Psyllid ID: psy11963

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MDGGFNPEELRGTRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNFSGLYGAPSRTGKIKDIASFDAEFFGIHSKLANVMDPQLRMLLELTHESIMDGGFNPEELRGTRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNFSVF
ccccccccccccccccEEEccccccHHHccccccHHHHcHHccccccccccccccccccccccccccccccccccccccccccccccHHHHccccHHHHHHHHHHHHHHHHcccccccccccccEEEEEccccHHHHHHcccccccccEEccccccHHHcccEEEEEccccc
ccccccccccccccccccEEEEEEcccccccccHHHHHHHHHHHcccccccccccccccHHHHccccccccccccHHHccHHHccccHHHHHHccHHHHHHHHHHHHHHHHccccHHHccccccEEEEEEccccHHHHHccccccccEEEEccccHHHHcccEEEEEccEcc
mdggfnpeelrgtrTGVYIGLMTteandfaegnpekltgyeTIGSTRAMLANRLSYAFNfsglygapsrtgkikdiasfdaEFFGIHSKLANVMDPQLRMLLELTHEsimdggfnpeelrgtrtGVYIGLMTteandfaegnpekltgyeTIGSTRAMLANRLSYAFNFSVF
mdggfnpeelrgtrTGVYIGLMTteandfaegnpeKLTGYETIGSTRAMLANRLSYAFNFSGLYGAPSRTGKIKDIASFDAEFFGIHSKLANVMDPQLRMLLELTHESIMdggfnpeelrGTRTGVYIGLMTteandfaegnpeKLTGYETIGSTRAMLANRLSYAFNFSVF
MDGGFNPEELRGTRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNFSGLYGAPSRTGKIKDIASFDAEFFGIHSKLANVMDPQLRMLLELTHESIMDGGFNPEELRGTRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNFSVF
*************RTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNFSGLYGAPSRTGKIKDIASFDAEFFGIHSKLANVMDPQLRMLLELTHESIMDGGFNPEELRGTRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNF***
MDGGFNPEELRGTRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNFSGLYGAPSRTGKIKDIASFDAEFFGIHSKLANVMDPQLRMLLELTHESIMDGGFNPEELRGTRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNFSVF
MDGGFNPEELRGTRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNFSGLYGAPSRTGKIKDIASFDAEFFGIHSKLANVMDPQLRMLLELTHESIMDGGFNPEELRGTRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNFSVF
**************TGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNFSGLYGAPSRTGKIKDIASFDAEFFGIHSKLANVMDPQLRMLLELTHESIMDGGFNPEELRGTRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNFSVF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGGFNPEELRGTRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNFSGLYGAPSRTGKIKDIASFDAEFFGIHSKLANVMDPQLRMLLELTHESIMDGGFNPEELRGTRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNFSVF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query172 2.2.26 [Sep-21-2011]
P49327 2511 Fatty acid synthase OS=Ho yes N/A 0.633 0.043 0.559 2e-34
P19096 2504 Fatty acid synthase OS=Mu yes N/A 0.633 0.043 0.559 3e-34
P12785 2505 Fatty acid synthase OS=Ra yes N/A 0.633 0.043 0.559 3e-34
Q71SP7 2513 Fatty acid synthase OS=Bo yes N/A 0.633 0.043 0.559 2e-33
P12276 2512 Fatty acid synthase OS=Ga yes N/A 0.633 0.043 0.559 6e-33
P36189 352 Fatty acid synthase (Frag N/A N/A 0.627 0.306 0.564 6e-33
Q03132 3567 Erythronolide synthase, m no N/A 0.569 0.027 0.366 3e-15
Q10978 1538 Phthiocerol synthesis pol no N/A 0.552 0.061 0.4 7e-15
Q7TXL9 1538 Phthiocerol/phenolphthioc no N/A 0.552 0.061 0.4 7e-15
Q0C8M3 3038 Lovastatin nonaketide syn N/A N/A 0.529 0.029 0.368 4e-14
>sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 Back     alignment and function desciption
 Score =  144 bits (364), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 61/109 (55%), Positives = 85/109 (77%)

Query: 61  SGLYGAPSRTGKIKDIASFDAEFFGIHSKLANVMDPQLRMLLELTHESIMDGGFNPEELR 120
           +GLYG P R+GK+KD++ FDA FFG+H K A+ MDPQLR+LLE+T+E+I+DGG NP+ LR
Sbjct: 42  AGLYGLPRRSGKLKDLSRFDASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPDSLR 101

