Psyllid ID: psy11966

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MTQFVLVAPSTPRAAKSNSPIFALAGPCCTIDTACSSTLFGLHLAVGAIERGECDHAIIGGVNLTLKPATSLMYHKYNMLSPTGTISPFDASGVGHRQP
cccccccccccccccccHHHHcccccccHHHHcHHHHHHHHHHHHHHHHHHcccHHHHHHcccEEEccHHHHHHHHHcccccccccccccccccccccc
cccEEEcccHHHHHHccEEEEEcccccEEEEccccHHHHHHHHHHHHHHHcccccEEEEccEEEEccHHHHHHHHHHcccccccccccccccccccccc
mtqfvlvapstpraaksnspifalagpcctidtacssTLFGLHLAVGaiergecdhaiiggvnltlkpatslmyhkynmlsptgtispfdasgvghrqp
mtqfvlvapstpraaksnspIFALAGPCCTIDTACSSTLFGLHLAVGAIERGECDHAIIGGVNLTLKPATSLMYHKYNMLSPTGtispfdasgvghrqp
MTQFVLVAPSTPRAAKSNSPIFALAGPCCTIDTACSSTLFGLHLAVGAIERGECDHAIIGGVNLTLKPATSLMYHKYNMLSPTGTISPFDASGVGHRQP
*******************PIFALAGPCCTIDTACSSTLFGLHLAVGAIERGECDHAIIGGVNLTLKPATSLMYHKYNMLSP*****************
*TQFVLVAPSTPRAAKSNSPIFALAGPCCTIDTACSSTLFGLHLAVGAIERGECDHAIIGGVNLTLKPATSLMYHKYNMLSPTGTISPFDASGVGHRQ*
***************KSNSPIFALAGPCCTIDTACSSTLFGLHLAVGAIERGECDHAIIGGVNLTLKPATSLMYHKYNMLSPTGTISPFDA********
MTQFVLVAPSTPRAAKSNSPIFALAGPCCTIDTACSSTLFGLHLAVGAIERGECDHAIIGGVNLTLKPATSLMYHKYNML*PTGTISPFDASGV*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTQFVLVAPSTPRAAKSNSPIFALAGPCCTIDTACSSTLFGLHLAVGAIERGECDHAIIGGVNLTLKPATSLMYHKYNMLSPTGTISPFDASGVGHRQP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query99 2.2.26 [Sep-21-2011]
Q71SP7 2513 Fatty acid synthase OS=Bo yes N/A 0.848 0.033 0.546 7e-18
P12785 2505 Fatty acid synthase OS=Ra yes N/A 0.848 0.033 0.511 1e-15
P19096 2504 Fatty acid synthase OS=Mu yes N/A 0.848 0.033 0.5 2e-15
P12276 2512 Fatty acid synthase OS=Ga yes N/A 0.848 0.033 0.488 2e-15
P36189 352 Fatty acid synthase (Frag N/A N/A 0.787 0.221 0.512 5e-15
P49327 2511 Fatty acid synthase OS=Ho yes N/A 0.848 0.033 0.465 4e-14
P96203 1827 Phthiocerol synthesis pol yes N/A 0.757 0.041 0.453 4e-12
Q7TXL7 1827 Phthiocerol/phenolphthioc yes N/A 0.757 0.041 0.453 4e-12
P96202 2188 Phthiocerol synthesis pol no N/A 0.767 0.034 0.447 7e-12
Q7TXL8 2188 Phthiocerol/phenolphthioc no N/A 0.767 0.034 0.447 7e-12
>sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 Back     alignment and function desciption
 Score = 89.4 bits (220), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 47/86 (54%), Positives = 56/86 (65%), Gaps = 2/86 (2%)

Query: 13  RAAKSN--SPIFALAGPCCTIDTACSSTLFGLHLAVGAIERGECDHAIIGGVNLTLKPAT 70
           RA  +N  S  F   GP  T+DTACSS+L  L  A  AI+RGEC  AI+GGVN+ LKP T
Sbjct: 137 RAMLANRLSFFFDFKGPSITLDTACSSSLLALQRAYQAIQRGECAMAIVGGVNIRLKPNT 196

Query: 71  SLMYHKYNMLSPTGTISPFDASGVGH 96
           S+ + K  MLSP GT   FDASG G+
Sbjct: 197 SVQFMKLGMLSPEGTCKFFDASGNGY 222
Fatty acid synthetase catalyzes the formation of long-chain fatty acids from acetyl-CoA, malonyl-CoA and NADPH. This multifunctional protein has 7 catalytic activities and an acyl carrier protein.
Bos taurus (taxid: 9913)
EC: 3EC: .EC: 1EC: .EC: 2EC: .EC: 1EC: 4
>sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 Back     alignment and function description
>sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 Back     alignment and function description
>sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 Back     alignment and function description
>sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 Back     alignment and function description
>sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 Back     alignment and function description
>sp|P96203|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis GN=ppsD PE=3 SV=1 Back     alignment and function description
>sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 Back     alignment and function description
>sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis GN=ppsC PE=1 SV=2 Back     alignment and function description
>sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query99
328717598 1975 PREDICTED: fatty acid synthase-like, par 0.757 0.037 0.613 7e-21
328717600 1421 PREDICTED: fatty acid synthase-like [Acy 0.757 0.052 0.613 2e-20
189233593 3189 PREDICTED: similar to fatty acid synthas 0.848 0.026 0.534 2e-17
322779501 2220 hypothetical protein SINV_14684 [Solenop 0.969 0.043 0.447 2e-17
307171604 231 Fatty acid synthase [Camponotus floridan 0.747 0.320 0.567 4e-17
345479260 2408 PREDICTED: fatty acid synthase-like isof 0.787 0.032 0.5 6e-17
345479258 2398 PREDICTED: fatty acid synthase-like isof 0.787 0.032 0.5 6e-17
270014917 2383 hypothetical protein TcasGA2_TC011522 [T 0.848 0.035 0.534 7e-17
78214939 2514 fatty acid synthase [Capra hircus] 0.828 0.032 0.536 1e-16
374092388 2392 fatty acid synthase [Bombus lucorum] 0.787 0.032 0.512 2e-16
>gi|328717598|ref|XP_001942583.2| PREDICTED: fatty acid synthase-like, partial [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  104 bits (260), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 46/75 (61%), Positives = 54/75 (72%)

Query: 22  FALAGPCCTIDTACSSTLFGLHLAVGAIERGECDHAIIGGVNLTLKPATSLMYHKYNMLS 81
           F   GP   +DTACSS LF LH A+ AI+ G+CD AI+ G NL LKPATS+MYH+YNMLS
Sbjct: 151 FNFNGPSVAVDTACSSALFCLHDAITAIQTGQCDAAIVAGTNLLLKPATSVMYHRYNMLS 210

Query: 82  PTGTISPFDASGVGH 96
           PTGT  PFD    G+
Sbjct: 211 PTGTSRPFDIGANGY 225

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328717600|ref|XP_001945449.2| PREDICTED: fatty acid synthase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|189233593|ref|XP_970417.2| PREDICTED: similar to fatty acid synthase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|322779501|gb|EFZ09693.1| hypothetical protein SINV_14684 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307171604|gb|EFN63391.1| Fatty acid synthase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345479260|ref|XP_001605059.2| PREDICTED: fatty acid synthase-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345479258|ref|XP_003423914.1| PREDICTED: fatty acid synthase-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|270014917|gb|EFA11365.1| hypothetical protein TcasGA2_TC011522 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|78214939|gb|ABB36643.1| fatty acid synthase [Capra hircus] Back     alignment and taxonomy information
>gi|374092388|gb|AEY83835.1| fatty acid synthase [Bombus lucorum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query99
UNIPROTKB|F1N647 2512 FASN "Fatty acid synthase" [Bo 0.848 0.033 0.546 6.3e-16
UNIPROTKB|Q71SP7 2513 FASN "Fatty acid synthase" [Bo 0.848 0.033 0.546 1.3e-15
ZFIN|ZDB-GENE-030131-7802 2514 fasn "fatty acid synthase" [Da 0.848 0.033 0.546 2.2e-15
UNIPROTKB|F1Q2F6 2518 FASN "Uncharacterized protein" 0.848 0.033 0.488 3.2e-14
UNIPROTKB|I3LC73 1375 FASN "Uncharacterized protein" 0.848 0.061 0.5 4.2e-14
RGD|620665 2505 Fasn "fatty acid synthase" [Ra 0.848 0.033 0.511 5.2e-14
UNIPROTKB|P12785 2505 Fasn "Fatty acid synthase" [Ra 0.848 0.033 0.511 5.2e-14
UNIPROTKB|E1BWG0 2446 FASN "Fatty acid synthase" [Ga 0.848 0.034 0.488 6.4e-14
MGI|MGI:95485 2504 Fasn "fatty acid synthase" [Mu 0.848 0.033 0.5 6.6e-14
UNIPROTKB|F1N8A8 2512 FASN "Fatty acid synthase" [Ga 0.848 0.033 0.488 6.6e-14
UNIPROTKB|F1N647 FASN "Fatty acid synthase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 216 (81.1 bits), Expect = 6.3e-16, P = 6.3e-16
 Identities = 47/86 (54%), Positives = 56/86 (65%)

Query:    13 RAAKSN--SPIFALAGPCCTIDTACSSTLFGLHLAVGAIERGECDHAIIGGVNLTLKPAT 70
             RA  +N  S  F   GP  T+DTACSS+L  L  A  AI+RGEC  AI+GGVN+ LKP T
Sbjct:   137 RAMLANRLSFFFDFKGPSITLDTACSSSLLALQRAYQAIQRGECAMAIVGGVNILLKPNT 196

Query:    71 SLMYHKYNMLSPTGTISPFDASGVGH 96
             S+ + K  MLSP GT   FDASG G+
Sbjct:   197 SVQFMKLGMLSPEGTCKSFDASGNGY 222
GO:0042587 "glycogen granule" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=IEA
GO:0005739 "mitochondrion" evidence=IEA
GO:0016296 "palmitoyl-[acyl-carrier-protein
GO:0016295 "myristoyl-[acyl-carrier-protein
GO:0009058 "biosynthetic process" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0004320 "oleoyl-[acyl-carrier-protein
GO:0004319 "enoyl-[acyl-carrier-protein
GO:0004317 "3-hydroxypalmitoyl-[acyl-carrier-protein
GO:0004316 "3-oxoacyl-[acyl-carrier-protein
GO:0004315 "3-oxoacyl-[acyl-carrier-protein
GO:0004314 "[acyl-carrier-protein
GO:0004313 "[acyl-carrier-protein
GO:0000166 "nucleotide binding" evidence=IEA
UNIPROTKB|Q71SP7 FASN "Fatty acid synthase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7802 fasn "fatty acid synthase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q2F6 FASN "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LC73 FASN "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|620665 Fasn "fatty acid synthase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P12785 Fasn "Fatty acid synthase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWG0 FASN "Fatty acid synthase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:95485 Fasn "fatty acid synthase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1N8A8 FASN "Fatty acid synthase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q71SP7FAS_BOVIN3, ., 1, ., 2, ., 1, 40.54650.84840.0334yesN/A
P12785FAS_RAT3, ., 1, ., 2, ., 1, 40.51160.84840.0335yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query99
cd00833 421 cd00833, PKS, polyketide synthases (PKSs) polymeri 3e-25
smart00825 298 smart00825, PKS_KS, Beta-ketoacyl synthase 1e-23
COG3321 1061 COG3321, COG3321, Polyketide synthase modules and 1e-21
pfam00109243 pfam00109, ketoacyl-synt, Beta-ketoacyl synthase, 1e-14
cd00825 332 cd00825, decarbox_cond_enzymes, decarboxylating co 2e-08
COG0304 412 COG0304, FabB, 3-oxoacyl-(acyl-carrier-protein) sy 1e-06
cd00828 407 cd00828, elong_cond_enzymes, "elongating" condensi 5e-06
PRK09185 392 PRK09185, PRK09185, 3-oxoacyl-(acyl carrier protei 1e-05
cd00834 406 cd00834, KAS_I_II, Beta-ketoacyl-acyl carrier prot 5e-05
TIGR02813 2582 TIGR02813, omega_3_PfaA, polyketide-type polyunsat 7e-05
COG0183 392 COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid 5e-04
TIGR01930 386 TIGR01930, AcCoA-C-Actrans, acetyl-CoA acetyltrans 0.001
cd00830 320 cd00830, KAS_III, Ketoacyl-acyl carrier protein sy 0.003
COG0332 323 COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein] 0.003
pfam00108 262 pfam00108, Thiolase_N, Thiolase, N-terminal domain 0.004
>gnl|CDD|238429 cd00833, PKS, polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information 
 Score = 96.5 bits (241), Expect = 3e-25
 Identities = 40/77 (51%), Positives = 48/77 (62%)

Query: 19  SPIFALAGPCCTIDTACSSTLFGLHLAVGAIERGECDHAIIGGVNLTLKPATSLMYHKYN 78
           S  F L GP  T+DTACSS+L  LHLA  ++  GECD A++GGVNL L P   + + K  
Sbjct: 154 SYFFDLRGPSLTVDTACSSSLVALHLACQSLRSGECDLALVGGVNLILSPDMFVGFSKAG 213

Query: 79  MLSPTGTISPFDASGVG 95
           MLSP G   PFDA   G
Sbjct: 214 MLSPDGRCRPFDADADG 230

PKSs can be divided into 2 groups, modular type I PKSs consisting of one or more large multifunctional proteins and iterative type II PKSs, complexes of several monofunctional subunits. Length = 421
>gnl|CDD|214836 smart00825, PKS_KS, Beta-ketoacyl synthase Back     alignment and domain information
>gnl|CDD|225858 COG3321, COG3321, Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215723 pfam00109, ketoacyl-synt, Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>gnl|CDD|238421 cd00825, decarbox_cond_enzymes, decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>gnl|CDD|223381 COG0304, FabB, 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|238424 cd00828, elong_cond_enzymes, "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>gnl|CDD|236398 PRK09185, PRK09185, 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>gnl|CDD|238430 cd00834, KAS_I_II, Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>gnl|CDD|234022 TIGR02813, omega_3_PfaA, polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>gnl|CDD|223261 COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|233642 TIGR01930, AcCoA-C-Actrans, acetyl-CoA acetyltransferases Back     alignment and domain information
>gnl|CDD|238426 cd00830, KAS_III, Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>gnl|CDD|223409 COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>gnl|CDD|215722 pfam00108, Thiolase_N, Thiolase, N-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 99
PRK14691 342 3-oxoacyl-(acyl carrier protein) synthase II; Prov 99.94
KOG1394|consensus 440 99.92
PRK08722 414 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.92
PF00109254 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal 99.92
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 99.92
COG0304 412 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Li 99.91
PRK07967 406 3-oxoacyl-(acyl carrier protein) synthase I; Revie 99.91
PRK05952 381 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.9
PRK07910 418 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.9
PLN02787 540 3-oxoacyl-[acyl-carrier-protein] synthase II 99.9
cd00832 399 CLF Chain-length factor (CLF) is a factor required 99.9
PRK06333 424 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.89
COG3321 1061 Polyketide synthase modules and related proteins [ 99.89
PTZ00050 421 3-oxoacyl-acyl carrier protein synthase; Provision 99.89
PRK08439 406 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.89
PRK09116 405 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.88
PLN02836 437 3-oxoacyl-[acyl-carrier-protein] synthase 99.88
PRK06519 398 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.87
cd00828 407 elong_cond_enzymes "elongating" condensing enzymes 99.85
PRK07314 411 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.85
PRK07103 410 polyketide beta-ketoacyl:acyl carrier protein synt 99.85
PRK06501 425 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.84
TIGR03150 407 fabF beta-ketoacyl-acyl-carrier-protein synthase I 99.84
smart00825 424 PKS_KS Beta-ketoacyl synthase. The structure of be 99.81
cd00834 406 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) 99.81
cd00833 421 PKS polyketide synthases (PKSs) polymerize simple 99.81
PRK09185 392 3-oxoacyl-(acyl carrier protein) synthase I; Revie 99.79
KOG1202|consensus 2376 99.77
cd00825 332 decarbox_cond_enzymes decarboxylating condensing e 99.66
PRK06147 348 3-oxoacyl-(acyl carrier protein) synthase; Validat 99.27
PRK13359 400 beta-ketoadipyl CoA thiolase; Provisional 98.92
PF00108 264 Thiolase_N: Thiolase, N-terminal domain; InterPro: 98.92
PRK07108 392 acetyl-CoA acetyltransferase; Provisional 98.89
TIGR02430 400 pcaF beta-ketoadipyl CoA thiolase. Members of this 98.86
PRK09050 401 beta-ketoadipyl CoA thiolase; Validated 98.85
PRK08963 428 fadI 3-ketoacyl-CoA thiolase; Reviewed 98.85
cd00327 254 cond_enzymes Condensing enzymes; Family of enzymes 98.84
PRK07850 387 acetyl-CoA acetyltransferase; Provisional 98.83
COG0183 392 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolis 98.8
PRK06816 378 3-oxoacyl-(acyl carrier protein) synthase III; Rev 98.79
TIGR02446 430 FadI fatty oxidation complex, beta subunit FadI. T 98.77
PRK06633 392 acetyl-CoA acetyltransferase; Provisional 98.75
PRK06690 361 acetyl-CoA acetyltransferase; Provisional 98.75
PRK08131 401 acetyl-CoA acetyltransferase; Provisional 98.72
PRK07661 391 acetyl-CoA acetyltransferase; Provisional 98.72
PRK06504 390 acetyl-CoA acetyltransferase; Provisional 98.7
PRK08947 387 fadA 3-ketoacyl-CoA thiolase; Reviewed 98.69
PTZ00455 438 3-ketoacyl-CoA thiolase; Provisional 98.67
PRK06025 417 acetyl-CoA acetyltransferase; Provisional 98.67
PRK08256 391 lipid-transfer protein; Provisional 98.65
PRK09268 427 acetyl-CoA acetyltransferase; Provisional 98.65
PRK06366 388 acetyl-CoA acetyltransferase; Provisional 98.65
PRK06157 398 acetyl-CoA acetyltransferase; Validated 98.64
PRK05656 393 acetyl-CoA acetyltransferase; Provisional 98.63
PRK07851 406 acetyl-CoA acetyltransferase; Provisional 98.62
TIGR02445 385 fadA fatty oxidation complex, beta subunit FadA. T 98.62
PRK06064 389 acetyl-CoA acetyltransferase; Provisional 98.62
PRK06205 404 acetyl-CoA acetyltransferase; Provisional 98.59
PRK08242 402 acetyl-CoA acetyltransferase; Validated 98.59
PRK09352 319 3-oxoacyl-(acyl carrier protein) synthase III; Rev 98.57
PRK06059 399 lipid-transfer protein; Provisional 98.56
PRK09051 394 beta-ketothiolase; Provisional 98.54
PRK08235 393 acetyl-CoA acetyltransferase; Provisional 98.53
PRK12578 385 acetyl-CoA acetyltransferase; Provisional 98.52
PRK09052 399 acetyl-CoA acetyltransferase; Provisional 98.5
PRK06365 430 acetyl-CoA acetyltransferase; Provisional 98.5
PRK08170 426 acetyl-CoA acetyltransferase; Provisional 98.5
PRK07515 372 3-oxoacyl-(acyl carrier protein) synthase III; Rev 98.49
PLN02287 452 3-ketoacyl-CoA thiolase 98.49
cd00826 393 nondecarbox_cond_enzymes nondecarboxylating conden 98.47
cd00829 375 SCP-x_thiolase Thiolase domain associated with ste 98.47
PRK06954 397 acetyl-CoA acetyltransferase; Provisional 98.46
PLN02644 394 acetyl-CoA C-acetyltransferase 98.45
cd00751 386 thiolase Thiolase are ubiquitous enzymes that cata 98.45
PRK07801 382 acetyl-CoA acetyltransferase; Provisional 98.37
TIGR00747 318 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III 98.37
PRK07516 389 acetyl-CoA acetyltransferase; Provisional 98.32
PRK09258 338 3-oxoacyl-(acyl carrier protein) synthase III; Rev 98.3
PRK06445 394 acetyl-CoA acetyltransferase; Provisional 98.28
KOG1390|consensus 396 98.28
PRK06065 392 acetyl-CoA acetyltransferase; Provisional 98.27
PRK05790 393 putative acyltransferase; Provisional 98.27
TIGR01930 386 AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi 98.26
KOG1406|consensus 408 98.21
PRK07204 329 3-oxoacyl-(acyl carrier protein) synthase III; Rev 98.21
cd00827 324 init_cond_enzymes "initiating" condensing enzymes 98.21
TIGR02845 327 spore_V_AD stage V sporulation protein AD. Bacillu 98.2
cd00830 320 KAS_III Ketoacyl-acyl carrier protein synthase III 98.2
CHL00203 326 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr 98.16
PRK12879 325 3-oxoacyl-(acyl carrier protein) synthase III; Rev 98.16
PRK08313 386 acetyl-CoA acetyltransferase; Provisional 98.14
PRK06289 403 acetyl-CoA acetyltransferase; Provisional 98.14
PRK08304 337 stage V sporulation protein AD; Validated 98.07
PRK08142 388 acetyl-CoA acetyltransferase; Provisional 98.04
PRK06158 384 thiolase; Provisional 98.01
PLN02326 379 3-oxoacyl-[acyl-carrier-protein] synthase III 97.98
PRK07855 386 lipid-transfer protein; Provisional 97.81
PRK12404 334 stage V sporulation protein AD; Provisional 97.8
COG0332 323 FabH 3-oxoacyl-[acyl-carrier-protein] 97.73
PRK06840 339 hypothetical protein; Validated 97.72
KOG1389|consensus 435 97.71
PRK04262 347 hypothetical protein; Provisional 97.7
PF13723218 Ketoacyl-synt_2: Beta-ketoacyl synthase, N-termina 97.69
TIGR01835 379 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synt 97.59
TIGR00748 345 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase 97.56
PRK08257 498 acetyl-CoA acetyltransferase; Validated 97.5
PF0854580 ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP) 97.43
PRK06066 385 acetyl-CoA acetyltransferase; Provisional 97.43
KOG1392|consensus 465 97.4
cd00831 361 CHS_like Chalcone and stilbene synthases; plant-sp 97.33
PLN02932 478 3-ketoacyl-CoA synthase 97.29
PLN02192 511 3-ketoacyl-CoA synthase 97.25
PLN03168 389 chalcone synthase; Provisional 97.24
PRK12880 353 3-oxoacyl-(acyl carrier protein) synthase III; Rev 97.23
KOG1391|consensus 396 97.22
PRK05963 326 3-oxoacyl-(acyl carrier protein) synthase II; Revi 97.19
PLN02854 521 3-ketoacyl-CoA synthase 97.18
PLN02377 502 3-ketoacyl-CoA synthase 97.16
PLN03172 393 chalcone synthase family protein; Provisional 97.02
PLN03169 391 chalcone synthase family protein; Provisional 96.96
PLN03170 401 chalcone synthase; Provisional 96.96
PLN03173 391 chalcone synthase; Provisional 96.93
PF08392290 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase- 96.87
PLN03171 399 chalcone synthase-like protein; Provisional 96.59
PLN00415 466 3-ketoacyl-CoA synthase 96.36
PRK07937 352 lipid-transfer protein; Provisional 95.79
PLN02577 459 hydroxymethylglutaryl-CoA synthase 95.66
TIGR01833 454 HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synth 95.61
PF01154174 HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A s 95.47
COG3425 377 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipi 94.38
PF07451 329 SpoVAD: Stage V sporulation protein AD (SpoVAD); I 93.84
PF00195226 Chal_sti_synt_N: Chalcone and stilbene synthases, 92.23
COG3424 356 BcsA Predicted naringenin-chalcone synthase [Secon 86.1
>PRK14691 3-oxoacyl-(acyl carrier protein) synthase II; Provisional Back     alignment and domain information 
Probab=99.94  E-value=2.1e-26  Score=164.07  Aligned_cols=99  Identities=24%  Similarity=0.292  Sum_probs=93.7

Q ss_pred             CCcccccCCCcchHHhHHHHHhCCCCCcceecccchHHHHHHHHHHHHHHcCCCCEEEEEecCCCCCHHHHHHHHHccCC
Q psy11966          1 MTQFVLVAPSTPRAAKSNSPIFALAGPCCTIDTACSSTLFGLHLAVGAIERGECDHAIIGGVNLTLKPATSLMYHKYNML   80 (99)
Q Consensus         1 ~~~~~~~~~~~~~~~~~ia~~~~l~Gp~~tv~~acaS~~~Ai~~A~~~i~~G~~d~~l~gg~~~~~~~~~~~~~~~~~~l   80 (99)
                      ++|+.++.++.|+++++|++.|+++||+++++++|+|++.||..|+++|++|++|++||||+|..+++..+..|..++.+
T Consensus        57 ~~p~~~~~~~~n~~a~~is~~~~l~Gp~~ti~~aCaSg~~Al~~A~~~I~~G~~d~~ivgg~d~~~~~~~~~~f~~~~~l  136 (342)
T PRK14691         57 LSPFTVPSFLVNLAAGHVSIKHHFKGPIGAPVTACAAGVQAIGDAVRMIRNNEADVALCGGAEAVIDTVSLAGFAAARAL  136 (342)
T ss_pred             cChhHHhhhhhhHHHHHHHHHhCCCCCccccccHhHHHHHHHHHHHHHHHcCCCCEEEEecccccCCHHHHHHHHHhhhh
Confidence            46888999999999999999999999999999999999999999999999999999999999999999999999999888


Q ss_pred             C------CCCCCcccCCCCCceeCC
Q psy11966         81 S------PTGTISPFDASGVGHRQP   99 (99)
Q Consensus        81 s------~~~~~~pfd~~~~G~v~g   99 (99)
                      +      |++.|||||++|+||++|
T Consensus       137 s~~~~~~p~~~~rPFd~~r~G~v~g  161 (342)
T PRK14691        137 STHFNSTPEKASRPFDTARDGFVMG  161 (342)
T ss_pred             hcCCCCCCCcCCCCCCCCCCCcccc
Confidence            7      567899999999999985

>KOG1394|consensus Back     alignment and domain information
>PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PF00109 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal domain; InterPro: IPR014030 Beta-ketoacyl-ACP synthase 2 Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK07967 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PLN02787 3-oxoacyl-[acyl-carrier-protein] synthase II Back     alignment and domain information
>cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>COG3321 Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional Back     alignment and domain information
>PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PLN02836 3-oxoacyl-[acyl-carrier-protein] synthase Back     alignment and domain information
>PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated Back     alignment and domain information
>PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>TIGR03150 fabF beta-ketoacyl-acyl-carrier-protein synthase II Back     alignment and domain information
>smart00825 PKS_KS Beta-ketoacyl synthase Back     alignment and domain information
>cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information
>PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated Back     alignment and domain information
>PRK13359 beta-ketoadipyl CoA thiolase; Provisional Back     alignment and domain information
>PF00108 Thiolase_N: Thiolase, N-terminal domain; InterPro: IPR020616 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>PRK07108 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR02430 pcaF beta-ketoadipyl CoA thiolase Back     alignment and domain information
>PRK09050 beta-ketoadipyl CoA thiolase; Validated Back     alignment and domain information
>PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>PRK07850 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>TIGR02446 FadI fatty oxidation complex, beta subunit FadI Back     alignment and domain information
>PRK06633 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06690 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08131 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07661 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06504 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PTZ00455 3-ketoacyl-CoA thiolase; Provisional Back     alignment and domain information
>PRK06025 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08256 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK09268 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06366 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06157 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK05656 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07851 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR02445 fadA fatty oxidation complex, beta subunit FadA Back     alignment and domain information
>PRK06064 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06205 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08242 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK06059 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK09051 beta-ketothiolase; Provisional Back     alignment and domain information
>PRK08235 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK12578 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09052 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06365 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08170 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PLN02287 3-ketoacyl-CoA thiolase Back     alignment and domain information
>cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism Back     alignment and domain information
>PRK06954 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PLN02644 acetyl-CoA C-acetyltransferase Back     alignment and domain information
>cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK07801 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III Back     alignment and domain information
>PRK07516 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK06445 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>KOG1390|consensus Back     alignment and domain information
>PRK06065 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK05790 putative acyltransferase; Provisional Back     alignment and domain information
>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases Back     alignment and domain information
>KOG1406|consensus Back     alignment and domain information
>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>TIGR02845 spore_V_AD stage V sporulation protein AD Back     alignment and domain information
>cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK08313 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06289 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08304 stage V sporulation protein AD; Validated Back     alignment and domain information
>PRK08142 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06158 thiolase; Provisional Back     alignment and domain information
>PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III Back     alignment and domain information
>PRK07855 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK12404 stage V sporulation protein AD; Provisional Back     alignment and domain information
>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK06840 hypothetical protein; Validated Back     alignment and domain information
>KOG1389|consensus Back     alignment and domain information
>PRK04262 hypothetical protein; Provisional Back     alignment and domain information
>PF13723 Ketoacyl-synt_2: Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>TIGR01835 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade Back     alignment and domain information
>TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative Back     alignment and domain information
>PRK08257 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PF08545 ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III; InterPro: IPR013751 Fatty acid synthesis (FAS) is a vital aspect of cellular physiology which can occur by two distinct pathways Back     alignment and domain information
>PRK06066 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>KOG1392|consensus Back     alignment and domain information
>cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs Back     alignment and domain information
>PLN02932 3-ketoacyl-CoA synthase Back     alignment and domain information
>PLN02192 3-ketoacyl-CoA synthase Back     alignment and domain information
>PLN03168 chalcone synthase; Provisional Back     alignment and domain information
>PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>KOG1391|consensus Back     alignment and domain information
>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PLN02854 3-ketoacyl-CoA synthase Back     alignment and domain information
>PLN02377 3-ketoacyl-CoA synthase Back     alignment and domain information
>PLN03172 chalcone synthase family protein; Provisional Back     alignment and domain information
>PLN03169 chalcone synthase family protein; Provisional Back     alignment and domain information
>PLN03170 chalcone synthase; Provisional Back     alignment and domain information
>PLN03173 chalcone synthase; Provisional Back     alignment and domain information
>PF08392 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase-like protein; InterPro: IPR013601 This domain is found in proteins that are described as 3-ketoacyl-CoA synthases, type III polyketide synthases, fatty acid elongases and fatty acid condensing enzymes, and are found in both prokaryotic and eukaryotic (mainly plant) species Back     alignment and domain information
>PLN03171 chalcone synthase-like protein; Provisional Back     alignment and domain information
>PLN00415 3-ketoacyl-CoA synthase Back     alignment and domain information
>PRK07937 lipid-transfer protein; Provisional Back     alignment and domain information
>PLN02577 hydroxymethylglutaryl-CoA synthase Back     alignment and domain information
>TIGR01833 HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synthase, eukaryotic clade Back     alignment and domain information
>PF01154 HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A synthase N terminal; InterPro: IPR013528 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase Back     alignment and domain information
>COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] Back     alignment and domain information
>PF07451 SpoVAD: Stage V sporulation protein AD (SpoVAD); InterPro: IPR010894 This family contains the bacterial stage V sporulation protein AD (SpoVAD), which is approximately 340 residues long Back     alignment and domain information
>PF00195 Chal_sti_synt_N: Chalcone and stilbene synthases, N-terminal domain; InterPro: IPR001099 Synonym(s): Chalcone synthase, Flavonone synthase, 6'-deoxychalcone synthase Naringenin-chalcone synthases (2 Back     alignment and domain information
>COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query99
2vz8_A 2512 Crystal Structure Of Mammalian Fatty Acid Synthase 1e-16
3hhd_A 965 Structure Of The Human Fatty Acid Synthase Ks-Mat D 4e-15
2qo3_A 915 Crystal Structure Of [ks3][at3] Didomain From Modul 1e-08
2hg4_A 917 Structure Of The Ketosynthase-acyltransferase Didom 3e-08
>pdb|2VZ8|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase Length = 2512 Back     alignment and structure 
Iteration: 1

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
Query: 13  RAAKSN--SPIFALAGPCCTIDTACSSTLFGLHLAVGAIERGECDHAIIGGVNLTLKPAT 70
           RA  +N  S  F   GP  TIDTACSS+L  L  A  AI  GEC  A++GG+N+ LKP +
Sbjct: 137 RAMMANRLSFFFDFKGPSITIDTACSSSLLALQSAYQAIRGGECSAAVVGGLNVLLKPNS 196
Query: 71  SLMYHKYNMLSPTGTISPFDASGVGH 96
           SL + K  MLS  GT   FDA G G+
Sbjct: 197 SLQFMKLGMLSQDGTCRSFDAEGTGY 222
>pdb|3HHD|A Chain A, Structure Of The Human Fatty Acid Synthase Ks-Mat Didomain As A Framework For Inhibitor Design. Length = 965 Back     alignment and structure
>pdb|2QO3|A Chain A, Crystal Structure Of [ks3][at3] Didomain From Module 3 Of 6- Deoxyerthronolide B Synthase Length = 915 Back     alignment and structure
>pdb|2HG4|A Chain A, Structure Of The Ketosynthase-acyltransferase Didomain Of Module 5 From Debs. Length = 917 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query99
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 7e-27
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, meg 1e-24
2hg4_A 917 DEBS, 6-deoxyerythronolide B synthase; ketosynthas 5e-19
2qo3_A 915 Eryaii erythromycin polyketide synthase modules 3; 8e-19
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 9e-07
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 2e-04
3goa_A 387 3-ketoacyl-COA thiolase; metabolism, fatty acid, p 4e-04
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 6e-04
1wdk_C 390 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame 8e-04
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Back     alignment and structure
 Score =  101 bits (253), Expect = 7e-27
 Identities = 40/77 (51%), Positives = 47/77 (61%)

Query: 19  SPIFALAGPCCTIDTACSSTLFGLHLAVGAIERGECDHAIIGGVNLTLKPATSLMYHKYN 78
           S  F   GP  TIDTACSS+L  L  A  AI  GEC  A++GG+N+ LKP +SL + K  
Sbjct: 145 SFFFDFKGPSITIDTACSSSLLALQSAYQAIRGGECSAAVVGGLNVLLKPNSSLQFMKLG 204

Query: 79  MLSPTGTISPFDASGVG 95
           MLS  GT   FDA G G
Sbjct: 205 MLSQDGTCRSFDAEGTG 221
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Length = 965 Back     alignment and structure
>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} Length = 917 Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Length = 915 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Length = 387 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Length = 390 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query99
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.93
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, meg 99.9
2vba_A 406 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop 99.9
2iwz_A 438 3-oxoacyl-[acyl-carrier-protein] synthase; mitocho 99.89
1ox0_A 430 Beta ketoacyl-acyl carrier protein synthase; trans 99.89
1e5m_A 416 KAS II, beta ketoacyl acyl carrier protein synthas 99.89
4ewg_A 412 Beta-ketoacyl synthase; ssgcid, structural genomic 99.89
3mqd_A 428 Beta-ketoacyl synthase; ssgcid, ALS collaborative 99.88
2gqd_A 437 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli 99.88
1tqy_B 415 Actinorhodin polyketide putative beta-ketoacyl SY; 99.88
2gp6_A 434 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol 99.88
2hg4_A 917 DEBS, 6-deoxyerythronolide B synthase; ketosynthas 99.88
2qo3_A 915 Eryaii erythromycin polyketide synthase modules 3; 99.88
3o04_A 413 LMO2201 protein, beta-keto-acyl carrier protein sy 99.88
1tqy_A 424 Beta-ketoacyl synthase/acyl transferase; alpha-bet 99.87
1j3n_A 408 3-oxoacyl-(acyl-carrier protein) synthase II; cond 99.87
3ho9_A 427 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, 99.87
3kzu_A 428 3-oxoacyl-(acyl-carrier-protein) synthase II; seat 99.87
2wge_A 416 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta 99.87
2ix4_A 431 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke 99.87
4ddo_A 451 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci 99.86
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.83
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.83
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.8
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 99.77
1wl4_A 397 Acetyl-coenzyme A acetyltransferase 2; thiolase fo 99.46
1wdk_C 390 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame 99.36
2iik_A 418 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m 99.25
2ib8_A 395 Acetyl-COA acetyltransferase; thiolase fold, potas 99.16
2vu1_A 392 Acetyl-COA acetyltransferase; acyltransferase, PHB 99.15
1ulq_A 401 Putative acetyl-COA acetyltransferase; structural 99.11
2ebd_A 309 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 99.1
3s21_A 345 3-oxoacyl-[ACP] synthase III; non-decarboxylative 99.1
2wu9_A 442 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o 99.08
1afw_A 393 3-ketoacetyl-COA thiolase; fatty acid metabolism; 99.06
1zow_A 313 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB 99.05
1hnj_A 317 Beta-ketoacyl-acyl carrier protein synthase III; F 99.02
1ub7_A 322 3-oxoacyl-[acyl-carrier protein] synthase; fatty a 98.99
1u6e_A 335 3-oxoacyl-[acyl-carrier-protein] synthase III; tra 98.97
3goa_A 387 3-ketoacyl-COA thiolase; metabolism, fatty acid, p 98.93
1u0m_A 382 Putative polyketide synthase; type III polyketide 98.92
1mzj_A 339 Beta-ketoacylsynthase III; beta-ketosynthase, arom 98.91
4e1l_A 395 Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, 98.9
2x3e_A 331 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, 98.87
3ss6_A 394 Acetyl-COA acetyltransferase; structural genomics, 98.86
4dd5_A 396 Acetyl-COA acetyltransferase; structural genomics, 98.85
3svk_A 407 Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, 98.78
4egv_A 520 Acetyl-COA acetyltransferase; NEW SUB-family, thio 98.77
2h84_A 374 Steely1; thiolase-fold, type III polyketide syntha 98.74
4dfe_A 333 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci 98.65
1ted_A 393 PKS18; thiolase fold, substrate binding tunnel, tr 98.55
2d3m_A 406 Pentaketide chromone synthase; chalcone synthase, 98.52
3led_A 392 3-oxoacyl-acyl carrier protein synthase III; struc 98.49
3a5r_A 387 Benzalacetone synthase; chalcone synthase, type II 98.49
3il3_A 323 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 98.48
1xpm_A 396 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA s 98.47
1xes_A 413 Dihydropinosylvin synthase; native structure, tran 98.47
3il6_A 321 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 98.46
1i88_A 389 CHS2, chalcone synthase 2; polyketide synthase, tr 98.45
4efi_A 354 3-oxoacyl-(acyl-carrier protein) synthase; structu 98.43
3awk_A 402 Chalcone synthase-like polyketide synthase; type I 98.42
3gwa_A 365 3-oxoacyl-(acyl-carrier-protein) synthase III; str 98.41
3h78_A 359 PQS biosynthetic enzyme; PQSD, anthranilic acid, a 98.41
2p0u_A 413 Stilbenecarboxylate synthase 2; polyketide synthas 98.4
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 98.38
1ee0_A 402 2-pyrone synthase; polyketide synthase, thiolase f 98.36
3s3l_A 357 CERJ; acyltransferase, FABH homologue, KS III homo 98.31
3oit_A 387 OS07G0271500 protein; type III polyketide synthase 98.24
3ov2_A 393 Curcumin synthase; type III polyketide synthase, t 98.23
3v4n_A 388 HMG-COA synthase; hydroxymethylglutaryl-COA syntha 98.15
2f82_A 450 HMG-COA synthase; HMGS1, transferase; 2.10A {Brass 98.15
3v7i_A 413 Putative polyketide synthase; type III polyketide 98.1
3sqz_A 425 Putative hydroxymethylglutaryl-COA synthase; thiol 98.02
3lma_A 347 Stage V sporulation protein AD (spovad); NESG, str 97.95
3euo_A 379 Type III pentaketide synthase; alpha helix, acyltr 97.93
4ewp_A 350 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans 97.89
3e1h_A 465 PKSIIINC, putative uncharacterized protein; resorc 97.73
2p8u_A 478 Hydroxymethylglutaryl-COA synthase, cytoplasmic; h 97.57
2v4w_A 460 Hydroxymethylglutaryl-COA synthase, mitochondrial; 97.45
2wya_A 460 Hydroxymethylglutaryl-COA synthase, mitochondrial; 94.9
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
Probab=99.93  E-value=6.1e-26  Score=188.22  Aligned_cols=99  Identities=41%  Similarity=0.669  Sum_probs=96.0

Q ss_pred             CCcccccCCCcchHHhHHHHHhCCCCCcceecccchHHHHHHHHHHHHHHcCCCCEEEEEecCCCCCHHHHHHHHHccCC
Q psy11966          1 MTQFVLVAPSTPRAAKSNSPIFALAGPCCTIDTACSSTLFGLHLAVGAIERGECDHAIIGGVNLTLKPATSLMYHKYNML   80 (99)
Q Consensus         1 ~~~~~~~~~~~~~~~~~ia~~~~l~Gp~~tv~~acaS~~~Ai~~A~~~i~~G~~d~~l~gg~~~~~~~~~~~~~~~~~~l   80 (99)
                      +++|.++++..+++++|||+.||++||+++|++||+||+.||++|+++|++|++|++||||++.+++|..+..|.+++.+
T Consensus       127 ~~~~~~~g~~~~~~a~ris~~~~l~Gps~tv~tACsSsl~Al~~A~~~l~~g~~d~al~gG~~~~~~p~~~~~~~~~~~l  206 (2512)
T 2vz8_A          127 LVGYSMIGCQRAMMANRLSFFFDFKGPSITIDTACSSSLLALQSAYQAIRGGECSAAVVGGLNVLLKPNSSLQFMKLGML  206 (2512)
T ss_dssp             SCGGGGGGTSTTHHHHHHHHHHTCCSCEEEEECTTSTHHHHHHHHHHHHHTSSCSEEEEEEEECCCCHHHHHHHHHTTCB
T ss_pred             cCcceecccchhHHHHHHHHHhCCCCCceeeccHhHHHHHHHHHHHHHHHcCCCCeeEEeEeccccCHHHHHHHccCCCC
Confidence            35788899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCcccCCCCCceeCC
Q psy11966         81 SPTGTISPFDASGVGHRQP   99 (99)
Q Consensus        81 s~~~~~~pfd~~~~G~v~g   99 (99)
                      |++++|||||+++|||++|
T Consensus       207 s~~g~c~~Fd~~adG~~~g  225 (2512)
T 2vz8_A          207 SQDGTCRSFDAEGTGYCRA  225 (2512)
T ss_dssp             CTTCSCCSSSTTCCCBCBB
T ss_pred             CCCCCCCCCCCCCCCccee
Confidence            9999999999999999986
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Back     alignment and structure
>2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ... Back     alignment and structure
>2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A Back     alignment and structure
>1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A Back     alignment and structure
>1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} Back     alignment and structure
>3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A* Back     alignment and structure
>2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Back     alignment and structure
>3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} Back     alignment and structure
>1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A Back     alignment and structure
>3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A Back     alignment and structure
>2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* Back     alignment and structure
>2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A Back     alignment and structure
>4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Back     alignment and structure
>1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Back     alignment and structure
>2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Back     alignment and structure
>2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Back     alignment and structure
>2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Back     alignment and structure
>1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A Back     alignment and structure
>2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A Back     alignment and structure
>1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A Back     alignment and structure
>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A Back     alignment and structure
>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* Back     alignment and structure
>1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A Back     alignment and structure
>3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Back     alignment and structure
>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Back     alignment and structure
>2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} Back     alignment and structure
>3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Back     alignment and structure
>4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Back     alignment and structure
>3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} Back     alignment and structure
>4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis} Back     alignment and structure
>2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} Back     alignment and structure
>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} Back     alignment and structure
>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A Back     alignment and structure
>3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} Back     alignment and structure
>3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A Back     alignment and structure
>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} Back     alignment and structure
>1xpm_A 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA synthase, HMGS, coenzyme A, thiolase fold, condensing enzyme; HET: HMG CAA; 1.60A {Staphylococcus aureus subsp} SCOP: c.95.1.2 c.95.1.2 PDB: 1xpl_A* 1xpk_A* 1tvz_A 1txt_A* Back     alignment and structure
>1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A Back     alignment and structure
>3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A* Back     alignment and structure
>4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} Back     alignment and structure
>3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A Back     alignment and structure
>3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* Back     alignment and structure
>3oit_A OS07G0271500 protein; type III polyketide synthases, transferase; 2.00A {Oryza sativa} PDB: 3ale_A Back     alignment and structure
>3ov2_A Curcumin synthase; type III polyketide synthase, transferase; 2.32A {Curcuma longa} PDB: 3ov3_A Back     alignment and structure
>3v4n_A HMG-COA synthase; hydroxymethylglutaryl-COA synthase, nitrosylation, transfera inhibitor complex; HET: BTB; 1.60A {Enterococcus faecalis} PDB: 3v4x_A* 1x9e_A 1ysl_B* 1ysl_A* 2hdb_A* Back     alignment and structure
>2f82_A HMG-COA synthase; HMGS1, transferase; 2.10A {Brassica juncea} PDB: 2f9a_A* 2fa0_A* 2fa3_A* Back     alignment and structure
>3v7i_A Putative polyketide synthase; type III polyketide synthase, acyltransferase, transferase,; 2.90A {Streptomyces coelicolor} Back     alignment and structure
>3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A Back     alignment and structure
>4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} Back     alignment and structure
>3e1h_A PKSIIINC, putative uncharacterized protein; resorcinolic lipid synthase, type III PKS, acyltransferase, transferase; 2.58A {Neurospora crassa} Back     alignment and structure
>2p8u_A Hydroxymethylglutaryl-COA synthase, cytoplasmic; hydromethylglutaryl COA, mevalonate pathway, structural GENO structural genomics consortium, SGC; HET: COA; 2.00A {Homo sapiens} Back     alignment and structure
>2wya_A Hydroxymethylglutaryl-COA synthase, mitochondrial; steroid biosynthesis, cholesterol biosynthesis, mitochondrion, phosphoprotein; HET: HMG; 1.70A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 99
d1j3na1249 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II { 3e-14
d1tqya1216 c.95.1.1 (A:3-218) Actinorhodin polyketide putativ 9e-11
d2ix4a1270 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II 7e-10
d2gfva1250 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II { 6e-09
d1ox0a1256 c.95.1.1 (A:-5-251) Beta-ketoacyl-ACP synthase II 1e-08
d1tqyb1208 c.95.1.1 (B:2-209) Actinorhodin polyketide putativ 2e-08
d1e5ma1250 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II { 5e-08
d2vbaa1253 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {E 3e-05
>d1j3na1 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Length = 249 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Thiolase-related
domain: Beta-ketoacyl-ACP synthase II
species: Thermus thermophilus [TaxId: 274]

 Score = 63.6 bits (154), Expect = 3e-14
 Identities = 22/79 (27%), Positives = 31/79 (39%), Gaps = 5/79 (6%)

Query: 22  FALAGPCCTIDTACSSTLFGLHLAVGAIERGECDHAIIGGVNLTLKPATSLMYHKYNMLS 81
           +   GP  T+ TAC++    L  A+  I+ GE D  + GG    + P     +     LS
Sbjct: 148 YGFTGPSSTVVTACATGADALGSALRMIQLGEADLVLAGGTEAAITPMAIGAFAVMRALS 207

Query: 82  -----PTGTISPFDASGVG 95
                P     PF  S  G
Sbjct: 208 TRNEEPEKASRPFTLSRDG 226
>d1tqya1 c.95.1.1 (A:3-218) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Length = 216 Back     information, alignment and structure
>d2ix4a1 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Length = 270 Back     information, alignment and structure
>d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Length = 250 Back     information, alignment and structure
>d1ox0a1 c.95.1.1 (A:-5-251) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} Length = 256 Back     information, alignment and structure
>d1tqyb1 c.95.1.1 (B:2-209) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Length = 208 Back     information, alignment and structure
>d1e5ma1 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Length = 250 Back     information, alignment and structure
>d2vbaa1 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Length = 253 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query99
d1ox0a1256 Beta-ketoacyl-ACP synthase II {Streptococcus pneum 99.95
d2ix4a1270 Beta-ketoacyl-ACP synthase II {Thale cress (Arabid 99.95
d2gfva1250 Beta-ketoacyl-ACP synthase II {Escherichia coli [T 99.95
d1j3na1249 Beta-ketoacyl-ACP synthase II {Thermus thermophilu 99.94
d1e5ma1250 Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ 99.94
d2vbaa1253 Beta-ketoacyl-ACP synthase I {Escherichia coli [Ta 99.93
d1tqyb1208 Actinorhodin polyketide putative beta-ketoacyl syn 99.85
d1tqya1216 Actinorhodin polyketide putative beta-ketoacyl syn 99.85
d1m3ka1 268 Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 98.89
d1ulqa1 273 Beta-ketoadipyl CoA thiolase {Thermus thermophilus 98.87
d1wdkc1 262 Fatty oxidation complex beta subunit (3-ketoacyl-C 98.87
d1afwa1 269 Thiolase {Baker's yeast (Saccharomyces cerevisiae) 98.85
d1hnja1174 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 97.92
d1ub7a1172 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 97.74
d1u6ea1184 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 97.71
d1mzja1181 Priming beta-ketosynthase from the r1128 polyketid 97.46
d1u0ma1200 Putative polyketide synthase SCO1206 {Streptomyces 97.39
d1xpma1166 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Stap 97.38
d1teda_ 372 Polyketide synthase PKS18 {Mycobacterium tuberculo 97.19
d1bi5a1235 Chalcone synthase {Alfalfa (Medicago sativa) [TaxI 96.78
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 89.26
>d2ix4a1 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Back     information, alignment and structure
>d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3na1 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e5ma1 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d2vbaa1 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tqyb1 c.95.1.1 (B:2-209) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1tqya1 c.95.1.1 (A:3-218) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Back     information, alignment and structure
>d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1afwa1 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hnja1 c.95.1.2 (A:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ub7a1 c.95.1.2 (A:2-173) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mzja1 c.95.1.2 (A:3-183) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Back     information, alignment and structure
>d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1xpma1 c.95.1.2 (A:2-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bi5a1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure