118 E-selectin, C-lectin domain {Human (Homo sapiens) 98.62
d1oz7b_123 Snake coagglutinin beta chain {Saw-scaled viper (E 98.62
d1c3aa_135 Snake coagglutinin alpha chain {Habu snake (Trimer 98.61
d1j34b_123 Snake coagglutinin beta chain {Habu snake (Trimere 98.6
d1sb2a1132 Snake coagglutinin alpha chain {Malayan pit viper 98.54
d1v7pa_134 Snake coagglutinin alpha chain {Snake (Echis multi 98.53
d1fvub_125 Snake coagglutinin beta chain {Jararaca (Bothrops 98.53
d3bdwa1121 CD94 {Human (Homo sapiens) [TaxId: 9606]} 98.51
d1dv8a_128 H1 subunit of the asialoglycoprotein receptor {Hum 98.5
d1umra_135 Snake coagglutinin alpha chain {South american rat 98.49
d2qqia2155 B1 domain of neuropilin-1 {Human (Homo sapiens) [T 98.49
d1hq8a_123 NK cell-activating receptor nkg2d {Mouse (Mus musc 98.49
d1umrc_125 Snake coagglutinin beta chain {South american ratt 98.47
d1v7pb_127 Snake coagglutinin beta chain {Snake (Echis multis 98.47
d1xpha1130 DC-SIGNR (DC-SIGN related receptor) {Human (Homo s 98.46
d1uv0a_140 Pancreatitis-associated protein 1 {Human (Homo sap 98.4
d1jwia_124 Snake coagglutinin alpha chain {Puff adder (Bitis 98.39
d1jwib_123 Snake coagglutinin beta chain {Puff adder (Bitis a 98.35
d1qo3c_133 NK cell receptor {Mouse (Mus musculus), ly49-a [Ta 98.34
d3c8ja1122 NK cell receptor {Mouse (Mus musculus), ly49-c [Ta 98.33
d1byfa_123 Lectin TC14 {Tunicate (Polyandrocarpa misakiensis) 98.3
d1sb2b1127 Snake coagglutinin beta chain {Malayan pit viper ( 98.27
d1d7pm_159 C2 domain of factor VIII {Human (Homo sapiens) [Ta 98.21
d1czsa_160 C2 domain of factor V {Human (Homo sapiens) [TaxId 98.21
d1ypqa1131 Oxidised low density lipoprotein {Human (Homo sapi 98.2
d1kg0c_136 EBV gp42 {Epstein-Barr virus [TaxId: 10376]} 98.2
d1oz7a_131 Snake coagglutinin alpha chain {Saw-scaled viper ( 98.02
d1e87a_117 CD69 {Human (Homo sapiens) [TaxId: 9606]} 97.98
d2ok5a468 Complement factor B {Human (Homo sapiens) [TaxId: 97.29
d2ok5a468 Complement factor B {Human (Homo sapiens) [TaxId: 97.05
d2b5id263 Interleukin-2 receptor alpha chain {Human (Homo sa 96.62
d2b5id263 Interleukin-2 receptor alpha chain {Human (Homo sa 96.15
d1g40a164 Complement control protein {Vaccinia virus [TaxId: 93.99
d1g40a164 Complement control protein {Vaccinia virus [TaxId: 90.93
>d1k12a_ b.18.1.15 (A:) Fucose binding lectin {European eel (Anguilla anguilla) [TaxId: 7936]} Back     information, alignment and structure
class: All beta proteins
fold: Galactose-binding domain-like
superfamily: Galactose-binding domain-like
family: Fucose binding lectin
domain: Fucose binding lectin
species: European eel (Anguilla anguilla) [TaxId: 7936]

Probab=99.96  E-value=1.6e-30  Score=252.43  Aligned_cols=143  Identities=36%  Similarity=0.630  Sum_probs=124.7

Q ss_pred             ccccccCCCCceeccCCCC-----CCCCCCcCCCCCCCcCCCceeccCCCCCCcEEEEcCCeEEEEEEEEEccCCCCCCC
Q psy11954         18 SGTNVALRRPTNQSSTIRG-----APSSNANDGELTTVHDGKRCTETQKEVSPWWQVDLLRPYPIRIVRITTRGCCGHQP   92 (881)
Q Consensus        18 ~~~nlA~~k~a~qSS~~~~-----~~a~~AvDG~~~~~~~~~~c~~t~~~~~pWw~VDLg~~~~i~~V~i~nr~d~~~~~   92 (881)
                      ...||||||+|+|||++.+     +.|++||||+++++|.+++|+||..+.+|||+||||+.|.|++|+|++|.|+...+
T Consensus         7 ~~~NiAl~k~at~SS~~~~~~~~~~~a~~AvDG~~~t~w~s~~~~~T~~~~~~W~~VDLg~~~~i~~v~i~~r~d~~~~~   86 (158)
T d1k12a_           7 TQENVAVRGKATQSAQLRGEHAANSEASNAIDGNRDSNFYHGSCTHSSGQANPWWRVDLLQVYTITSVTITNRGDCCGER   86 (158)
T ss_dssp             EEEEGGGGSEEEESCBCCSTTGGGCCGGGGGSSCCCCCGGGSCSCCBCSCSSCEEEEEEEEEEEEEEEEEEECSSSCTTT
T ss_pred             CcccCcCCCceeEcceecCCCCCCCCHHHcCCCCccCCccccccccCCCCCCcEEEEEcCCceEeeEEEEEccccccccc
Confidence            4579999999999998753     46899999999999999999999999999999999999999999999999988899


Q ss_pred             CcccEEEEccCCCCCCCCCccCCCCCCCCCCCcccceeeccCCCCCCCceeeeccCccCCCceEEEeCCCCCcceEEEEE
Q psy11954         93 LQDLEIRVGNSTDLQKNPLCAWFPGTLGHQPLQDLEIRVGNSTDLQKNPLCAWFPGTLEEGITKSFTCARTLVGQNVFIQ  172 (881)
Q Consensus        93 ~~~~~i~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gRyV~i~  172 (881)
                      +.+|+|+|+++...                             ....++.|+... ....+.+.++.|..++.||||||+
T Consensus        87 ~~~~~i~vs~d~~~-----------------------------~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~gRYVrI~  136 (158)
T d1k12a_          87 ISGAEINIGQHLAS-----------------------------NGVNNPECSVIG-SMATGETKTFHCPAPMIGRYVVTY  136 (158)
T ss_dssp             TTTCEEEEESSCTT-----------------------------TTTTSCEEEECC-CCCTTCEEEEEEEEEEEEEEEEEE
T ss_pred             ccceeEEeccCccc-----------------------------cceecceeCccc-ccCCCCeEEEECCCCceEEEEEEE
Confidence            99999999988431                             234566776654 456788899999888999999999


Q ss_pred             EecCccceEeeEEEeeccc
Q psy11954        173 LVGVEGSLSLCEVEIFTTD  191 (881)
Q Consensus       173 ~~g~~~~l~l~EveV~g~~  191 (881)
                      +++.. .|+|||||||+++
T Consensus       137 ~~~~~-~lsl~EveVY~~~  154 (158)
T d1k12a_         137 LPTSE-SLHLCEVEVNVDK  154 (158)
T ss_dssp             CCSSS-CCCEEEEEEEEEE
T ss_pred             eCCCc-eEEEEEEEEecCC
Confidence            99854 8999999999874
>d1w8oa2 b.18.1.1 (A:506-647) Sialidase, C-terminal domain {Micromonospora viridifaciens [TaxId: 1881]} Back     information, alignment and structure
>d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tvga_ b.18.1.9 (A:) Placental protein 25, pp25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ppqa_ g.18.1.1 (A:) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g40a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]} Back     information, alignment and structure
>d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1quba1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3xa2 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g40a2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus [TaxId: 10245]} Back     information, alignment and structure
>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g40a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]} Back     information, alignment and structure
>d1ppqa_ g.18.1.1 (A:) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1md8a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkga2 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]} Back     information, alignment and structure
>d1ok3a2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1quba1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1md8a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ok3a1 g.18.1.1 (A:1-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3xa2 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g40a2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus [TaxId: 10245]} Back     information, alignment and structure
>d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkna1 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]} Back     information, alignment and structure
>d1gkga2 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zjka2 g.18.1.1 (A:311-363) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srza_ g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ok3a2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ok3a1 g.18.1.1 (A:1-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z3qb1 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o39c1 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msba_ d.169.1.1 (A:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2z3qb1 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmza_ d.169.1.1 (A:) Lectin CEL-I {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1rdl1_ d.169.1.1 (1:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h8ua_ d.169.1.1 (A:) Eosinophil major basic protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkna1 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srza_ g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jzna_ d.169.1.1 (A:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox) [TaxId: 8730]} Back     information, alignment and structure
>d1zjka2 g.18.1.1 (A:311-363) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o39c1 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egga_ d.169.1.1 (A:) Macrophage mannose receptor, CRD4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r13a1 d.169.1.1 (A:110-228) Surfactant protein, lectin domain {Rat (Rattus norvegicus), SP-A [TaxId: 10116]} Back     information, alignment and structure
>d1hupa1 d.169.1.1 (A:112-228) Mannose-binding protein A, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pwba1 d.169.1.1 (A:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]} Back     information, alignment and structure
>d1tdqb_ d.169.1.1 (B:) Aggrecan core protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t8da1 d.169.1.1 (A:1-143) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk1a_ d.169.1.1 (A:) Hypothetical protein F28B4.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1tn3a_ d.169.1.1 (A:) Tetranectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz2a_ d.169.1.1 (A:) Ovocleidin-17 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2qqia1 b.18.1.2 (A:431-586) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdda_ d.169.1.1 (A:) Lithostathine, inhibitor of stone formation {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvua_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]} Back     information, alignment and structure
>d2afpa_ d.169.1.1 (A:) Type II antifreeze protein {Sea raven (Hemitripterus americanus) [TaxId: 8094]} Back     information, alignment and structure
>d1g1sa1 d.169.1.1 (A:1-118) P-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gqpa_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jhja_ b.18.1.9 (A:) APC10/DOC1 subunit of the anaphase-promoting complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sddb3 b.18.1.2 (B:1863-2024) C2 domain of factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j34a_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]} Back     information, alignment and structure
>d1c3ab_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis), flavocetin-A [TaxId: 88087]} Back     information, alignment and structure
>d1g1ta1 d.169.1.1 (A:1-118) E-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz7b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Saw-scaled viper (Echis carinatus), echicetin [TaxId: 40353]} Back     information, alignment and structure
>d1c3aa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Habu snake (Trimeresurus flavoviridis), flavocetin-A [TaxId: 88087]} Back     information, alignment and structure
>d1j34b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]} Back     information, alignment and structure
>d1sb2a1 d.169.1.1 (A:1-132) Snake coagglutinin alpha chain {Malayan pit viper (Calloselasma rhodostoma), rhodocetin [TaxId: 8717]} Back     information, alignment and structure
>d1v7pa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Snake (Echis multisquamatus), Ems16 [TaxId: 93050]} Back     information, alignment and structure
>d1fvub_ d.169.1.1 (B:) Snake coagglutinin beta chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]} Back     information, alignment and structure
>d3bdwa1 d.169.1.1 (A:59-179) CD94 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dv8a_ d.169.1.1 (A:) H1 subunit of the asialoglycoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1umra_ d.169.1.1 (A:) Snake coagglutinin alpha chain {South american rattlesnake (Crotalus durissus terrificus), convulxin [TaxId: 8732]} Back     information, alignment and structure
>d2qqia2 b.18.1.2 (A:273-427) B1 domain of neuropilin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hq8a_ d.169.1.1 (A:) NK cell-activating receptor nkg2d {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1umrc_ d.169.1.1 (C:) Snake coagglutinin beta chain {South american rattlesnake (Crotalus durissus terrificus), convulxin [TaxId: 8732]} Back     information, alignment and structure
>d1v7pb_ d.169.1.1 (B:) Snake coagglutinin beta chain {Snake (Echis multisquamatus), Ems16 [TaxId: 93050]} Back     information, alignment and structure
>d1xpha1 d.169.1.1 (A:265-394) DC-SIGNR (DC-SIGN related receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uv0a_ d.169.1.1 (A:) Pancreatitis-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwia_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]} Back     information, alignment and structure
>d1jwib_ d.169.1.1 (B:) Snake coagglutinin beta chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]} Back     information, alignment and structure
>d1qo3c_ d.169.1.1 (C:) NK cell receptor {Mouse (Mus musculus), ly49-a [TaxId: 10090]} Back     information, alignment and structure
>d3c8ja1 d.169.1.1 (A:138-259) NK cell receptor {Mouse (Mus musculus), ly49-c [TaxId: 10090]} Back     information, alignment and structure
>d1byfa_ d.169.1.1 (A:) Lectin TC14 {Tunicate (Polyandrocarpa misakiensis) [TaxId: 7723]} Back     information, alignment and structure
>d1sb2b1 d.169.1.1 (B:2-128) Snake coagglutinin beta chain {Malayan pit viper (Calloselasma rhodostoma), rhodocetin [TaxId: 8717]} Back     information, alignment and structure
>d1d7pm_ b.18.1.2 (M:) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1czsa_ b.18.1.2 (A:) C2 domain of factor V {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ypqa1 d.169.1.1 (A:140-270) Oxidised low density lipoprotein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kg0c_ d.169.1.1 (C:) EBV gp42 {Epstein-Barr virus [TaxId: 10376]} Back     information, alignment and structure
>d1oz7a_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Saw-scaled viper (Echis carinatus), echicetin [TaxId: 40353]} Back     information, alignment and structure
>d1e87a_ d.169.1.1 (A:) CD69 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ok5a4 g.18.1.1 (A:9-76) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ok5a4 g.18.1.1 (A:9-76) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5id2 g.18.1.1 (D:103-165) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5id2 g.18.1.1 (D:103-165) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g40a1 g.18.1.1 (A:1-64) Complement control protein {Vaccinia virus [TaxId: 10245]} Back     information, alignment and structure
>d1g40a1 g.18.1.1 (A:1-64) Complement control protein {Vaccinia virus [TaxId: 10245]} Back     information, alignment and structure