Query: 121 GTRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNF 169
           GT TGV++G+  +E ++    +PE L GY  +G  RAM+ANRLS+ F+F
Sbjct: 102 GTHTGVWVGVSGSETSEALSRDPETLVGYSMVGCQRAMMANRLSFFFDF 150
Fatty acid synthetase catalyzes the formation of long-chain fatty acids from acetyl-CoA, malonyl-CoA and NADPH. This multifunctional protein has 7 catalytic activities and an acyl carrier protein.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 1EC: .EC: 2EC: .EC: 1EC: 4
>sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 Back     alignment and function description
>sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 Back     alignment and function description
>sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 Back     alignment and function description
>sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 Back     alignment and function description
>sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 Back     alignment and function description
>sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 Back     alignment and function description
>sp|Q10978|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis GN=ppsB PE=3 SV=2 Back     alignment and function description
>sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 Back     alignment and function description
>sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
328717600 1421 PREDICTED: fatty acid synthase-like [Acy 0.633 0.076 0.688 1e-41
328717598 1975 PREDICTED: fatty acid synthase-like, par 0.633 0.055 0.706 2e-41
242023225 2381 fatty acid synthase, putative [Pediculus 0.639 0.046 0.581 1e-34
345479258 2398 PREDICTED: fatty acid synthase-like isof 0.639 0.045 0.6 2e-34
61744020 2411 fatty acid synthase [Sus scrofa] 0.633 0.045 0.596 2e-34
198443141 2512 Chain A, Crystal Structure Of Mammalian 0.633 0.043 0.596 2e-34
153792600 2512 fatty acid synthase [Sus scrofa] gi|1487 0.633 0.043 0.596 2e-34
27552753269 fatty acid synthase [Sus scrofa] 0.633 0.405 0.596 4e-34
410982042 2478 PREDICTED: fatty acid synthase [Felis ca 0.633 0.043 0.577 1e-33
322790614 2154 hypothetical protein SINV_15862 [Solenop 0.633 0.050 0.568 2e-33
>gi|328717600|ref|XP_001945449.2| PREDICTED: fatty acid synthase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 75/109 (68%), Positives = 97/109 (88%)

Query: 62  GLYGAPSRTGKIKDIASFDAEFFGIHSKLANVMDPQLRMLLELTHESIMDGGFNPEELRG 121
           G+YG P RTGK+K+I+ FDAEFFGIHSKLAN MD QLR+LLE+THE+I+D G NP+++RG
Sbjct: 46  GMYGVPPRTGKLKEISKFDAEFFGIHSKLANAMDVQLRILLEVTHEAIVDAGVNPQDIRG 105

Query: 122 TRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNFS 170
           TRTGVY+G+MTTE++D+ E  PEK++GYETIG+ R+MLANRLS+ FNF+
Sbjct: 106 TRTGVYVGMMTTESSDYFERTPEKMSGYETIGAIRSMLANRLSFQFNFN 154

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328717598|ref|XP_001942583.2| PREDICTED: fatty acid synthase-like, partial [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242023225|ref|XP_002432036.1| fatty acid synthase, putative [Pediculus humanus corporis] gi|212517394|gb|EEB19298.1| fatty acid synthase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|345479258|ref|XP_003423914.1| PREDICTED: fatty acid synthase-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|61744020|gb|AAX55638.1| fatty acid synthase [Sus scrofa] Back     alignment and taxonomy information
>gi|198443141|pdb|2VZ8|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase gi|198443142|pdb|2VZ8|B Chain B, Crystal Structure Of Mammalian Fatty Acid Synthase gi|198443143|pdb|2VZ9|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase In Complex With Nadp gi|198443144|pdb|2VZ9|B Chain B, Crystal Structure Of Mammalian Fatty Acid Synthase In Complex With Nadp Back     alignment and taxonomy information
>gi|153792600|ref|NP_001093400.1| fatty acid synthase [Sus scrofa] gi|148733529|gb|ABR09275.1| fatty acid synthase [Sus scrofa] Back     alignment and taxonomy information
>gi|27552753|gb|AAO19448.1| fatty acid synthase [Sus scrofa] Back     alignment and taxonomy information
>gi|410982042|ref|XP_003997372.1| PREDICTED: fatty acid synthase [Felis catus] Back     alignment and taxonomy information
>gi|322790614|gb|EFZ15422.1| hypothetical protein SINV_15862 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
UNIPROTKB|I3LC73 1375 FASN "Uncharacterized protein" 0.633 0.079 0.587 2.9e-31
UNIPROTKB|F1Q2F6 2518 FASN "Uncharacterized protein" 0.633 0.043 0.568 4.7e-30
UNIPROTKB|P49327 2511 FASN "Fatty acid synthase" [Ho 0.633 0.043 0.559 6e-30
MGI|MGI:95485 2504 Fasn "fatty acid synthase" [Mu 0.633 0.043 0.559 9.7e-30
RGD|620665 2505 Fasn "fatty acid synthase" [Ra 0.633 0.043 0.559 9.7e-30
UNIPROTKB|P12785 2505 Fasn "Fatty acid synthase" [Ra 0.633 0.043 0.559 9.7e-30
UNIPROTKB|F1N647 2512 FASN "Fatty acid synthase" [Bo 0.633 0.043 0.559 4.2e-29
UNIPROTKB|Q71SP7 2513 FASN "Fatty acid synthase" [Bo 0.633 0.043 0.559 4.2e-29
UNIPROTKB|F1N8A8 2512 FASN "Fatty acid synthase" [Ga 0.633 0.043 0.559 1.4e-28
UNIPROTKB|E1BW07 2513 FASN "Fatty acid synthase" [Ga 0.633 0.043 0.559 1.4e-28
UNIPROTKB|I3LC73 FASN "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 357 (130.7 bits), Expect = 2.9e-31, P = 2.9e-31
 Identities = 64/109 (58%), Positives = 86/109 (78%)

Query:    61 SGLYGAPSRTGKIKDIASFDAEFFGIHSKLANVMDPQLRMLLELTHESIMDGGFNPEELR 120
             +GLYG P R GK+KD++ FDA FFG+HSK AN MDPQLRMLLE+T+E+I+DGG NP  LR
Sbjct:    42 AGLYGLPRRMGKLKDLSRFDASFFGVHSKQANTMDPQLRMLLEVTYEAIVDGGINPASLR 101

Query:   121 GTRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNF 169
             GT TGV++G+ +++A++    +PE L GY  IG  RAM+ANR+S+ F+F
Sbjct:   102 GTSTGVWVGVSSSDASEALSRDPETLVGYSMIGCQRAMMANRVSFFFDF 150
GO:0016740 "transferase activity" evidence=IEA
UNIPROTKB|F1Q2F6 FASN "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P49327 FASN "Fatty acid synthase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:95485 Fasn "fatty acid synthase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620665 Fasn "fatty acid synthase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P12785 Fasn "Fatty acid synthase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N647 FASN "Fatty acid synthase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q71SP7 FASN "Fatty acid synthase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1N8A8 FASN "Fatty acid synthase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BW07 FASN "Fatty acid synthase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q71SP7FAS_BOVIN3, ., 1, ., 2, ., 1, 40.55960.63370.0433yesN/A
P12785FAS_RAT3, ., 1, ., 2, ., 1, 40.55960.63370.0435yesN/A
P49327FAS_HUMAN3, ., 1, ., 2, ., 1, 40.55960.63370.0434yesN/A
P12276FAS_CHICK3, ., 1, ., 2, ., 1, 40.55960.63370.0433yesN/A
P19096FAS_MOUSE3, ., 1, ., 2, ., 1, 40.55960.63370.0435yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
cd00833 421 cd00833, PKS, polyketide synthases (PKSs) polymeri 4e-33
COG3321 1061 COG3321, COG3321, Polyketide synthase modules and 7e-26
smart00825 298 smart00825, PKS_KS, Beta-ketoacyl synthase 3e-24
pfam00109243 pfam00109, ketoacyl-synt, Beta-ketoacyl synthase, 2e-21
cd00833 421 cd00833, PKS, polyketide synthases (PKSs) polymeri 3e-15
COG3321 1061 COG3321, COG3321, Polyketide synthase modules and 5e-09
pfam00109243 pfam00109, ketoacyl-synt, Beta-ketoacyl synthase, 9e-07
smart00825298 smart00825, PKS_KS, Beta-ketoacyl synthase 2e-04
cd00825 332 cd00825, decarbox_cond_enzymes, decarboxylating co 0.004
>gnl|CDD|238429 cd00833, PKS, polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information 
 Score =  121 bits (305), Expect = 4e-33
 Identities = 44/114 (38%), Positives = 69/114 (60%)

Query: 56  YAFNFSGLYGAPSRTGKIKDIASFDAEFFGIHSKLANVMDPQLRMLLELTHESIMDGGFN 115
           Y            R G + D+ +FDA FFGI  + A  MDPQ R+LLE+  E++ D G++
Sbjct: 46  YPDPGKPGKTYTRRGGFLDDVDAFDAAFFGISPREAEAMDPQQRLLLEVAWEALEDAGYS 105

Query: 116 PEELRGTRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNF 169
           PE L G+RTGV++G  +++  +    +P+++  Y   G++RA LANR+SY F+ 
Sbjct: 106 PESLAGSRTGVFVGASSSDYLELLARDPDEIDAYAATGTSRAFLANRISYFFDL 159

PKSs can be divided into 2 groups, modular type I PKSs consisting of one or more large multifunctional proteins and iterative type II PKSs, complexes of several monofunctional subunits. Length = 421
>gnl|CDD|225858 COG3321, COG3321, Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|214836 smart00825, PKS_KS, Beta-ketoacyl synthase Back     alignment and domain information
>gnl|CDD|215723 pfam00109, ketoacyl-synt, Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>gnl|CDD|238429 cd00833, PKS, polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information
>gnl|CDD|225858 COG3321, COG3321, Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215723 pfam00109, ketoacyl-synt, Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>gnl|CDD|214836 smart00825, PKS_KS, Beta-ketoacyl synthase Back     alignment and domain information
>gnl|CDD|238421 cd00825, decarbox_cond_enzymes, decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 172
COG3321 1061 Polyketide synthase modules and related proteins [ 99.95
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 99.87
KOG1202|consensus 2376 99.78
PRK08722 414 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.77
smart00825 424 PKS_KS Beta-ketoacyl synthase. The structure of be 99.77
cd00833 421 PKS polyketide synthases (PKSs) polymerize simple 99.75
cd00832 399 CLF Chain-length factor (CLF) is a factor required 99.75
PRK07314 411 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.74
PF00109254 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal 99.73
PRK06333 424 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.72
TIGR03150 407 fabF beta-ketoacyl-acyl-carrier-protein synthase I 99.7
PRK08439 406 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.68
PLN02787 540 3-oxoacyl-[acyl-carrier-protein] synthase II 99.65
KOG1394|consensus 440 99.65
PLN02836 437 3-oxoacyl-[acyl-carrier-protein] synthase 99.64
PRK09116 405 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.63
cd00834 406 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) 99.63
PRK07910 418 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.63
PRK07967 406 3-oxoacyl-(acyl carrier protein) synthase I; Revie 99.61
PRK07103 410 polyketide beta-ketoacyl:acyl carrier protein synt 99.52
PRK06519 398 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.52
PTZ00050 421 3-oxoacyl-acyl carrier protein synthase; Provision 99.5
cd00828 407 elong_cond_enzymes "elongating" condensing enzymes 99.49
COG0304 412 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Li 99.41
PRK14691 342 3-oxoacyl-(acyl carrier protein) synthase II; Prov 98.94
PRK06501 425 3-oxoacyl-(acyl carrier protein) synthase II; Revi 98.9
PRK09185 392 3-oxoacyl-(acyl carrier protein) synthase I; Revie 98.83
PRK05952 381 3-oxoacyl-(acyl carrier protein) synthase II; Revi 98.66
KOG1202|consensus 2376 98.59
cd00825 332 decarbox_cond_enzymes decarboxylating condensing e 97.86
COG3321 1061 Polyketide synthase modules and related proteins [ 97.59
PF13723 218 Ketoacyl-synt_2: Beta-ketoacyl synthase, N-termina 96.59
cd00327 254 cond_enzymes Condensing enzymes; Family of enzymes 93.15
PRK08256 391 lipid-transfer protein; Provisional 90.34
COG0332 323 FabH 3-oxoacyl-[acyl-carrier-protein] 87.39
smart00825 424 PKS_KS Beta-ketoacyl synthase. The structure of be 86.62
PRK08722 414 3-oxoacyl-(acyl carrier protein) synthase II; Revi 86.0
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 84.47
cd00832 399 CLF Chain-length factor (CLF) is a factor required 83.0
cd00833 421 PKS polyketide synthases (PKSs) polymerize simple 82.51
>COG3321 Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information 
Probab=99.95  E-value=1.3e-28  Score=211.86  Aligned_cols=151  Identities=28%  Similarity=0.480  Sum_probs=135.4

Q ss_pred             cceEEEeeecCccchhhcCCcccccccccccccccccccccCcccccCCCCC---------CCCCCcccCCcCCCCcccc
Q psy11963         14 RTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNFSGLYG---------APSRTGKIKDIASFDAEFF   84 (172)
Q Consensus        14 ~~~V~vg~~~~~~~~~~~~~~~~~~~w~~l~~g~s~~~~~~~~~~~~~~~~~---------~~~~~~~~~~v~~fd~~~~   84 (172)
                      -..|+|+|+||+..+     ++.|  |+.+.+|++.+..+|.+||+++.+|+         +++++||++++..||+.||
T Consensus         6 IAIiGm~~rfPga~~-----~~~~--W~~l~~g~~~i~~ip~~rwd~~~~~~~~~~~~gk~~~~~ggfl~~~~~FD~~fF   78 (1061)
T COG3321           6 IAIIGMACRFPGADS-----PEEF--WDLLKEGRDEITEVPADRWDVDAYYDPDPTVPGKSYSRWGGFLDDVDDFDALFF   78 (1061)
T ss_pred             EEEEeccccCCCCCC-----HHHH--HHHHhcCCceeeecChhhhhHhhccCCccccccccccccccccCCccccCHHHc
Confidence            457888899998554     7789  99999999999999999999998886         3578999999999999999


Q ss_pred             CCCHHHHhhcChHHHHHHHHHHHHHHhCCCCCCCCCCCcceEEEcccchhHHHHhccCCCCCCccccccchhhHHHhHHH
Q psy11963         85 GIHSKLANVMDPQLRMLLELTHESIMDGGFNPEELRGTRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLS  164 (172)
Q Consensus        85 ~~~~~~~~~~d~~~~~~l~aa~eAl~dAG~~~~~~~~~r~gv~vG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~is  164 (172)
                      +|+|+|+..||||||++|+++|+|||||||.+..+.+.++|||+|.+..+|..+.........++...++..+++++|||
T Consensus        79 gisPrEA~~mDPQqRllLe~aw~AlEdAG~~~~~l~g~~tgV~~g~~~~~y~~~~~~~~~~~~~~~~~g~~~~~~a~Ris  158 (1061)
T COG3321          79 GISPREAEAMDPQQRLLLEVAWEALEDAGIYPDSLRGSATGVFAGASVADYLLLLLADDEAEPEYAITGNSSSVAAGRIS  158 (1061)
T ss_pred             CCCHHHHHhcCchHhHHHHHHHHHHHHcCCCccccCCcceEEEEeeccCccccccccccccccceecccchhhHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999987654332267788889999999999999


Q ss_pred             HHhCCCC
Q psy11963        165 YAFNFSV  171 (172)
Q Consensus       165 ~~~~l~~  171 (172)
                      +.|||++
T Consensus       159 y~l~l~G  165 (1061)
T COG3321         159 YVLGLSG  165 (1061)
T ss_pred             HHhcCCC
Confidence            9999986

>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>smart00825 PKS_KS Beta-ketoacyl synthase Back     alignment and domain information
>cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information
>cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PF00109 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal domain; InterPro: IPR014030 Beta-ketoacyl-ACP synthase 2 Back     alignment and domain information
>PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>TIGR03150 fabF beta-ketoacyl-acyl-carrier-protein synthase II Back     alignment and domain information
>PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PLN02787 3-oxoacyl-[acyl-carrier-protein] synthase II Back     alignment and domain information
>KOG1394|consensus Back     alignment and domain information
>PLN02836 3-oxoacyl-[acyl-carrier-protein] synthase Back     alignment and domain information
>PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07967 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated Back     alignment and domain information
>PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional Back     alignment and domain information
>cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK14691 3-oxoacyl-(acyl carrier protein) synthase II; Provisional Back     alignment and domain information
>PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>COG3321 Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF13723 Ketoacyl-synt_2: Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>PRK08256 lipid-transfer protein; Provisional Back     alignment and domain information
>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>smart00825 PKS_KS Beta-ketoacyl synthase Back     alignment and domain information
>PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
2vz8_A 2512 Crystal Structure Of Mammalian Fatty Acid Synthase 5e-37
3hhd_A 965 Structure Of The Human Fatty Acid Synthase Ks-Mat D 5e-35
2qo3_A 915 Crystal Structure Of [ks3][at3] Didomain From Modul 9e-14
2hg4_A 917 Structure Of The Ketosynthase-acyltransferase Didom 2e-11
>pdb|2VZ8|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase Length = 2512 Back     alignment and structure 
Iteration: 1

 Score =  150 bits (378), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 65/109 (59%), Positives = 86/109 (78%)
Query: 61  SGLYGAPSRTGKIKDIASFDAEFFGIHSKLANVMDPQLRMLLELTHESIMDGGFNPEELR 120
           +GLYG P R GK+KD++ FDA FFG+HSK AN MDPQLRMLLE+T+E+I+DGG NP  LR
Sbjct: 42  AGLYGLPRRMGKLKDLSRFDASFFGVHSKQANTMDPQLRMLLEVTYEAIVDGGINPASLR 101
Query: 121 GTRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNF 169
           GT TGV++G+ +++A++    +PE L GY  IG  RAM+ANRLS+ F+F
Sbjct: 102 GTSTGVWVGVSSSDASEALSRDPETLVGYSMIGCQRAMMANRLSFFFDF 150
>pdb|3HHD|A Chain A, Structure Of The Human Fatty Acid Synthase Ks-Mat Didomain As A Framework For Inhibitor Design. Length = 965 Back     alignment and structure
>pdb|2QO3|A Chain A, Crystal Structure Of [ks3][at3] Didomain From Module 3 Of 6- Deoxyerthronolide B Synthase Length = 915 Back     alignment and structure
>pdb|2HG4|A Chain A, Structure Of The Ketosynthase-acyltransferase Didomain Of Module 5 From Debs. Length = 917 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 4e-41
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 1e-16
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, meg 2e-40
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, meg 6e-17
2qo3_A 915 Eryaii erythromycin polyketide synthase modules 3; 4e-27
2qo3_A 915 Eryaii erythromycin polyketide synthase modules 3; 1e-10
2hg4_A 917 DEBS, 6-deoxyerythronolide B synthase; ketosynthas 8e-27
2hg4_A 917 DEBS, 6-deoxyerythronolide B synthase; ketosynthas 2e-11
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 7e-04
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Back     alignment and structure
 Score =  145 bits (368), Expect = 4e-41
 Identities = 65/108 (60%), Positives = 85/108 (78%)

Query: 62  GLYGAPSRTGKIKDIASFDAEFFGIHSKLANVMDPQLRMLLELTHESIMDGGFNPEELRG 121
           GLYG P R GK+KD++ FDA FFG+HSK AN MDPQLRMLLE+T+E+I+DGG NP  LRG
Sbjct: 43  GLYGLPRRMGKLKDLSRFDASFFGVHSKQANTMDPQLRMLLEVTYEAIVDGGINPASLRG 102

Query: 122 TRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNF 169
           T TGV++G+ +++A++    +PE L GY  IG  RAM+ANRLS+ F+F
Sbjct: 103 TSTGVWVGVSSSDASEALSRDPETLVGYSMIGCQRAMMANRLSFFFDF 150
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Back     alignment and structure
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Length = 965 Back     alignment and structure
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Length = 965 Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Length = 915 Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Length = 915 Back     alignment and structure
>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} Length = 917 Back     alignment and structure
>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} Length = 917 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, meg 99.91
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.91
2qo3_A 915 Eryaii erythromycin polyketide synthase modules 3; 99.9
2hg4_A 917 DEBS, 6-deoxyerythronolide B synthase; ketosynthas 99.89
3o04_A 413 LMO2201 protein, beta-keto-acyl carrier protein sy 99.84
3kzu_A 428 3-oxoacyl-(acyl-carrier-protein) synthase II; seat 99.84
3ho9_A 427 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, 99.83
4ddo_A 451 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci 99.81
1tqy_A 424 Beta-ketoacyl synthase/acyl transferase; alpha-bet 99.81
1e5m_A 416 KAS II, beta ketoacyl acyl carrier protein synthas 99.8
2iwz_A 438 3-oxoacyl-[acyl-carrier-protein] synthase; mitocho 99.8
2gqd_A 437 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli 99.79
4ewg_A 412 Beta-ketoacyl synthase; ssgcid, structural genomic 99.79
2wge_A 416 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta 99.79
1tqy_B 415 Actinorhodin polyketide putative beta-ketoacyl SY; 99.79
1ox0_A 430 Beta ketoacyl-acyl carrier protein synthase; trans 99.78
1j3n_A 408 3-oxoacyl-(acyl-carrier protein) synthase II; cond 99.78
2gp6_A 434 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol 99.78
2vba_A 406 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop 99.77
2ix4_A 431 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke 99.76
3mqd_A 428 Beta-ketoacyl synthase; ssgcid, ALS collaborative 99.74
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.54
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.5
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.5
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 99.4
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 97.4
2h84_A 374 Steely1; thiolase-fold, type III polyketide syntha 97.16
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, meg 96.81
2ebd_A 309 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 96.39
2hg4_A 917 DEBS, 6-deoxyerythronolide B synthase; ketosynthas 96.29
1mzj_A 339 Beta-ketoacylsynthase III; beta-ketosynthase, arom 96.24
1ulq_A 401 Putative acetyl-COA acetyltransferase; structural 96.01
1wdk_C 390 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame 95.97
1hnj_A 317 Beta-ketoacyl-acyl carrier protein synthase III; F 95.9
2wu9_A 442 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o 95.87
1wl4_A 397 Acetyl-coenzyme A acetyltransferase 2; thiolase fo 95.72
2vu1_A 392 Acetyl-COA acetyltransferase; acyltransferase, PHB 95.57
1afw_A 393 3-ketoacetyl-COA thiolase; fatty acid metabolism; 95.57
1u0m_A 382 Putative polyketide synthase; type III polyketide 95.49
1u6e_A 335 3-oxoacyl-[acyl-carrier-protein] synthase III; tra 95.43
2qo3_A 915 Eryaii erythromycin polyketide synthase modules 3; 95.4
1ub7_A 322 3-oxoacyl-[acyl-carrier protein] synthase; fatty a 95.15
2ib8_A 395 Acetyl-COA acetyltransferase; thiolase fold, potas 95.04
1zow_A 313 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB 94.86
2iik_A 418 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m 94.85
3a5r_A 387 Benzalacetone synthase; chalcone synthase, type II 94.19
2d3m_A 406 Pentaketide chromone synthase; chalcone synthase, 93.53
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 92.47
4dd5_A 396 Acetyl-COA acetyltransferase; structural genomics, 91.99
3goa_A 387 3-ketoacyl-COA thiolase; metabolism, fatty acid, p 91.51
4dfe_A 333 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci 90.43
3svk_A 407 Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, 90.07
2x3e_A 331 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, 89.79
1xes_A 413 Dihydropinosylvin synthase; native structure, tran 89.34
1tqy_A 424 Beta-ketoacyl synthase/acyl transferase; alpha-bet 89.16
3s21_A 345 3-oxoacyl-[ACP] synthase III; non-decarboxylative 88.91
1ee0_A 402 2-pyrone synthase; polyketide synthase, thiolase f 88.49
4e1l_A 395 Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, 87.55
1i88_A 389 CHS2, chalcone synthase 2; polyketide synthase, tr 87.28
2gqd_A 437 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli 87.15
1e5m_A 416 KAS II, beta ketoacyl acyl carrier protein synthas 86.41
3ss6_A 394 Acetyl-COA acetyltransferase; structural genomics, 86.38
1ted_A 393 PKS18; thiolase fold, substrate binding tunnel, tr 86.37
3o04_A 413 LMO2201 protein, beta-keto-acyl carrier protein sy 86.07
3mqd_A 428 Beta-ketoacyl synthase; ssgcid, ALS collaborative 85.92
3il3_A 323 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 85.65
1tqy_B 415 Actinorhodin polyketide putative beta-ketoacyl SY; 85.19
1ox0_A 430 Beta ketoacyl-acyl carrier protein synthase; trans 82.36
3awk_A 402 Chalcone synthase-like polyketide synthase; type I 81.76
2vba_A 406 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop 81.23
3kzu_A 428 3-oxoacyl-(acyl-carrier-protein) synthase II; seat 80.66
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Back     alignment and structure
Probab=99.91  E-value=8.5e-25  Score=186.81  Aligned_cols=150  Identities=43%  Similarity=0.757  Sum_probs=132.2

Q ss_pred             CcceEEEeeecCccchhhcCCcccccccccccccccccccccCcccccCCCCCCCCCCcccCCcCCCCccccCCCHHHHh
Q psy11963         13 TRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNFSGLYGAPSRTGKIKDIASFDAEFFGIHSKLAN   92 (172)
Q Consensus        13 ~~~~V~vg~~~~~~~~~~~~~~~~~~~w~~l~~g~s~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~fd~~~~~~~~~~~~   92 (172)
                      ....|+|||.+|...     +++.+  |+.|.+|++.+.+.+ .+|+. +.|+.+.+.|+++++..||+.+|+|++++++
T Consensus         5 ~IaIvGmg~r~P~~~-----~~~~~--W~~l~~g~~~~~~~~-~~~~~-~~~~~~~~~g~~~~~~~FD~~~f~i~~~ea~   75 (965)
T 3hhd_A            5 EVVIAGMSGKLPESE-----NLQEF--WDNLIGGVDMVTDDD-RRWKA-GLYGLPRRSGKLKDLSRFDASFFGVHPKQAH   75 (965)
T ss_dssp             CEEEEEEEEEBTTBS-----SHHHH--HHHHHTTCCCEECSS-SSSCT-TGGGCCSCEECCSCSSCCCTTTTTCCHHHHH
T ss_pred             CEEEEeeeEECCCCC-----CHHHH--HHHHHcCCCcccCCC-ccccc-ccccCcccccccCChhhcChhhcCCCHHHHh
Confidence            345788999999864     46778  999999999887643 45553 4555667889999999999999999999999


Q ss_pred             hcChHHHHHHHHHHHHHHhCCCCCCCCCCCcceEEEcccchhHHHHhccCCCCCCccccccchhhHHHhHHHHHhCCCC
Q psy11963         93 VMDPQLRMLLELTHESIMDGGFNPEELRGTRTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNFSV  171 (172)
Q Consensus        93 ~~d~~~~~~l~aa~eAl~dAG~~~~~~~~~r~gv~vG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~is~~~~l~~  171 (172)
                      .||||||+++++++|||+|||++++.+++.++||++|++..+|.......+..+.++..+++..+++++|||+.|||++
T Consensus        76 ~mDp~~rL~leaa~eALedAGi~~~~i~~~~~Gv~vG~~~~d~~~~~~~~~~~~~~~~~~g~~~~~~a~ris~~lgl~G  154 (965)
T 3hhd_A           76 TMDPQLRLLLEVTYEAIVDGGINPDSLRGTHTGVWVGVSGSETSEALSRDPETLVGYSMVGCQRAMMANRLSFFFDFRG  154 (965)
T ss_dssp             TSCHHHHHHHHHHHHHHHHTTCCGGGGTTSCCEEEEEECCCHHHHHHTSCTTTCCTHHHHHHSTTHHHHHHHHHHTCCS
T ss_pred             hcCHHHHHHHHHHHHHHHHcCCChHHcCCceeEEEEeccchhHHHHHhcCccccCcccccccccchHHHHHHHHhCCCC
Confidence            9999999999999999999999999999999999999999999888888888899999999999999999999999986
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Back     alignment and structure
>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} Back     alignment and structure
>3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} Back     alignment and structure
>3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A Back     alignment and structure
>3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A Back     alignment and structure
>4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* Back     alignment and structure
>1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A Back     alignment and structure
>2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} Back     alignment and structure
>4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} Back     alignment and structure
>2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* Back     alignment and structure
>1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A Back     alignment and structure
>1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ... Back     alignment and structure
>2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A Back     alignment and structure
>3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} Back     alignment and structure
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Back     alignment and structure
>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} Back     alignment and structure
>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Back     alignment and structure
>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* Back     alignment and structure
>2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A Back     alignment and structure
>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Back     alignment and structure
>2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Back     alignment and structure
>1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A Back     alignment and structure
>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Back     alignment and structure
>1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Back     alignment and structure
>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A Back     alignment and structure
>2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Back     alignment and structure
>3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A Back     alignment and structure
>2d3m_A Pentaketide chromone synthase; chalcone synthase, polyketide synthase, transferase; HET: COA; 1.60A {Aloe arborescens} PDB: 2d51_A 2d52_A* Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Back     alignment and structure
>3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Back     alignment and structure
>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} Back     alignment and structure
>3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} Back     alignment and structure
>2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} Back     alignment and structure
>1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A Back     alignment and structure
>1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A Back     alignment and structure
>1ee0_A 2-pyrone synthase; polyketide synthase, thiolase fold, transferase; HET: CAA; 2.05A {Gerbera hybrid cultivar} SCOP: c.95.1.2 c.95.1.2 PDB: 1qlv_A Back     alignment and structure
>4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Back     alignment and structure
>1i88_A CHS2, chalcone synthase 2; polyketide synthase, transferase; 1.45A {Medicago sativa} SCOP: c.95.1.2 c.95.1.2 PDB: 1i89_A 1i86_A 1i8b_A 1bi5_A 1cml_A* 1d6f_A* 1chw_A* 1cgz_A* 1cgk_A* 1bq6_A* 1jwx_A 1d6i_A 1d6h_A* 1u0v_A 1u0w_A* 1z1e_A* 1z1f_A* Back     alignment and structure
>2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Back     alignment and structure
>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A Back     alignment and structure
>3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} Back     alignment and structure
>3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A* Back     alignment and structure
>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} Back     alignment and structure
>1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A Back     alignment and structure
>3awk_A Chalcone synthase-like polyketide synthase; type III polyketide synthase, transferase; 2.00A {Huperzia serrata} PDB: 3awj_A Back     alignment and structure
>2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ... Back     alignment and structure
>3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 172
d2gfva1250 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II { 5e-10
d2gfva1250 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II { 1e-05
d1j3na1249 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II { 4e-09
d1j3na1249 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II { 1e-04
d1ox0a1256 c.95.1.1 (A:-5-251) Beta-ketoacyl-ACP synthase II 1e-05
d1ox0a1256 c.95.1.1 (A:-5-251) Beta-ketoacyl-ACP synthase II 4e-04
d1e5ma1250 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II { 6e-05
>d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Length = 250 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Thiolase-related
domain: Beta-ketoacyl-ACP synthase II
species: Escherichia coli [TaxId: 562]

 Score = 54.4 bits (130), Expect = 5e-10
 Identities = 20/113 (17%), Positives = 37/113 (32%), Gaps = 7/113 (6%)

Query: 64  YGAPSRTGKIKDIASFDAEFFGIHSKLANVMDPQLRMLLELTHESIMDGGFNPEELRGTR 123
           +   +   K   +         I  K    MD  ++  +    +++ D G    E   TR
Sbjct: 39  FDTSAYATKFAGLVKDFNCEDIISRKEQRKMDAFIQYGIVAGVQAMQDSGLEITEENATR 98

Query: 124 TGVYIG-------LMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNF 169
            G  IG       L+         G P K++ +    +   M+A  L+  +  
Sbjct: 99  IGAAIGSGIGGLGLIEENHTSLMNGGPRKISPFFVPSTIVNMVAGHLTIMYGL 151
>d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Length = 250 Back     information, alignment and structure
>d1j3na1 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Length = 249 Back     information, alignment and structure
>d1j3na1 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Length = 249 Back     information, alignment and structure
>d1ox0a1 c.95.1.1 (A:-5-251) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} Length = 256 Back     information, alignment and structure
>d1ox0a1 c.95.1.1 (A:-5-251) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} Length = 256 Back     information, alignment and structure
>d1e5ma1 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Length = 250 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
d1tqyb1208 Actinorhodin polyketide putative beta-ketoacyl syn 99.82
d2gfva1250 Beta-ketoacyl-ACP synthase II {Escherichia coli [T 99.8
d1ox0a1256 Beta-ketoacyl-ACP synthase II {Streptococcus pneum 99.78
d1j3na1249 Beta-ketoacyl-ACP synthase II {Thermus thermophilu 99.77
d1tqya1216 Actinorhodin polyketide putative beta-ketoacyl syn 99.72
d1e5ma1250 Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ 99.71
d2vbaa1253 Beta-ketoacyl-ACP synthase I {Escherichia coli [Ta 99.27
d2ix4a1270 Beta-ketoacyl-ACP synthase II {Thale cress (Arabid 98.93
d1tqyb1208 Actinorhodin polyketide putative beta-ketoacyl syn 82.34
d1ox0a1256 Beta-ketoacyl-ACP synthase II {Streptococcus pneum 80.04
>d1tqyb1 c.95.1.1 (B:2-209) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Thiolase-related
domain: Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB
species: Streptomyces coelicolor [TaxId: 1902]

Probab=99.82  E-value=8e-21  Score=134.96  Aligned_cols=143  Identities=19%  Similarity=0.227  Sum_probs=117.1

Q ss_pred             cceEEEeeecCccchhhcCCcccccccccccccccccccccCcccccCCCCCCCCCCcccCCcCCCCccccCCCHHHHhh
Q psy11963         14 RTGVYIGLMTTEANDFAEGNPEKLTGYETIGSTRAMLANRLSYAFNFSGLYGAPSRTGKIKDIASFDAEFFGIHSKLANV   93 (172)
Q Consensus        14 ~~~V~vg~~~~~~~~~~~~~~~~~~~w~~l~~g~s~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~fd~~~~~~~~~~~~~   93 (172)
                      ...++|||..|...+     .+.+  |+.|.+|++++....  +|+.+.+  +++..+   ++.+|++..+ +++++.+.
T Consensus         2 VvITG~G~vsp~g~~-----~~~~--w~~L~~G~sgi~~~~--~~~~~~~--~~~~~~---~~~~~~~~~~-~~~~~~~~   66 (208)
T d1tqyb1           2 VLITGVGVVAPNGLG-----LAPY--WSAVLDGRHGLGPVT--RFDVSRY--PATLAG---QIDDFHAPDH-IPGRLLPQ   66 (208)
T ss_dssp             EEEEEEEEEETTEES-----HHHH--HHHHHTTCCCEEECT--TTTGGGS--SCCEEE---CCCSCCHHHH-SCTTTGGG
T ss_pred             EEEEcceeECCCcCC-----HHHH--HHHHHcCCCceecCc--ccCchhc--cccccc---cccccccccc-CChhHhhc
Confidence            457889999998877     5567  999999999886543  5666665  223333   4556777776 89999999


Q ss_pred             cChHHHHHHHHHHHHHHhCCCCCCCCCCCcceEEEcccc-------hhHHHHhccCCCCCCccccccchhhHHHhHHHHH
Q psy11963         94 MDPQLRMLLELTHESIMDGGFNPEELRGTRTGVYIGLMT-------TEANDFAEGNPEKLTGYETIGSTRAMLANRLSYA  166 (172)
Q Consensus        94 ~d~~~~~~l~aa~eAl~dAG~~~~~~~~~r~gv~vG~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~is~~  166 (172)
                      |||++++++.++.|||+|||++++.+.+.++|+++|+..       ..+..+....+..+.|+..+..++++++++||+.
T Consensus        67 ~~~~~~~~~~a~~~Al~~Ag~~~~~~~~~~~g~~~g~~~g~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~a~~ia~~  146 (208)
T d1tqyb1          67 TDPSTRLALTAADWALQDAKADPESLTDYDMGVVTANACGGFDFTHREFRKLWSEGPKSVSVYESFAWFYAVNTGQISIR  146 (208)
T ss_dssp             CCHHHHHHHHHHHHHHHHTTCCGGGSCGGGEEEEEECSSCSHHHHHHHHHHHHHTCGGGSCTTHHHHSSTTHHHHHHHHH
T ss_pred             cccccccccccccccchhhhcccccccccccccccccccccccccchhhhhhccccccccccccccccccccccchhhhc
Confidence            999999999999999999999988888899999999653       3455566677778899999999999999999999


Q ss_pred             hCCCC
Q psy11963        167 FNFSV  171 (172)
Q Consensus       167 ~~l~~  171 (172)
                      ||+++
T Consensus       147 ~gl~G  151 (208)
T d1tqyb1         147 HGMRG  151 (208)
T ss_dssp             HTCCS
T ss_pred             ccccc
Confidence            99987
>d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3na1 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tqya1 c.95.1.1 (A:3-218) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1e5ma1 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d2vbaa1 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ix4a1 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Back     information, alignment and structure
>d1tqyb1 c.95.1.1 (B:2-209) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure