Psyllid ID: psy11975

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780------
MIQASPITIYVSQTPSTSSLSSNLYTSTSSGNVFTSSSIGQSNFTPSSSGSNVYTSNPSGTSSVYTTISSSATNSVYTISSTAPSSVYTSSPPDTTTLSPIEAGGAPSPCHSLEVPPSPLLPDDNHPSPTSTSVHLVSSSNTDWSDVNPDSDGFVTPKPSGVPPSSSTTTFVKRLFSPPTPGSSKDFVESSSSPPTHRSYGRSHHHSHHHRSHSHHHHQSQSKHHHSKPLSRTMFGPVSRLCLKVTSRTLSIQDKEEPNVLLSRTMLGPVSRLCLKVTSRTLSIQTMSLSSSTQLDLTGVFSALPTPFREDEEIDFEKFKFNVSKWEKVPLKGSDSDHSADSDDDSAVATTTKLLGLAEGDLVWGSVKGYPSWPGKLISPAPTQGRVWVKWFGMSNEPLSEVEPATLKSLSQGLEAHHRSRKKLQGLPVVAGQAHFAGAHPGPGVGQMMVSSVSFSHYFKAHSSTSMPIQKRKSLLRKFPLWPELEPSTSELKRSDRPMSVGPRSVRPSEREWQADLLKPQKHTTTRATIDLTQKAAKAGANAALILCPYYFQKKMTEDLIYEHFISVADNSPIPVIIYNNTFVTNIDISVDTLVKLAHHENIRGVKDTDNIKLANMANQTKDLNFSVFAGSAGYLLSGLLVGCAGGINALSAVLGGPICELYDLAKAGKWEEAMKLQHRLVKPDVTVRNVLLMKEMGVPGVRAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVLTEAGFLVPGVRAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVLTEAGFL
ccccccEEEEEEccccccccccccccccccccEEEcccccccccccccccccccccccccccEEEEEEEccccccEEEEEccccccEEccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccEEEHHcccccHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHccccccEEEEEccccccccccccccccccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEcccccccccccccHHHHHccccccccccccccccccccccccccEEEEEEEEcccccccccEEEcccccccHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHccccccEEEEEccccccccccHHHHHHHHccccEEEEEccccHHHHHHHHHHcccccEEEEccHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHcccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHcccc
ccccccEEEEEEccccccccccccEEcccccccEEcccccccccccccccccEEEcccccccEEEEEEEccccccEEEEEccccccEEccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccHHHHHHHcccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccEEEccccccccEEEEHHccccccHEEEEEccccEEEEEEEcccccccccccccccccccccccccEccEEEEEEEccEEEccccccccccccccccccHHHHHHHHHHcccccEEEEcccccccccccEEcccccccEEEEEEccccccccccccHHHHHHHHHcHHHHHHHHHHHccccccccEHccccccccccccEEEEEEEEEEEEEEcccccccccccccHHHHHccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHccccEEEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEcccccEEcccHHHHHHHHccccEEEEEccccHHHHHHHHHHccccEEEEEcccHcHHHHHHHccccEEEEEHcHcHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHcccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHccccccccccccHccccccHHHHHHHHHHcccc
miqaspitiyvsqtpstsslssnlytstssgnvftsssigqsnftpsssgsnvytsnpsgtsSVYTTIsssatnsvytisstapssvytssppdtttlspieaggapspchslevppspllpddnhpsptstsvhlvsssntdwsdvnpdsdgfvtpkpsgvppssstttfvkrlfspptpgsskdfvessssppthrsygrshhhshhhrshshhhhqsqskhhhskplsrtmfgpvsrLCLKVTSrtlsiqdkeepnvllsrtmlgpvsrLCLKVTSRTLSIQTmslssstqldltgvfsalptpfredeeidfekfkfnvskwekvplkgsdsdhsadsdddsaVATTTKLLGLaegdlvwgsvkgypswpgklispaptqgrvwvkwfgmsneplsevepATLKSLSQGLEAHHRSrkklqglpvvagqahfagahpgpgvgqMMVSSVSFSHyfkahsstsmpiqKRKSLlrkfplwpelepstselkrsdrpmsvgprsvrpserEWQADllkpqkhtttrATIDLTQKAAKAGANAALILCPYYFQKKMTEDLIYEHFisvadnspipviiynntfvtnidISVDTLVKLAhhenirgvkdtdniKLANMANQTKDLNFSVFAGSAGYLLSGLLVGCAGGINALSAVLGGPICELYDLAKAGKWEEAMKLQHRLVKPDVTVRNVLLMKEMGVPGVRAAMELYGyyggrsrrplpaalkpggaEKIKQVLTEAGFLVPGVRAAMELYGyyggrsrrplpaalkpggaEKIKQVLTEAGFL
miqaspitiyvsqtpstsslSSNLYTSTSSGNVFTSSSIGQSNFTPSSSGSNVYTSNPSGTSSVYTTISSSATNSVYTISSTAPSSVYTSSPPDTTTLSPIEAGGAPSPCHSLEVPPSPLLPDDNHPSPTSTSVHLVSSSNTDWSDVNPDSDGFVtpkpsgvppsssttTFVKRLFspptpgsskdfvESSSSPPTHRSYGRSHHHSHHHRSHSHHHHQSQSKHHHSKPLSRTMFGPVSRLCLKVTsrtlsiqdkeepnvllsrtmlgpvSRLCLKVTSRTLSIQTMslssstqldltGVFSALPTPFREDEEIDFEKFkfnvskwekvplkgsdsdhsadsdddsAVATTTKLLGLAEGDLVWGSVKGYPSWPGKLISPAPTQGRVWVKWFGMSNEPLSEVEPATLKSLSQGLEAHHRSRKKLQGLPVVAGQAHFAGAHPGPGVGQMMVSSVSFSHYFKAhsstsmpiqkRKSLLRKFplwpelepstselkrsdrpmsvgprsvrpserewqadllkpqkhtttraTIDLTQKAAKAGANAALILCPYYFQKKMTEDLIYEHFISVADNSPIPVIIYNNTFVTNIDISVDTLVKLAHHenirgvkdtdnIKLANMANQTKDLNFSVFAGSAGYLLSGLLVGCAGGINALSAVLGGPICELYDLAKAGKWEEAMKlqhrlvkpdvtvRNVLLMkemgvpgvRAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVLTeagflvpgVRAAMELYGYYGGRSRRPLPAalkpggaekiKQVLTEAGFL
MIQASPITIYVsqtpstsslssnlytstssgnvftsssIGQSNFTPSSSGSNVYTSNPSGTSSVYTTISSSATNSVYTIsstapssvytssppdtttlspIEAGGAPSPCHSLEVPPSPLLPDDNHPSPTSTSVHLVSSSNTDWSDVNPDSDGFVtpkpsgvppssstttFVKRLFSPPTPGSSKDFVESSSSPPTHRSYGrshhhshhhrshshhhhqsqskhhhskPLSRTMFGPVSRLCLKVTSRTLSIQDKEEPNVLLSRTMLGPVSRLCLKVTSRTLSIQTMSLSSSTQLDLTGVFSALPTPfredeeidfekfkfNVSKWEKVPLKGsdsdhsadsdddsaVATTTKLLGLAEGDLVWGSVKGYPSWPGKLISPAPTQGRVWVKWFGMSNEPLSEVEPATLKSLSQGLEAHHRSRKKLQGLPVVAGQAHFAGAHPGPGVGQMMVSSVSFSHYFKAHSSTSMPIQKRKSLLRKFPLWPELEPSTSELKRSDRPMSVGPRSVRPSEREWQADLLKPQKHTTTRATIDLTQkaakaganaaLILCPYYFQKKMTEDLIYEHFISVADNSPIPVIIYNNTFVTNIDISVDTLVKLAHHENIRGVKDTDNIKLANMANQTKDLNFSVFagsagyllsgllvgCAGGINALSAVLGGPICELYDLAKAGKWEEAMKLQHRLVKPDVTVRNVLLMKEMGVPGVRAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVLTEAGFLVPGVRAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVLTEAGFL
******************************************************************************************************************************************************************************************************************************************FGPVSRLCLKVTSRTLSIQ****PNVLLSRTMLGPVSRLCLKVTSRTLSIQTMSLS*STQLDLTGVFSALPTPFREDEEIDFEKFKFNVSKWE*********************ATTTKLLGLAEGDLVWGSVKGYPSWPGKLISPAPTQGRVWVKWFGM*********************************PVVAGQAHFAG*********MMVSSVSFSHYF*********************************************************************TIDLTQKAAKAGANAALILCPYYFQKKMTEDLIYEHFISVADNSPIPVIIYNNTFVTNIDISVDTLVKLAHHENIRGVKDTDNIKLANMANQTKDLNFSVFAGSAGYLLSGLLVGCAGGINALSAVLGGPICELYDLAKAGKWEEAMKLQHRLVKPDVTVRNVLLMKEMGVPGVRAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVLTEAGFLVPGVRAAMELYGYYGGR***************************
****SPI*IYVSQTPS********YTSTSSGNVFTS**********************SGTSSVYTTISSSATNSVYTISSTAPS****SSP***TTLSPIEAGGAPSPCHSLEVPPSPLLPD*NHPSPTSTSVHLVSSSNTDWSDVNPDSDGFVTPKP******SSTTTFVKRLFSP******************************************************TMFGPVSRLCLKVTSRTLSIQDKEEPNVLLSRTMLGPVSRLCL**********************TGVFSALPTPFREDEEIDFEKFKFNVSKWEKVPLKGSDSDHSADSDDDSAVATTTKLLGLAEGDLVWGSVKGYPSWPGKLISPAPTQGRVWVKWFGMSN*********************************VAGQAHFAGAHPGPGVGQMMVSSVSFSHYFKAHSS**M**QKRKSLLRKFPLWPELEPSTSELKRSDRPMSVGPRSVRPSEREWQADLLKPQKHTTTRATIDLTQKAAKAGANAALILCPYYFQKKMTEDLIYEHFISVADNSPIPVIIYNNTFVTNIDISVDTLVKLAHHENIRGVKDTDNIKLANMANQTKDLNFSVFAGSAGYLLSGLLVGCAGGINALSAVLGGPICELYDLAKAGKWEEAMKLQHRLVKPDVTVRNVLLMKEMGVPGVRAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVLTEAGFLVPGVRAAM*****************LKPGGAEKIKQVLTEAGFL
MIQASPITIYVS****************SSGNVFTSSSIG**********************SVYTTISSSATNSVYTIS**************TTTLSPIEAGGAPSPCHSLEVPPSPLLPDDN*****************DWSDVNPDSDGFVTP***********TTFVKRLFSPP***************************************************SRTMFGPVSRLCLKVTSRTLSIQDKEEPNVLLSRTMLGPVSRLCLKVTSRTLSIQTMSLSSSTQLDLTGVFSALPTPFREDEEIDFEKFKFNVSKWEKVPL****************VATTTKLLGLAEGDLVWGSVKGYPSWPGKLISPAPTQGRVWVKWFGMSNEPLSEVEPATLKSLSQGLEAHHRSRKKLQGLPVVAGQAHFAGAHPGPGVGQMMVSSVSFSHYFKAHSSTSMPIQKRKSLLRKFPLWPELE*************************EWQADLLKPQKHTTTRATIDLTQKAAKAGANAALILCPYYFQKKMTEDLIYEHFISVADNSPIPVIIYNNTFVTNIDISVDTLVKLAHHENIRGVKDTDNIKLANMANQTKDLNFSVFAGSAGYLLSGLLVGCAGGINALSAVLGGPICELYDLAKAGKWEEAMKLQHRLVKPDVTVRNVLLMKEMGVPGVRAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVLTEAGFLVPGVRAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVLTEAGFL
*I*ASPITIYVSQT****SL**************************************SGTSSVYTTISSSATNSVYTIS*TAP*********************A*SPCHSLEVPPSPLLP******PTSTS********TDW*DVNPDSDGFVTPKP**************R************************************************************FGPVSRLCLKVTSRTLSIQDKEEPNVLLSRTMLGPVSRLCLKVTSRTLSIQTMSLSSSTQLDLTGVFSALPTPFREDEEIDFEKFKFNVSKWEKVPL*************DSAVATTTKLLGLAEGDLVWGSVKGYPSWPGKLISPAPTQGRVWVKWFGMSNEPLSEVEPAT*****QGLEAHHRSRKKLQGLPVVAGQAHFAGAHPGPGVGQMMVSSVSFSHYFKAHSSTSMPIQKRKSLLRKFPLWPELE****ELKRSDRPMSVGPRSVRPSEREWQADLLKPQKHTTTRATIDLTQKAAKAGANAALILCPYYFQKKMTEDLIYEHFISVADNSPIPVIIYNNTFVTNIDISVDTLVKLAHHENIRGVKDTDNIKLANMANQTKDLNFSVFAGSAGYLLSGLLVGCAGGINALSAVLGGPICELYDLAKAGKWEEAMKLQHRLVKPDVTVRNVLLMKEMGVPGVRAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVLTEAGFLVPGVRAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVLTEAGFL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIQASPITIYVSQTPSTSSLSSNLYTSTSSGNVFTSSSIGQSNFTPSSSGSNVYTSNPSGTSSVYTTISSSATNSVYTISSTAPSSVYTSSPPDTTTLSPIEAGGAPSPCHSLEVPPSPLLPDDNHPSPTSTSVHLVSSSNTDWSDVNPDSDGFVTPKPSGVPPSSSTTTFVKRLFSPPTPGSSKDFVESSSSPPTHRSYGRSHHHSHHHRSHSHHHHQSQSKHHHSKPLSRTMFGPVSRLCLKVTSRTLSIQDKEEPNVLLSRTMLGPVSRLCLKVTSRTLSIQTMSLSSSTQLDLTGVFSALPTPFREDEEIDFEKFKFNVSKWEKVPLKGSDSDHSADSDDDSAVATTTKLLGLAEGDLVWGSVKGYPSWPGKLISPAPTQGRVWVKWFGMSNEPLSEVEPATLKSLSQGLEAHHRSRKKLQGLPVVAGQAHFAGAHPGPGVGQMMVSSVSFSHYFKAHSSTSMPIQKRKSLLRKFPLWPELEPSTSELKRSDRPMSVGPRSVRPSEREWQADLLKPQKHTTTRATIDLTQKAAKAGANAALILCPYYFQKKMTEDLIYEHFISVADNSPIPVIIYNNTFVTNIDISVDTLVKLAHHENIRGVKDTDNIKLANMANQTKDLNFSVFAGSAGYLLSGLLVGCAGGINALSAVLGGPICELYDLAKAGKWEEAMKLQHRLVKPDVTVRNVLLMKEMGVPGVRAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVLTEAGFLVPGVRAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVLTEAGFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query786 2.2.26 [Sep-21-2011]
Q5M8W9328 Probable 4-hydroxy-2-oxog yes N/A 0.269 0.646 0.4 2e-43
Q5XGL6326 Probable 4-hydroxy-2-oxog N/A N/A 0.269 0.650 0.395 2e-43
Q86XE5327 Probable 4-hydroxy-2-oxog yes N/A 0.279 0.672 0.381 4e-43
Q0P5I5327 Probable 4-hydroxy-2-oxog yes N/A 0.279 0.672 0.377 4e-43
Q6NY77324 Probable 4-hydroxy-2-oxog yes N/A 0.243 0.589 0.393 2e-40
Q9DCU9321 Probable 4-hydroxy-2-oxog yes N/A 0.269 0.660 0.377 3e-40
Q8EQJ1295 4-hydroxy-tetrahydrodipic yes N/A 0.231 0.616 0.321 4e-20
B9DS79309 4-hydroxy-tetrahydrodipic yes N/A 0.263 0.669 0.330 5e-20
Q2JQ67306 4-hydroxy-tetrahydrodipic yes N/A 0.264 0.679 0.303 9e-19
P0CL20314 Putative 4-hydroxy-2-oxog N/A N/A 0.198 0.496 0.381 1e-18
>sp|Q5M8W9|HOGA1_XENTR Probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Xenopus tropicalis GN=hoga1 PE=2 SV=2 Back     alignment and function desciption
 Score =  177 bits (450), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 88/220 (40%), Positives = 145/220 (65%), Gaps = 8/220 (3%)

Query: 525 TTRATIDLTQKAAKAGANAALILCPYYFQKKMTEDLIYEHFISVADNSPIPVIIYNNTFV 584
           +T+ATI++T + A++GA+A L++ P Y++ KMT   +  H+  VAD+SP+PV++Y+    
Sbjct: 113 STQATIEMTVEMAQSGADAVLVVTPSYYRGKMTSSALVHHYTKVADHSPVPVVLYSVPAN 172

Query: 585 TNIDISVDTLVKLAHHENIRGVKDT--DNIKLANMANQTKDLNFSVFAGSAGYLLSGLLV 642
           T +D+ VD +V L+ H NI G+KD+  D  ++  + ++TK L F V +GSAG+LL+G  V
Sbjct: 173 TGLDLPVDAVVTLSQHPNIIGLKDSGGDITRIGLIIHKTKHLGFQVLSGSAGFLLAGYSV 232

Query: 643 GCAGGINALSAVLGGPICELYDLAKAGKWEEAMKLQHRLVKPDVTVRNVLLMKEMGVPGV 702
           G  GG+ AL+ VLG  +CEL  L   G+W+EA +LQ+RL++P+  V      ++ G+PG+
Sbjct: 233 GAVGGVCALANVLGAQVCELERLCLNGRWQEAKELQYRLIEPNTAV-----TRKFGIPGL 287

Query: 703 RAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVLTEAGFL 742
           + AME +G+ GG+ R PL   L     ++++ + T  G+L
Sbjct: 288 KQAMEWFGFNGGKCRSPL-LPLTEQEIKELRHIFTVNGWL 326
Catalyzes the final step in the metabolic pathway of hydroxyproline.
Xenopus tropicalis (taxid: 8364)
EC: 4EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6
>sp|Q5XGL6|HOGA1_XENLA Probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Xenopus laevis GN=hoga1 PE=2 SV=1 Back     alignment and function description
>sp|Q86XE5|HOGA1_HUMAN Probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Homo sapiens GN=HOGA1 PE=1 SV=1 Back     alignment and function description
>sp|Q0P5I5|HOGA1_BOVIN Probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Bos taurus GN=HOGA1 PE=1 SV=1 Back     alignment and function description
>sp|Q6NY77|HOGA1_DANRE Probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Danio rerio GN=zgc:77082 PE=2 SV=1 Back     alignment and function description
>sp|Q9DCU9|HOGA1_MOUSE Probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Mus musculus GN=Hoga1 PE=1 SV=1 Back     alignment and function description
>sp|Q8EQJ1|DAPA_OCEIH 4-hydroxy-tetrahydrodipicolinate synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=dapA PE=3 SV=1 Back     alignment and function description
>sp|B9DS79|DAPA_STRU0 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=dapA PE=3 SV=1 Back     alignment and function description
>sp|Q2JQ67|DAPA_SYNJB 4-hydroxy-tetrahydrodipicolinate synthase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=dapA PE=3 SV=1 Back     alignment and function description
>sp|P0CL20|HOGA1_COCIM Putative 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Coccidioides immitis (strain RS) GN=CIMG_00151 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query786
328720437319 PREDICTED: probable 4-hydroxy-2-oxogluta 0.265 0.655 0.515 4e-57
363735292326 PREDICTED: probable 4-hydroxy-2-oxogluta 0.279 0.674 0.403 4e-45
449277165295 Dihydrodipicolinate synthase-like, mitoc 0.279 0.745 0.412 6e-45
224052669333 PREDICTED: probable 4-hydroxy-2-oxogluta 0.279 0.660 0.407 1e-44
443691842339 hypothetical protein CAPTEDRAFT_21733 [C 0.268 0.622 0.442 9e-44
326923836326 PREDICTED: probable 4-hydroxy-2-oxogluta 0.279 0.674 0.394 6e-43
431838934370 Dihydrodipicolinate synthase-like, mitoc 0.269 0.572 0.404 9e-43
301763210327 PREDICTED: dihydrodipicolinate synthase- 0.279 0.672 0.390 2e-42
291404579327 PREDICTED: DHDPS-like protein [Oryctolag 0.291 0.700 0.390 5e-42
73998495348 PREDICTED: probable 4-hydroxy-2-oxogluta 0.279 0.632 0.390 6e-42
>gi|328720437|ref|XP_003247030.1| PREDICTED: probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  229 bits (584), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 114/221 (51%), Positives = 157/221 (71%), Gaps = 12/221 (5%)

Query: 525 TTRATIDLTQKAAKAGANAALILCPYYFQKKMTEDLIYEHFISVADNSPIPVIIYNNTFV 584
           +T+ T DL++ AA+ GA+  L++ P+YF+ +MTE+ +YEHF+SVAD+ P PVI+YN   V
Sbjct: 108 STKMTCDLSKAAAEVGADGVLVMSPFYFKTRMTEESLYEHFVSVADSCPAPVIVYNMVPV 167

Query: 585 TNIDISVDTLVKLAHHENIRGVKDTDNIKLANMANQTKDLNFSVFAGSAGYLLSGLLVGC 644
           T ID+SV+ L K++ H NI GVKD D  KLA +  +T+D  F + AGSA YLL+ +LVGC
Sbjct: 168 TGIDLSVEILKKMSLHPNIVGVKDKDMGKLAALVTETRDQRFQIVAGSASYLLAAMLVGC 227

Query: 645 AGGINALSAVLGGPICELYDLAKAGKWEEAMKLQHRLVKPDVTVRNVLLMKEMGVPGVRA 704
           +GGIN L+AVLG P+C++++LA AG+W+EA++LQ +LV  D     +LLM+E G  G++A
Sbjct: 228 SGGINGLAAVLGEPLCKMHELAAAGRWQEALELQRKLVNID-----LLLMQECGPAGLKA 282

Query: 705 AMELYGYYGGRSRRPLPAALKPGGAE---KIKQVLTEAGFL 742
           AMEL GY GG  R PLP    P  AE   KIK  L + GFL
Sbjct: 283 AMELLGYRGGLCRSPLP----PITAEKVAKIKLTLEKDGFL 319

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|363735292|ref|XP_001233352.2| PREDICTED: probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial [Gallus gallus] Back     alignment and taxonomy information
>gi|449277165|gb|EMC85441.1| Dihydrodipicolinate synthase-like, mitochondrial, partial [Columba livia] Back     alignment and taxonomy information
>gi|224052669|ref|XP_002192221.1| PREDICTED: probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|443691842|gb|ELT93592.1| hypothetical protein CAPTEDRAFT_21733 [Capitella teleta] Back     alignment and taxonomy information
>gi|326923836|ref|XP_003208139.1| PREDICTED: probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial-like [Meleagris gallopavo] Back     alignment and taxonomy information
>gi|431838934|gb|ELK00863.1| Dihydrodipicolinate synthase-like, mitochondrial [Pteropus alecto] Back     alignment and taxonomy information
>gi|301763210|ref|XP_002917023.1| PREDICTED: dihydrodipicolinate synthase-like, mitochondrial-like [Ailuropoda melanoleuca] gi|281348500|gb|EFB24084.1| hypothetical protein PANDA_005187 [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|291404579|ref|XP_002718623.1| PREDICTED: DHDPS-like protein [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|73998495|ref|XP_850958.1| PREDICTED: probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial [Canis lupus familiaris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query786
UNIPROTKB|Q86XE5327 HOGA1 "Probable 4-hydroxy-2-ox 0.269 0.648 0.331 6.1e-36
UNIPROTKB|Q0P5I5327 HOGA1 "Probable 4-hydroxy-2-ox 0.269 0.648 0.322 1.3e-35
UNIPROTKB|F1PVY8319 HOGA1 "Uncharacterized protein 0.269 0.664 0.331 1.9e-35
ZFIN|ZDB-GENE-040426-2242324 hoga1 "4-hydroxy-2-oxoglutarat 0.269 0.654 0.318 4.6e-34
MGI|MGI:1914682321 Hoga1 "4-hydroxy-2-oxoglutarat 0.269 0.660 0.318 2e-32
UNIPROTKB|F1S8X9326 HOGA1 "Uncharacterized protein 0.269 0.650 0.331 4e-32
RGD|1310475321 Hoga1 "4-hydroxy-2-oxoglutarat 0.269 0.660 0.313 3.6e-31
UNIPROTKB|E1C1D7279 HOGA1 "Uncharacterized protein 0.208 0.587 0.337 3.6e-28
UNIPROTKB|J9P6C5204 HOGA1 "Uncharacterized protein 0.231 0.892 0.315 1.8e-25
TIGR_CMR|BA_3935292 BA_3935 "dihydrodipicolinate s 0.237 0.640 0.304 9e-19
UNIPROTKB|Q86XE5 HOGA1 "Probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 364 (133.2 bits), Expect = 6.1e-36, Sum P(2) = 6.1e-36
 Identities = 73/220 (33%), Positives = 121/220 (55%)

Query:   525 TTRATIDLTQXXXXXXXXXXLILCPYYFQKKMTEDLIYEHFISVADNSPIPVIIYNNTFV 584
             +T+AT+++T           +++ P Y++ +M+   +  H+  VAD SPIPV++Y+    
Sbjct:   114 STQATVEMTVSMAQVGADAAMVVTPCYYRGRMSSAALIHHYTKVADLSPIPVVLYSVPAN 173

Query:   585 TNIDISVDTLVKLAHHENIRGVKDT--DNIKLANMANQTKDLNFSVFXXXXXXXXXXXXX 642
             T +D+ VD +V L+ H NI G+KD+  D  ++  + ++T+  +F V              
Sbjct:   174 TGLDLPVDAVVTLSQHPNIVGMKDSGGDVTRIGLIVHKTRKQDFQVLAGSAGFLMASYAL 233

Query:   643 XCAGGINALSAVLGGPICELYDLAKAGKWEEAMKLQHRLVKPDVTVRNVLLMKEMGVPGV 702
                GG+ AL+ VLG  +C+L  L   G+WE+A KLQHRL++P     N  + +  G+PG+
Sbjct:   234 GAVGGVCALANVLGAQVCQLERLCCTGQWEDAQKLQHRLIEP-----NAAVTRRFGIPGL 288

Query:   703 RAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVLTEAGFL 742
             +  M+ +GYYGG  R PL   L P   E ++   T  G+L
Sbjct:   289 KKIMDWFGYYGGPCRAPLQE-LSPAEEEALRMDFTSNGWL 327
GO:0008700 "4-hydroxy-2-oxoglutarate aldolase activity" evidence=ISS;IDA
GO:0009436 "glyoxylate catabolic process" evidence=IMP
GO:0019470 "4-hydroxyproline catabolic process" evidence=IDA
GO:0042866 "pyruvate biosynthetic process" evidence=IDA
GO:0046487 "glyoxylate metabolic process" evidence=IDA
GO:0042803 "protein homodimerization activity" evidence=IDA
GO:0005739 "mitochondrion" evidence=ISS
GO:0033609 "oxalate metabolic process" evidence=IMP
UNIPROTKB|Q0P5I5 HOGA1 "Probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PVY8 HOGA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2242 hoga1 "4-hydroxy-2-oxoglutarate aldolase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1914682 Hoga1 "4-hydroxy-2-oxoglutarate aldolase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1S8X9 HOGA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1310475 Hoga1 "4-hydroxy-2-oxoglutarate aldolase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C1D7 HOGA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9P6C5 HOGA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
TIGR_CMR|BA_3935 BA_3935 "dihydrodipicolinate synthase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.2.1LOW CONFIDENCE prediction!
4th Layer4.2.1.52LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query786
cd00408281 cd00408, DHDPS-like, Dihydrodipicolinate synthase 1e-58
COG0329299 COG0329, DapA, Dihydrodipicolinate synthase/N-acet 6e-47
PRK03170292 PRK03170, PRK03170, dihydrodipicolinate synthase; 3e-40
cd00950284 cd00950, DHDPS, Dihydrodipicolinate synthase (DHDP 6e-39
pfam00701289 pfam00701, DHDPS, Dihydrodipicolinate synthetase f 5e-31
TIGR00674285 TIGR00674, dapA, dihydrodipicolinate synthase 3e-25
cd00954288 cd00954, NAL, N-Acetylneuraminic acid aldolase, al 6e-19
PRK04147293 PRK04147, PRK04147, N-acetylneuraminate lyase; Pro 9e-19
TIGR02313294 TIGR02313, HpaI-NOT-DapA, 2,4-dihydroxyhept-2-ene- 9e-16
cd0583587 cd05835, Dnmt3b_related, The PWWP domain is an ess 5e-15
cd00953279 cd00953, KDG_aldolase, KDG (2-keto-3-deoxygluconat 2e-11
TIGR00683290 TIGR00683, nanA, N-acetylneuraminate lyase 9e-11
PLN02417280 PLN02417, PLN02417, dihydrodipicolinate synthase 1e-10
cd00951289 cd00951, KDGDH, 5-dehydro-4-deoxyglucarate dehydra 4e-09
pfam0085574 pfam00855, PWWP, PWWP domain 8e-09
cd0583686 cd05836, N_Pac_NP60, The PWWP domain is an essenti 1e-06
cd0516287 cd05162, PWWP, The PWWP domain, named for a conser 2e-06
PRK03620303 PRK03620, PRK03620, 5-dehydro-4-deoxyglucarate deh 2e-06
cd0583483 cd05834, HDGF_related, The PWWP domain is an essen 7e-06
smart0029363 smart00293, PWWP, domain with conserved PWWP motif 8e-06
COG5422 1175 COG5422, ROM1, RhoGEF, Guanine nucleotide exchange 2e-05
TIGR03249296 TIGR03249, KdgD, 5-dehydro-4-deoxyglucarate dehydr 6e-04
cd0608080 cd06080, MUM1_like, Mutated melanoma-associated an 0.001
COG0329299 COG0329, DapA, Dihydrodipicolinate synthase/N-acet 0.002
cd05837110 cd05837, MSH6_like, The PWWP domain is present in 0.003
>gnl|CDD|188630 cd00408, DHDPS-like, Dihydrodipicolinate synthase family Back     alignment and domain information 
 Score =  200 bits (511), Expect = 1e-58
 Identities = 76/216 (35%), Positives = 112/216 (51%), Gaps = 11/216 (5%)

Query: 523 HTTTRATIDLTQKAAKAGANAALILCPYYFQKKMTEDLIYEHFISVADNSPIPVIIYNNT 582
             +TR  I+L + A +AGA+  L++ PYY   K +++ I  HF +VAD S +PVI+YN  
Sbjct: 75  ANSTREAIELARHAEEAGADGVLVVPPYYN--KPSQEGIVAHFKAVADASDLPVILYNIP 132

Query: 583 FVTNIDISVDTLVKLAHHENIRGVKDT--DNIKLANMANQTKDLNFSVFAGSAGYLLSGL 640
             T +D+S +T+ +LA H NI G+KD+  D  +L  +       +F+V +G    LL  L
Sbjct: 133 GRTGVDLSPETIARLAEHPNIVGIKDSSGDLDRLTRLIALLGP-DFAVLSGDDDLLLPAL 191

Query: 641 LVGCAGGINALSAVLGGPICELYDLAKAGKWEEAMKLQHRLVKPDVTVRNVLLMKEMGVP 700
            +G  G I+  + V       LY+ A+AG  EEA  LQ RL+          L KE    
Sbjct: 192 ALGADGAISGAANVAPKLAVALYEAARAGDLEEARALQDRLLPLI-----EALFKEGNPA 246

Query: 701 GVRAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVL 736
            V+AA+ L G   G  R PL   L      K++ +L
Sbjct: 247 PVKAALALLGLDAGPVRLPLV-PLSEEERAKLEALL 281

Dihydrodipicolinate synthase family. A member of the class I aldolases, which use an active-site lysine which stabilizes a reaction intermediate via Schiff base formation, and have TIM beta/alpha barrel fold. The dihydrodipicolinate synthase family comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways and includes such proteins as N-acetylneuraminate lyase, MosA protein, 5-keto-4-deoxy-glucarate dehydratase, trans-o-hydroxybenzylidenepyruvate hydratase-aldolase, trans-2'-carboxybenzalpyruvate hydratase-aldolase, and 2-keto-3-deoxy- gluconate aldolase. The family is also referred to as the N-acetylneuraminate lyase (NAL) family. Length = 281
>gnl|CDD|223406 COG0329, DapA, Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|235107 PRK03170, PRK03170, dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>gnl|CDD|188637 cd00950, DHDPS, Dihydrodipicolinate synthase (DHDPS) Back     alignment and domain information
>gnl|CDD|201403 pfam00701, DHDPS, Dihydrodipicolinate synthetase family Back     alignment and domain information
>gnl|CDD|129757 TIGR00674, dapA, dihydrodipicolinate synthase Back     alignment and domain information
>gnl|CDD|188641 cd00954, NAL, N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL) Back     alignment and domain information
>gnl|CDD|179749 PRK04147, PRK04147, N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>gnl|CDD|131366 TIGR02313, HpaI-NOT-DapA, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>gnl|CDD|99896 cd05835, Dnmt3b_related, The PWWP domain is an essential component of DNA methyltransferase 3 B (Dnmt3b) which is responsible for establishing DNA methylation patterns during embryogenesis and gametogenesis Back     alignment and domain information
>gnl|CDD|188640 cd00953, KDG_aldolase, KDG (2-keto-3-deoxygluconate) aldolases found in archaea Back     alignment and domain information
>gnl|CDD|188072 TIGR00683, nanA, N-acetylneuraminate lyase Back     alignment and domain information
>gnl|CDD|178038 PLN02417, PLN02417, dihydrodipicolinate synthase Back     alignment and domain information
>gnl|CDD|188638 cd00951, KDGDH, 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH) Back     alignment and domain information
>gnl|CDD|216154 pfam00855, PWWP, PWWP domain Back     alignment and domain information
>gnl|CDD|99897 cd05836, N_Pac_NP60, The PWWP domain is an essential part of the cytokine-like nuclear factor n-pac protein, or NP60, which enhances the activity of MAP2K4 and MAP2K6 kinases to phosphorylate p38-alpha Back     alignment and domain information
>gnl|CDD|99894 cd05162, PWWP, The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids Back     alignment and domain information
>gnl|CDD|235141 PRK03620, PRK03620, 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|99895 cd05834, HDGF_related, The PWWP domain is an essential part of the Hepatoma Derived Growth Factor (HDGF) family of proteins, and is necessary for DNA binding by HDGF Back     alignment and domain information
>gnl|CDD|214603 smart00293, PWWP, domain with conserved PWWP motif Back     alignment and domain information
>gnl|CDD|227709 COG5422, ROM1, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|132293 TIGR03249, KdgD, 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>gnl|CDD|99903 cd06080, MUM1_like, Mutated melanoma-associated antigen 1 (MUM-1) is a melanoma-associated antigen (MAA) Back     alignment and domain information
>gnl|CDD|223406 COG0329, DapA, Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|99898 cd05837, MSH6_like, The PWWP domain is present in MSH6, a mismatch repair protein homologous to bacterial MutS Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 786
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 100.0
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 100.0
TIGR00674285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 100.0
PRK04147293 N-acetylneuraminate lyase; Provisional 100.0
PF00701289 DHDPS: Dihydrodipicolinate synthetase family; Inte 100.0
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 100.0
PRK03170292 dihydrodipicolinate synthase; Provisional 100.0
TIGR00683290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 100.0
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 100.0
cd00950284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 100.0
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 100.0
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 100.0
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 100.0
PLN02417280 dihydrodipicolinate synthase 100.0
PRK03620303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 100.0
cd00953279 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolas 100.0
cd0583587 Dnmt3b_related The PWWP domain is an essential com 99.74
cd0583483 HDGF_related The PWWP domain is an essential part 99.72
cd0583686 N_Pac_NP60 The PWWP domain is an essential part of 99.71
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 99.71
smart0029363 PWWP domain with conserved PWWP motif. conservatio 99.63
cd0584093 SPBC215_ISWI_like The PWWP domain is a component o 99.62
cd0608080 MUM1_like Mutated melanoma-associated antigen 1 (M 99.61
PF0085586 PWWP: PWWP domain; InterPro: IPR000313 Upon charac 99.61
cd05837110 MSH6_like The PWWP domain is present in MSH6, a mi 99.6
cd0516287 PWWP The PWWP domain, named for a conserved Pro-Tr 99.59
cd0584183 BS69_related The PWWP domain is part of BS69 prote 99.58
cd0583895 WHSC1_related The PWWP domain was first identified 99.57
cd05839111 BR140_related The PWWP domain is found in the BR14 99.37
cd08205367 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase l 99.24
KOG1904|consensus496 99.07
cd08210364 RLP_RrRLP Ribulose bisphosphate carboxylase like p 98.93
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 98.42
PF06187382 DUF993: Protein of unknown function (DUF993); Inte 97.48
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 97.47
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 97.35
KOG1081|consensus463 96.95
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 96.01
PRK08227264 autoinducer 2 aldolase; Validated 95.9
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 95.8
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 95.64
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 95.57
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 95.26
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 95.14
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 95.09
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 95.09
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 94.94
PRK07226267 fructose-bisphosphate aldolase; Provisional 94.93
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 94.72
PRK09250348 fructose-bisphosphate aldolase; Provisional 94.11
TIGR03326412 rubisco_III ribulose bisphosphate carboxylase, typ 94.05
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 93.39
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 93.31
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 93.27
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 92.79
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 92.77
PRK06852304 aldolase; Validated 92.63
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 91.95
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 91.85
PLN02591250 tryptophan synthase 91.23
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 91.21
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 90.99
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 90.91
cd08209391 RLP_DK-MTP-1-P-enolase 2,3-diketo-5-methylthiopent 90.69
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 90.56
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 90.51
smart0074361 Agenet Tudor-like domain present in plant sequence 90.34
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 89.8
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 89.39
cd08206414 RuBisCO_large_I_II_III Ribulose bisphosphate carbo 89.34
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 89.33
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 89.16
cd08207406 RLP_NonPhot Ribulose bisphosphate carboxylase like 88.9
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 88.62
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 88.22
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 88.12
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 88.11
CHL00162267 thiG thiamin biosynthesis protein G; Validated 87.82
PRK09549407 mtnW 2,3-diketo-5-methylthiopentyl-1-phosphate eno 87.79
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 87.74
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 87.72
KOG1819|consensus990 87.66
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 87.63
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 87.45
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 87.17
PRK04208468 rbcL ribulose bisophosphate carboxylase; Reviewed 87.16
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 87.14
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 86.79
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 86.72
PRK00208250 thiG thiazole synthase; Reviewed 86.69
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 86.17
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 86.16
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 86.06
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 85.97
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 85.89
cd08213412 RuBisCO_large_III Ribulose bisphosphate carboxylas 85.85
PLN02433345 uroporphyrinogen decarboxylase 85.48
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 85.47
PLN02424332 ketopantoate hydroxymethyltransferase 85.32
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 85.3
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 85.24
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 85.18
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 84.94
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 84.83
TIGR03332407 salvage_mtnW 2,3-diketo-5-methylthiopentyl-1-phosp 84.71
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 84.71
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 84.38
cd03465330 URO-D_like The URO-D _like protein superfamily inc 84.05
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 84.04
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 83.91
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 83.55
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 83.26
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 83.25
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 83.02
PF01180295 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP 82.99
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 82.87
CHL00040475 rbcL ribulose-1,5-bisphosphate carboxylase/oxygena 82.77
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 82.76
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 82.64
cd08212450 RuBisCO_large_I Ribulose bisphosphate carboxylase 82.33
PRK04302223 triosephosphate isomerase; Provisional 82.18
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 81.83
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 81.67
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 81.21
cd08208424 RLP_Photo Ribulose bisphosphate carboxylase like p 80.87
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 80.65
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 80.63
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information 
Probab=100.00  E-value=2.6e-49  Score=419.43  Aligned_cols=251  Identities=25%  Similarity=0.380  Sum_probs=232.7

Q ss_pred             ceeee---cCCCCCCCHHHHHHHHHhCCCCCccCCCccccccCCCCCCCCCCCCCccccCCCCeEEEeCCCCCHHHHHHH
Q psy11975        456 SHYFK---AHSSTSMPIQKRKSLLRKFPLWPELEPSTSELKRSDRPMSVGPRSVRPSEREWQADLLKPQKHTTTRATIDL  532 (786)
Q Consensus       456 ~Gvf~---agE~~sLT~dER~~Lle~~~~wve~~a~~~e~~~~~~~~~~~~r~v~veevaGRVPVIaGVGa~ST~EAIEL  532 (786)
                      .|+|.   +||+.+||.+||++|++.   |++                         +++||+|||+||++++++|++++
T Consensus        36 ~gi~v~GstGE~~~Ls~~Er~~l~~~---~~~-------------------------~~~g~~pvi~gv~~~~t~~ai~~   87 (294)
T TIGR02313        36 HAISVGGTSGEPGSLTLEERKQAIEN---AID-------------------------QIAGRIPFAPGTGALNHDETLEL   87 (294)
T ss_pred             CEEEECccCcccccCCHHHHHHHHHH---HHH-------------------------HhCCCCcEEEECCcchHHHHHHH
Confidence            46665   899999999999999998   543                         46789999999999999999999


Q ss_pred             HHHHHHcCCCEEEEcCCCCCCCCCCHHHHHHHHHHHHhcC-CCCEEEEeCCCCcCCccCHHHHHHHH-hCCCEEEEEeC-
Q psy11975        533 TQKAAKAGANAALILCPYYFQKKMTEDLIYEHFISVADNS-PIPVIIYNNTFVTNIDISVDTLVKLA-HHENIRGVKDT-  609 (786)
Q Consensus       533 Ar~Ae~aGADAVmViPPyY~kps~S~eeLv~YFraIAeAt-dLPIiLYNiP~~TGv~LSpelL~rLA-eiPNVVGIKDS-  609 (786)
                      +++|+++|||++|++||+|++++  ++++++||++|++++ ++||++||+|.++|++++++++.+|+ ++|||+|||++ 
T Consensus        88 a~~A~~~Gad~v~v~pP~y~~~~--~~~l~~~f~~ia~a~~~lpv~iYn~P~~tg~~l~~~~l~~L~~~~pnv~giK~ss  165 (294)
T TIGR02313        88 TKFAEEAGADAAMVIVPYYNKPN--QEALYDHFAEVADAVPDFPIIIYNIPGRAAQEIAPKTMARLRKDCPNIVGAKESN  165 (294)
T ss_pred             HHHHHHcCCCEEEEcCccCCCCC--HHHHHHHHHHHHHhccCCCEEEEeCchhcCcCCCHHHHHHHHhhCCCEEEEEeCC
Confidence            99999999999999999999987  999999999999999 89999999999999999999999999 69999999999 


Q ss_pred             -CHHHHHHHHhhcCCCCEEEEeCCcchhhhhhccCCccccccccccccHHHHHHHHHHHcCCHHHHHHHHHHhhhhHHHH
Q psy11975        610 -DNIKLANMANQTKDLNFSVFAGSAGYLLSGLLVGCAGGINALSAVLGGPICELYDLAKAGKWEEAMKLQHRLVKPDVTV  688 (786)
Q Consensus       610 -Dl~ri~~ll~~~~~~df~Vf~G~DelLL~aL~~GAdG~Isg~aN~~Pel~vaL~eA~~aGD~eeAreLQ~rL~pLi~~l  688 (786)
                       |+.++.++++ ..+++|.||.|.|.++++++.+|++|+|++++|++|+++++||+++++||+++|+++|.++.++++.+
T Consensus       166 ~d~~~~~~~~~-~~~~~~~v~~G~d~~~~~~l~~Ga~G~is~~~n~~P~~~~~l~~~~~~gd~~~A~~l~~~~~~~~~~~  244 (294)
T TIGR02313       166 KDFEHLNHLFL-EAGRDFLLFCGIELLCLPMLAIGAAGSIAATANVEPKEVAELCEAAEAGDIKGAQDLHFELLEANDAI  244 (294)
T ss_pred             CCHHHHHHHHH-hcCCCeEEEEcchHHHHHHHHCCCCEEEecHHhhCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
Confidence             9999999876 34679999999999999999999999999999999999999999999999999999999999998765


Q ss_pred             HhhhhccccCHHHHHHHHHHcCCCCCCCCCCCCCCCCHHHHHHHHHHHHHcCCCC
Q psy11975        689 RNVLLMKEMGVPGVRAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVLTEAGFLV  743 (786)
Q Consensus       689 ~~~~~~~~~~ia~lKaaL~lrGI~~G~vR~PL~~pLseeekaeL~~~L~~lGll~  743 (786)
                           ....++..+|++|+++|++.|.+|+|+. +|+++++++|+++|+++++++
T Consensus       245 -----~~~~~~~~~K~al~~~G~~~g~~R~Pl~-~l~~~~~~~l~~~l~~~~~~~  293 (294)
T TIGR02313       245 -----FKDTNPAPLKAALGMMGLIEKELRPPLG-LPSDALEEEIRDMAEKYGKIE  293 (294)
T ss_pred             -----ccCCCcHHHHHHHHHcCCCCCCcCCCCC-CCCHHHHHHHHHHHHHcCCcc
Confidence                 3344566799999999999899999999 999999999999999988654

This model represents a subset of the DapA (dihydrodipicolinate synthase) family which has apparently evolved a separate function. The product of DapA, dihydrodipicolinate, results from the non-enzymatic cyclization and dehydration of 6-amino-2,4-dihydroxyhept-2-ene-1,7-dioic acid, which is different from the substrate of this reaction only in the presence of the amino group. In the absence of this amino group, and running the reaction in the opposite direction, the reaction corresponds to the HpaI aldolase component of the 4-hydroxyphenylacetic acid catabolism pathway (see TIGR02311). At present, this variant of DapA is found only in Oceanobacillus iheyensis HTE831 and Thermus thermophilus HB27. In both of these cases, one or more other DapA genes can be found and the one identified by this model is part of an operon for 4-hydroxyphenylacetic acid catabolism.
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>PLN02417 dihydrodipicolinate synthase Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea Back     alignment and domain information
>cd05835 Dnmt3b_related The PWWP domain is an essential component of DNA methyltransferase 3 B (Dnmt3b) which is responsible for establishing DNA methylation patterns during embryogenesis and gametogenesis Back     alignment and domain information
>cd05834 HDGF_related The PWWP domain is an essential part of the Hepatoma Derived Growth Factor (HDGF) family of proteins, and is necessary for DNA binding by HDGF Back     alignment and domain information
>cd05836 N_Pac_NP60 The PWWP domain is an essential part of the cytokine-like nuclear factor n-pac protein, or NP60, which enhances the activity of MAP2K4 and MAP2K6 kinases to phosphorylate p38-alpha Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>smart00293 PWWP domain with conserved PWWP motif Back     alignment and domain information
>cd05840 SPBC215_ISWI_like The PWWP domain is a component of the S Back     alignment and domain information
>cd06080 MUM1_like Mutated melanoma-associated antigen 1 (MUM-1) is a melanoma-associated antigen (MAA) Back     alignment and domain information
>PF00855 PWWP: PWWP domain; InterPro: IPR000313 Upon characterisation of WHSC1, a gene mapping to the Wolf-Hirschhornsyndrome critical region and at its C terminus similar to the Drosophila melanogaster ASH1/trithorax group proteins, a novel protein domain designated PWWP domain was identified [] Back     alignment and domain information
>cd05837 MSH6_like The PWWP domain is present in MSH6, a mismatch repair protein homologous to bacterial MutS Back     alignment and domain information
>cd05162 PWWP The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids Back     alignment and domain information
>cd05841 BS69_related The PWWP domain is part of BS69 protein, a nuclear protein that specifically binds adenoviral E1A and Epstein-Barr viral EBNA2 proteins, suppressing their transactivation functions Back     alignment and domain information
>cd05838 WHSC1_related The PWWP domain was first identified in the WHSC1 (Wolf-Hirschhorn syndrome candidate 1) protein, a protein implicated in Wolf-Hirschhorn syndrome (WHS) Back     alignment and domain information
>cd05839 BR140_related The PWWP domain is found in the BR140 family, which includes peregrin and BR140-like proteins 1 and 2 Back     alignment and domain information
>cd08205 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase like proteins, Rubisco-Form IV Back     alignment and domain information
>KOG1904|consensus Back     alignment and domain information
>cd08210 RLP_RrRLP Ribulose bisphosphate carboxylase like proteins (RLPs) similar to R Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>PF06187 DUF993: Protein of unknown function (DUF993); InterPro: IPR009334 This entry consists of several hypothetical bacterial proteins of unknown function Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>KOG1081|consensus Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR03326 rubisco_III ribulose bisphosphate carboxylase, type III Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>cd08209 RLP_DK-MTP-1-P-enolase 2,3-diketo-5-methylthiopentyl-1-phosphate enolase Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>smart00743 Agenet Tudor-like domain present in plant sequences Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>cd08206 RuBisCO_large_I_II_III Ribulose bisphosphate carboxylase large chain, Form I,II,III Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>cd08207 RLP_NonPhot Ribulose bisphosphate carboxylase like proteins from nonphototrophic bacteria Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>PRK09549 mtnW 2,3-diketo-5-methylthiopentyl-1-phosphate enolase; Reviewed Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>KOG1819|consensus Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK04208 rbcL ribulose bisophosphate carboxylase; Reviewed Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>cd08213 RuBisCO_large_III Ribulose bisphosphate carboxylase large chain, Form III Back     alignment and domain information
>PLN02433 uroporphyrinogen decarboxylase Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>TIGR03332 salvage_mtnW 2,3-diketo-5-methylthiopentyl-1-phosphate enolase Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>cd03465 URO-D_like The URO-D _like protein superfamily includes bacterial and eukaryotic uroporphyrinogen decarboxylases (URO-D), coenzyme M methyltransferases and other putative bacterial methyltransferases Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>CHL00040 rbcL ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>cd08212 RuBisCO_large_I Ribulose bisphosphate carboxylase large chain, Form I Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>cd08208 RLP_Photo Ribulose bisphosphate carboxylase like proteins from phototrophic bacteria Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query786
3s5n_A304 Crystal Structure Of Human 4-Hydroxy-2-Oxoglutarate 9e-35
3s5o_A307 Crystal Structure Of Human 4-Hydroxy-2-Oxoglutarate 4e-34
1xky_A301 Crystal Structure Of Dihydrodipicolinate Synthase D 3e-18
3hij_A292 Crystal Structure Of Dihydrodipicolinate Synthase F 2e-17
3eb2_A300 Crystal Structure Of Dihydrodipicolinate Synthase F 2e-11
3qfe_A318 Crystal Structures Of A Putative Dihydrodipicolinat 2e-11
3h5d_A311 Dihydrodipicolinate Synthase From Drug-Resistant St 3e-10
3pud_A291 Crystal Structure Of Dhydrodipicolinate Synthase Fr 2e-09
2vc6_A292 Structure Of Mosa From S. Meliloti With Pyruvate Bo 4e-09
2ehh_A294 Crystal Structure Of Dihydrodipicolinate Synthase F 6e-09
2a6n_A292 Dihydrodipicolinate Synthase (E. Coli)- Mutant R138 2e-08
1dhp_A292 Dihydrodipicolinate Synthase Length = 292 4e-08
2a6l_A292 Dihydrodipicolinate Synthase (E. Coli)- Mutant R138 4e-08
1s5t_A292 Crystal Structure Analysis Of A Mutant Of Dihydrodi 4e-08
3i7q_A292 Dihydrodipicolinate Synthase Mutant - K161a Length 7e-08
1s5w_A292 Crystal Structure Analysis Of A Mutant Of Dihydrodi 1e-07
1s5v_A292 Crystal Structure Analysis Of A Mutant Of Dihydrodi 1e-07
2pur_A292 Structure Of Dihydrodipicolinate Synthase Mutant Th 2e-07
3c0j_A292 Structure Of E. Coli Dihydrodipicolinate Synthase C 2e-07
2ojp_A292 The Crystal Structure Of A Dimeric Mutant Of Dihydr 2e-07
3flu_A297 Crystal Structure Of Dihydrodipicolinate Synthase F 2e-07
1o5k_A306 Crystal Structure Of Dihydrodipicolinate Synthase ( 4e-07
3pb0_A300 Characterisation Of The First Monomeric Dihydrodipi 4e-07
3pb2_A300 Characterisation Of The First Monomeric Dihydrodipi 4e-07
3den_A292 Structure Of E. Coli Dhdps Mutant Y107w Length = 29 5e-07
3g0s_A316 Dihydrodipicolinate Synthase From Salmonella Typhim 6e-07
3ird_A291 Structure Of Dihydrodipicolinate Synthase From Clos 7e-07
2r8w_A332 The Crystal Structure Of Dihydrodipicolinate Syntha 2e-06
3a5f_A291 High-Resolution Structure Of Dhdps From Clostridium 3e-06
3qze_A314 Crystal Structure Of Dapa (Pa1010) At 1.6 A Resolut 2e-05
3noe_A292 Crystal Structure Of Dihydrodipicolinate Synthase F 2e-05
2pcq_A283 Crystal Structure Of Putative Dihydrodipicolinate S 2e-05
2rfg_A297 Crystal Structure Of Dihydrodipicolinate Synthase F 2e-05
3m5v_A301 Crystal Structure Of Dihydrodipicolinate Synthase F 2e-05
2v8z_A343 Crystal Structure Of Yage, A Prophage Protein Belon 3e-05
2yxg_A289 Crystal Structure Of Dihyrodipicolinate Synthase (D 5e-05
2v9d_A343 Crystal Structure Of Yage, A Prophage Protein Belon 6e-05
3nev_A298 Crystal Structure Of Yage, A Prophage Protein From 8e-05
3ler_A301 Crystal Structure Of Dihydrodipicolinate Synthase F 1e-04
1xxx_A303 Crystal Structure Of Dihydrodipicolinate Synthase ( 2e-04
3n2x_A298 Crystal Structure Of Yage, A Prophage Protein Belon 4e-04
3flg_A151 The Pwwp Domain Of Human Dna (Cytosine-5-)-Methyltr 5e-04
1khc_A147 Crystal Structure Of The Pwwp Domain Of Mammalian D 6e-04
3l21_A304 The Crystal Structure Of A Dimeric Mutant Of Dihydr 8e-04
>pdb|3S5N|A Chain A, Crystal Structure Of Human 4-Hydroxy-2-Oxoglutarate Aldolase Length = 304 Back     alignment and structure 
Iteration: 1

 Score =  145 bits (366), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 75/228 (32%), Positives = 123/228 (53%), Gaps = 8/228 (3%)
Query: 517 LLKPQKHTTTRATIDLTQXXXXXXXXXXLILCPYYFQKKMTEDLIYEHFISVADNSPIPV 576
           LL      +T+AT+++T           +++ P Y++ +M+   +  H+  VAD SPIPV
Sbjct: 83  LLAGSGCESTQATVEMTVSMAQVGADAAMVVTPCYYRGRMSSAALIHHYTKVADLSPIPV 142
Query: 577 IIYNNTFVTNIDISVDTLVKLAHHENIRGVKDT--DNIKLANMANQTKDLNFSVFXXXXX 634
           ++Y+    T +D+ VD +V L+ H NI G+KD+  D  ++  + ++T+  +F V      
Sbjct: 143 VLYSVPANTGLDLPVDAVVTLSQHPNIVGMKDSGGDVTRIGLIVHKTRKQDFQVLAGSAG 202
Query: 635 XXXXXXXXXCAGGINALSAVLGGPICELYDLAKAGKWEEAMKLQHRLVKPDVTVRNVLLM 694
                      GG+ AL+ VLG  +C+L  L   G+WE+A KLQHRL++P     N  + 
Sbjct: 203 FLMASYALGAVGGVCALANVLGAQVCQLERLCCTGQWEDAQKLQHRLIEP-----NAAVT 257
Query: 695 KEMGVPGVRAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVLTEAGFL 742
           +  G+PG++  M+ +GYYGG  R PL   L P   E ++   T  G+L
Sbjct: 258 RRFGIPGLKKIMDWFGYYGGPCRAPL-QELSPAEEEALRMDFTSNGWL 304
>pdb|3S5O|A Chain A, Crystal Structure Of Human 4-Hydroxy-2-Oxoglutarate Aldolase Bound To Pyruvate Length = 307 Back     alignment and structure
>pdb|1XKY|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase Dapa-2 (Ba3935) From Bacillus Anthracis At 1.94a Resolution. Length = 301 Back     alignment and structure
>pdb|3HIJ|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase From Bacillus Anthracis In Complex With Its Substrate, Pyruvate Length = 292 Back     alignment and structure
>pdb|3EB2|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase From Rhodopseudomonas Palustris At 2.0a Resolution Length = 300 Back     alignment and structure
>pdb|3QFE|A Chain A, Crystal Structures Of A Putative Dihydrodipicolinate Synthase Family Protein From Coccidioides Immitis Length = 318 Back     alignment and structure
>pdb|3H5D|A Chain A, Dihydrodipicolinate Synthase From Drug-Resistant Streptococc Pneumoniae Length = 311 Back     alignment and structure
>pdb|3PUD|A Chain A, Crystal Structure Of Dhydrodipicolinate Synthase From Acinetobacter Baumannii At 2.8a Resolution Length = 291 Back     alignment and structure
>pdb|2VC6|A Chain A, Structure Of Mosa From S. Meliloti With Pyruvate Bound Length = 292 Back     alignment and structure
>pdb|2EHH|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase From Aquifex Aeolicus Length = 294 Back     alignment and structure
>pdb|2A6N|A Chain A, Dihydrodipicolinate Synthase (E. Coli)- Mutant R138a Length = 292 Back     alignment and structure
>pdb|1DHP|A Chain A, Dihydrodipicolinate Synthase Length = 292 Back     alignment and structure
>pdb|2A6L|A Chain A, Dihydrodipicolinate Synthase (E. Coli)- Mutant R138h Length = 292 Back     alignment and structure
>pdb|1S5T|A Chain A, Crystal Structure Analysis Of A Mutant Of Dihydrodipicolinate Synthase--Residue Thr44 To Val44 Length = 292 Back     alignment and structure
>pdb|3I7Q|A Chain A, Dihydrodipicolinate Synthase Mutant - K161a Length = 292 Back     alignment and structure
>pdb|1S5W|A Chain A, Crystal Structure Analysis Of A Mutant Of Dihydrodipicolinate Synthase--Residue Tyr133 To Phe133 Length = 292 Back     alignment and structure
>pdb|1S5V|A Chain A, Crystal Structure Analysis Of A Mutant Of Dihydrodipicolinate Synthase--Residue Tyr107 To Phe107 Length = 292 Back     alignment and structure
>pdb|2PUR|A Chain A, Structure Of Dihydrodipicolinate Synthase Mutant Thr44ser At 1.7 A. Length = 292 Back     alignment and structure
>pdb|3C0J|A Chain A, Structure Of E. Coli Dihydrodipicolinate Synthase Complexed With Hydroxypyruvate Length = 292 Back     alignment and structure
>pdb|2OJP|A Chain A, The Crystal Structure Of A Dimeric Mutant Of Dihydrodipicolinate Synthase From E.Coli- Dhdps-L197y Length = 292 Back     alignment and structure
>pdb|3FLU|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase From The Pathogen Neisseria Meningitidis Length = 297 Back     alignment and structure
>pdb|1O5K|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase (Tm1521) From Thermotoga Maritima At 1.80 A Resolution Length = 306 Back     alignment and structure
>pdb|3PB0|A Chain A, Characterisation Of The First Monomeric Dihydrodipicolinate Synthase Variant Reveals Evolutionary Insights Length = 300 Back     alignment and structure
>pdb|3PB2|A Chain A, Characterisation Of The First Monomeric Dihydrodipicolinate Synthase Variant Reveals Evolutionary Insights Length = 300 Back     alignment and structure
>pdb|3DEN|A Chain A, Structure Of E. Coli Dhdps Mutant Y107w Length = 292 Back     alignment and structure
>pdb|3G0S|A Chain A, Dihydrodipicolinate Synthase From Salmonella Typhimurium Lt2 Length = 316 Back     alignment and structure
>pdb|3IRD|A Chain A, Structure Of Dihydrodipicolinate Synthase From Clostridium Botulinum Length = 291 Back     alignment and structure
>pdb|2R8W|A Chain A, The Crystal Structure Of Dihydrodipicolinate Synthase (Atu0899) From Agrobacterium Tumefaciens Str. C58 Length = 332 Back     alignment and structure
>pdb|3A5F|A Chain A, High-Resolution Structure Of Dhdps From Clostridium Botulinum In Complex With Pyruvate Length = 291 Back     alignment and structure
>pdb|3QZE|A Chain A, Crystal Structure Of Dapa (Pa1010) At 1.6 A Resolution Length = 314 Back     alignment and structure
>pdb|3NOE|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase From Pseudomonas Aeruginosa Length = 292 Back     alignment and structure
>pdb|2PCQ|A Chain A, Crystal Structure Of Putative Dihydrodipicolinate Synthase (Ttha0737) From Thermus Thermophilus Hb8 Length = 283 Back     alignment and structure
>pdb|2RFG|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase From Hahella Chejuensis At 1.5a Resolution Length = 297 Back     alignment and structure
>pdb|3M5V|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase From Campylobacter Jejuni Length = 301 Back     alignment and structure
>pdb|2V8Z|A Chain A, Crystal Structure Of Yage, A Prophage Protein Belonging To The Dihydrodipicolinic Acid Synthase Family From E. Coli K12 Length = 343 Back     alignment and structure
>pdb|2YXG|A Chain A, Crystal Structure Of Dihyrodipicolinate Synthase (Dapa) Length = 289 Back     alignment and structure
>pdb|2V9D|A Chain A, Crystal Structure Of Yage, A Prophage Protein Belonging To The Dihydrodipicolinic Acid Synthase Family From E. Coli K12 Length = 343 Back     alignment and structure
>pdb|3NEV|A Chain A, Crystal Structure Of Yage, A Prophage Protein From E. Coli K12 In Complex With Kdgal Length = 298 Back     alignment and structure
>pdb|3LER|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase From Campylobacter Jejuni Subsp. Jejuni Nctc 11168 Length = 301 Back     alignment and structure
>pdb|1XXX|A Chain A, Crystal Structure Of Dihydrodipicolinate Synthase (Dapa, Rv2753c) From Mycobacterium Tuberculosis Length = 303 Back     alignment and structure
>pdb|3N2X|A Chain A, Crystal Structure Of Yage, A Prophage Protein Belonging To The Dihydrodipicolinic Acid Synthase Family From E. Coli K12 In Complex With Pyruvate Length = 298 Back     alignment and structure
>pdb|3FLG|A Chain A, The Pwwp Domain Of Human Dna (Cytosine-5-)-Methyltransferase 3 Beta Length = 151 Back     alignment and structure
>pdb|1KHC|A Chain A, Crystal Structure Of The Pwwp Domain Of Mammalian Dna Methyltransferase Dnmt3b Length = 147 Back     alignment and structure
>pdb|3L21|A Chain A, The Crystal Structure Of A Dimeric Mutant Of Dihydrodipicolinate Synthase (Dapa, Rv2753c) From Mycobacterium Tuberculosis - Dhdps- A204r Length = 304 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query786
3qfe_A318 Putative dihydrodipicolinate synthase family PROT; 2e-54
3eb2_A300 Putative dihydrodipicolinate synthetase; lysine bi 5e-47
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 7e-47
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 2e-04
2nuw_A288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 5e-43
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 5e-43
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 7e-43
2r91_A286 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM 1e-39
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 2e-39
3h5d_A311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 2e-39
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 2e-39
1w3i_A293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 4e-39
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 8e-39
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 9e-39
2pcq_A283 Putative dihydrodipicolinate synthase; lyase, lysi 1e-38
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 1e-38
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 2e-38
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 2e-38
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 2e-38
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 3e-38
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 3e-38
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 3e-38
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 1e-37
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 3e-37
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 3e-37
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 3e-37
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 4e-37
3dz1_A313 Dihydrodipicolinate synthase; lysine biosynthesis, 2e-36
3dz1_A313 Dihydrodipicolinate synthase; lysine biosynthesis, 9e-05
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 3e-36
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 3e-36
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 5e-36
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 2e-35
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 2e-33
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 2e-04
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 2e-33
4dpp_A360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 1e-31
4dpp_A360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 1e-04
2hmc_A344 AGR_L_411P, dihydrodipicolinate synthase; alpha-be 5e-29
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 1e-26
3llr_A154 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 5e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
3qby_A94 Hepatoma-derived growth factor-related protein 2; 1e-09
2daq_A110 WHSC1L1 protein, isoform long; PWWP domain, struct 8e-09
1ri0_A110 Hepatoma-derived growth factor; HDGF, HATH domain, 2e-08
1khc_A147 DNA cytosine-5 methyltransferase 3B2; five beta-sh 2e-08
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 5e-08
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 2e-07
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 4e-06
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 4e-05
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 3e-04
2l89_A108 PWWP domain-containing protein 1; histone binding, 9e-08
2gfu_A134 DNA mismatch repair protein MSH6; PWWP domain, tud 4e-07
1h3z_A109 Hypothetical 62.8 kDa protein C215.07C; nuclear pr 9e-07
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 3e-06
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 1e-05
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 1e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 2e-04
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 5e-04
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Length = 318 Back     alignment and structure
 Score =  189 bits (483), Expect = 2e-54
 Identities = 66/232 (28%), Positives = 109/232 (46%), Gaps = 25/232 (10%)

Query: 526 TRATIDLTQKAAKAGANAALILCPYYFQKKMTEDLIYEHFISVADNSPIPVIIYNNTF-- 583
           TR  ++    A+ AGAN  L+L P YF K  T  +I   F  V+  SP+PV+IYN  F  
Sbjct: 92  TRQVLEHINDASVAGANYVLVLPPAYFGKATTPPVIKSFFDDVSCQSPLPVVIYN--FPG 149

Query: 584 -VTNIDISVDTLVKLAH-HENIRGVKD-TDNI-KLANMANQTKDLNFSVFAGSAGYLLSG 639
               ID+  D +  +A  + N+ GVK    ++ K+  +A       FSVF G + +L+ G
Sbjct: 150 VCNGIDLDSDMITTIARKNPNVVGVKLTCASVGKITRLAATLPPAAFSVFGGQSDFLIGG 209

Query: 640 LLVGCAGGINALSAVLGGPICELYDLAKAGKWEEAMKLQHRLVKPDVTVRNVLLMKEMGV 699
           L VG AG I A + V    + ++Y+L KAGK ++AM+L  +    +          + G+
Sbjct: 210 LSVGSAGCIAAFANVFPKTVSKIYELYKAGKVDQAMELHRKAALAESPC-------KSGI 262

Query: 700 PGVRAAMELYGYYGG---------RSRRPLPAALKPGGAEKIKQVLTEAGFL 742
              + A  ++              R R+P          +++++V+ E   +
Sbjct: 263 ATTKYAAAIFSAKAAGIEDAEEKLRPRKPYD-PPSEAAKQEVRKVMAEVAAI 313
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} Length = 300 Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} PDB: 3s5n_A Length = 307 Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} PDB: 3s5n_A Length = 307 Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Length = 288 Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Length = 293 Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Length = 343 Back     alignment and structure
>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A Length = 286 Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} Length = 316 Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Length = 311 Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Length = 332 Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Length = 293 Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Length = 315 Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Length = 291 Back     alignment and structure
>2pcq_A Putative dihydrodipicolinate synthase; lyase, lysine biosynthesis, dihydrodipicoliante, S genomics, NPPSFA; 2.10A {Thermus thermophilus} Length = 283 Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} Length = 297 Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Length = 301 Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Length = 289 Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Length = 297 Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Length = 291 Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Length = 294 Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Length = 292 Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Length = 314 Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Length = 314 Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Length = 292 Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Length = 304 Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} PDB: 1xxx_A Length = 304 Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} Length = 313 Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} Length = 313 Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Length = 306 Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Length = 315 Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} PDB: 3ler_A* Length = 301 Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} PDB: 3di1_A 3di0_A Length = 292 Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Length = 309 Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Length = 309 Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Length = 303 Back     alignment and structure
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* Length = 360 Back     alignment and structure
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* Length = 360 Back     alignment and structure
>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str} Length = 344 Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Length = 294 Back     alignment and structure
>3llr_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase, methylysine binding, STR genomics consortium, SGC, alternative promoter usage; HET: DNA BTB; 2.30A {Homo sapiens} Length = 154 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3qby_A Hepatoma-derived growth factor-related protein 2; HDGF2, structural genomics consortium, SGC, protein binding; HET: M3L; 1.95A {Homo sapiens} PDB: 3qj6_A* 3eae_A 1n27_A Length = 94 Back     alignment and structure
>2daq_A WHSC1L1 protein, isoform long; PWWP domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.2 Length = 110 Back     alignment and structure
>1ri0_A Hepatoma-derived growth factor; HDGF, HATH domain, PWWP domain, heparin-binding, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.9.2 PDB: 2b8a_A 2nlu_A Length = 110 Back     alignment and structure
>1khc_A DNA cytosine-5 methyltransferase 3B2; five beta-sheets barrel followed by five-helix bundle; HET: DNA; 1.80A {Mus musculus} SCOP: b.34.9.2 PDB: 3flg_A* 3qkj_A* Length = 147 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>2l89_A PWWP domain-containing protein 1; histone binding, protein binding; NMR {Schizosaccharomyces pombe} Length = 108 Back     alignment and structure
>2gfu_A DNA mismatch repair protein MSH6; PWWP domain, tudor domain, DNA binding, DNA binding protein; HET: DNA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query786
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 100.0
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 100.0
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 100.0
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 100.0
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 100.0
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 100.0
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 100.0
3eb2_A300 Putative dihydrodipicolinate synthetase; lysine bi 100.0
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 100.0
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 100.0
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 100.0
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 100.0
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 100.0
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 100.0
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 100.0
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 100.0
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 100.0
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 100.0
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 100.0
3h5d_A311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 100.0
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 100.0
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 100.0
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 100.0
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 100.0
2pcq_A283 Putative dihydrodipicolinate synthase; lyase, lysi 100.0
3qfe_A318 Putative dihydrodipicolinate synthase family PROT; 100.0
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 100.0
2r91_A286 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM 100.0
1w3i_A293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 100.0
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 100.0
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 100.0
3dz1_A313 Dihydrodipicolinate synthase; lysine biosynthesis, 100.0
2hmc_A344 AGR_L_411P, dihydrodipicolinate synthase; alpha-be 100.0
2nuw_A288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 100.0
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 100.0
4dpp_A360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 100.0
2gfu_A134 DNA mismatch repair protein MSH6; PWWP domain, tud 99.66
3llr_A154 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 99.66
4fu6_A153 PC4 and SFRS1-interacting protein; structural geno 99.65
3qby_A94 Hepatoma-derived growth factor-related protein 2; 99.65
1ri0_A110 Hepatoma-derived growth factor; HDGF, HATH domain, 99.61
1khc_A147 DNA cytosine-5 methyltransferase 3B2; five beta-sh 99.59
2daq_A110 WHSC1L1 protein, isoform long; PWWP domain, struct 99.59
2l89_A108 PWWP domain-containing protein 1; histone binding, 99.57
1h3z_A109 Hypothetical 62.8 kDa protein C215.07C; nuclear pr 99.53
3l42_A130 Peregrin; transcription regulation, histone H3 ace 99.49
3pfs_A158 Bromodomain and PHD finger-containing protein 3; s 99.47
4dnh_A396 Uncharacterized protein; structural genomics, PSI- 97.27
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 96.9
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 96.29
3pmi_A134 PWWP domain-containing protein MUM1; structural ge 95.6
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 95.53
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 95.33
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 95.22
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 94.87
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 94.75
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 93.98
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 93.63
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 93.32
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 93.25
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 93.19
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 93.02
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 92.88
3tjx_A354 Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh 92.42
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 92.41
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 92.06
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 91.57
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 91.51
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 91.27
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 91.27
3qii_A85 PHD finger protein 20; tudor domain, structural ge 90.89
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 90.78
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 90.29
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 90.26
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 89.53
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 89.14
3p8d_A67 Medulloblastoma antigen MU-MB-50.72; tudor domain, 89.08
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 89.08
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 88.95
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 88.93
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 88.9
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 88.71
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 88.48
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 88.11
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 88.07
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 87.66
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 87.46
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 87.11
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 86.23
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 85.66
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 85.65
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 85.49
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 85.47
3uau_A379 JLPA, surface-exposed lipoprotein; adhesin, bacter 85.38
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 85.32
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 84.89
2qkf_A280 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; 84.79
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 84.7
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 84.67
3lg3_A435 Isocitrate lyase; conserved, CD, proteomics eviden 84.56
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 84.12
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 84.06
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 83.83
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 83.81
3tha_A252 Tryptophan synthase alpha chain; structural genomi 83.66
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 83.64
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 83.57
3i4e_A439 Isocitrate lyase; structural genomics, seattle str 83.5
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 83.47
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 82.94
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 82.81
3fok_A307 Uncharacterized protein CGL0159; CGL0159 ,brevibac 82.55
3s6w_A54 Tudor domain-containing protein 3; methylated argi 82.42
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 81.76
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 81.68
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 81.58
1o60_A292 2-dehydro-3-deoxyphosphooctonate aldolase; structu 81.54
3cyv_A354 URO-D, UPD, uroporphyrinogen decarboxylase; alpha/ 81.31
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 80.72
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 80.67
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 80.44
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
Probab=100.00  E-value=6.8e-52  Score=441.82  Aligned_cols=251  Identities=25%  Similarity=0.357  Sum_probs=236.8

Q ss_pred             ceeee---cCCCCCCCHHHHHHHHHhCCCCCccCCCccccccCCCCCCCCCCCCCccccCCCCeEEEeCCCCCHHHHHHH
Q psy11975        456 SHYFK---AHSSTSMPIQKRKSLLRKFPLWPELEPSTSELKRSDRPMSVGPRSVRPSEREWQADLLKPQKHTTTRATIDL  532 (786)
Q Consensus       456 ~Gvf~---agE~~sLT~dER~~Lle~~~~wve~~a~~~e~~~~~~~~~~~~r~v~veevaGRVPVIaGVGa~ST~EAIEL  532 (786)
                      .|++.   +||+.+||.+||++|++.   |++                         .++||+|||+|||+++|++++++
T Consensus        58 ~Gl~v~GtTGE~~~Ls~~Er~~v~~~---~v~-------------------------~~~grvpViaGvg~~st~~ai~l  109 (315)
T 3si9_A           58 NGVSPVGTTGESPTLTHEEHKRIIEL---CVE-------------------------QVAKRVPVVAGAGSNSTSEAVEL  109 (315)
T ss_dssp             SEEECSSTTTTGGGSCHHHHHHHHHH---HHH-------------------------HHTTSSCBEEECCCSSHHHHHHH
T ss_pred             CEEEeCccccCccccCHHHHHHHHHH---HHH-------------------------HhCCCCcEEEeCCCCCHHHHHHH
Confidence            36666   899999999999999999   654                         46789999999999999999999


Q ss_pred             HHHHHHcCCCEEEEcCCCCCCCCCCHHHHHHHHHHHHhcCCCCEEEEeCCCCcCCccCHHHHHHHHh-CCCEEEEEeC--
Q psy11975        533 TQKAAKAGANAALILCPYYFQKKMTEDLIYEHFISVADNSPIPVIIYNNTFVTNIDISVDTLVKLAH-HENIRGVKDT--  609 (786)
Q Consensus       533 Ar~Ae~aGADAVmViPPyY~kps~S~eeLv~YFraIAeAtdLPIiLYNiP~~TGv~LSpelL~rLAe-iPNVVGIKDS--  609 (786)
                      +++|+++|||++|+++|||++++  ++++++||++||+++++||||||+|++||++|+++++.+|++ +|||+||||+  
T Consensus       110 a~~A~~~Gadavlv~~P~y~~~~--~~~l~~~f~~va~a~~lPiilYn~P~~tg~~l~~~~~~~La~~~pnIvgiKdssg  187 (315)
T 3si9_A          110 AKHAEKAGADAVLVVTPYYNRPN--QRGLYTHFSSIAKAISIPIIIYNIPSRSVIDMAVETMRDLCRDFKNIIGVKDATG  187 (315)
T ss_dssp             HHHHHHTTCSEEEEECCCSSCCC--HHHHHHHHHHHHHHCSSCEEEEECHHHHSCCCCHHHHHHHHHHCTTEEEEEECSC
T ss_pred             HHHHHhcCCCEEEECCCCCCCCC--HHHHHHHHHHHHHcCCCCEEEEeCchhhCCCCCHHHHHHHHhhCCCEEEEEeCCC
Confidence            99999999999999999999987  999999999999999999999999999999999999999998 9999999999  


Q ss_pred             CHHHHHHHHhhcCCCCEEEEeCCcchhhhhhccCCccccccccccccHHHHHHHHHHHcCCHHHHHHHHHHhhhhHHHHH
Q psy11975        610 DNIKLANMANQTKDLNFSVFAGSAGYLLSGLLVGCAGGINALSAVLGGPICELYDLAKAGKWEEAMKLQHRLVKPDVTVR  689 (786)
Q Consensus       610 Dl~ri~~ll~~~~~~df~Vf~G~DelLL~aL~~GAdG~Isg~aN~~Pel~vaL~eA~~aGD~eeAreLQ~rL~pLi~~l~  689 (786)
                      |+.++.++++. .+++|.||+|.|.++++++.+|++|+|++++|++|+++++||+++++||+++|+++|+++.++++.+ 
T Consensus       188 d~~~~~~l~~~-~~~~f~v~~G~d~~~l~~l~~G~~G~is~~an~~P~~~~~l~~a~~~Gd~~~A~~l~~~l~~l~~~l-  265 (315)
T 3si9_A          188 KIERASEQREK-CGKDFVQLSGDDCTALGFNAHGGVGCISVSSNVAPKLCAQLHAACLCSDYKTALKLNDLLMPLNRAV-  265 (315)
T ss_dssp             CTHHHHHHHHH-HCSSSEEEESCGGGHHHHHHTTCCEEEESGGGTCHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHT-
T ss_pred             CHHHHHHHHHH-cCCCeEEEecCHHHHHHHHHcCCCEEEecHHHhhHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHH-
Confidence            99999999873 5689999999999999999999999999999999999999999999999999999999999999876 


Q ss_pred             hhhhccccCHHHHHHHHHHcCCCCCCCCCCCCCCCCHHHHHHHHHHHHHcCCCC
Q psy11975        690 NVLLMKEMGVPGVRAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVLTEAGFLV  743 (786)
Q Consensus       690 ~~~~~~~~~ia~lKaaL~lrGI~~G~vR~PL~~pLseeekaeL~~~L~~lGll~  743 (786)
                          ....++..+|++|+++|++.|.+|+|+. +++++++++|+++|++++++.
T Consensus       266 ----~~~~~~~~~K~al~~~G~~~g~~R~Pl~-~l~~~~~~~l~~~l~~~~l~~  314 (315)
T 3si9_A          266 ----FIEPSPAGIKYAAAKLGLCGTIVRSPIV-PLSDTTKKIIDEALYHAGLLK  314 (315)
T ss_dssp             ----TSSSTTHHHHHHHHHTTSSCCCCCTTSC-CCCHHHHHHHHHHHHHTTSCC
T ss_pred             ----HhcCChHHHHHHHHHCCCCCCCcCCCCC-CCCHHHHHHHHHHHHHCCCcc
Confidence                4567789999999999998899999999 999999999999999999864
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>2pcq_A Putative dihydrodipicolinate synthase; lyase, lysine biosynthesis, dihydrodipicoliante, S genomics, NPPSFA; 2.10A {Thermus thermophilus} Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A* Back     alignment and structure
>2gfu_A DNA mismatch repair protein MSH6; PWWP domain, tudor domain, DNA binding, DNA binding protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>3llr_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase, methylysine binding, STR genomics consortium, SGC, alternative promoter usage; HET: DNA BTB; 2.30A {Homo sapiens} SCOP: b.34.9.0 Back     alignment and structure
>4fu6_A PC4 and SFRS1-interacting protein; structural genomics consortium, SGC, transcription; 2.10A {Homo sapiens} PDB: 2b8a_A 2nlu_A Back     alignment and structure
>3qby_A Hepatoma-derived growth factor-related protein 2; HDGF2, structural genomics consortium, SGC, protein binding; HET: M3L; 1.95A {Homo sapiens} SCOP: b.34.9.2 PDB: 3qj6_A* 3eae_A 1n27_A Back     alignment and structure
>1ri0_A Hepatoma-derived growth factor; HDGF, HATH domain, PWWP domain, heparin-binding, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.9.2 PDB: 2b8a_A 2nlu_A Back     alignment and structure
>1khc_A DNA cytosine-5 methyltransferase 3B2; five beta-sheets barrel followed by five-helix bundle; HET: DNA; 1.80A {Mus musculus} SCOP: b.34.9.2 PDB: 3flg_A* 3qkj_A* Back     alignment and structure
>2daq_A WHSC1L1 protein, isoform long; PWWP domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.9.2 Back     alignment and structure
>2l89_A PWWP domain-containing protein 1; histone binding, protein binding; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3l42_A Peregrin; transcription regulation, histone H3 acetylation, chromatin modification, structural genomics, structural genomics CONS SGC, activator; 1.30A {Homo sapiens} PDB: 3mo8_A* 2x4w_A* 2x35_A* 2x4x_A* 2x4y_A* Back     alignment and structure
>3pfs_A Bromodomain and PHD finger-containing protein 3; structural genomics, structural genomics consortium, SGC, PW domain, protein binding; 1.90A {Homo sapiens} PDB: 3lyi_A* Back     alignment and structure
>4dnh_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati YORK structural genomics research consortium; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>3pmi_A PWWP domain-containing protein MUM1; structural genomics consortium, SGC, protein binding, nucLeu; HET: UNL; 2.82A {Homo sapiens} Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>3uau_A JLPA, surface-exposed lipoprotein; adhesin, bacterial cell surface, cell adhesion; 2.70A {Campylobacter jejuni subsp} Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>2qkf_A 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; manno-octulosonate, synthase, lipopolysaccharide, KDOP, KDO8 KDO8PS; 1.75A {Neisseria meningitidis serogroup B} PDB: 3stf_A 3qpy_A 3ste_A 3qpz_A 3qq0_A 3fyo_A* 3qq1_A 3fyp_A* 3stc_A 3stg_A 1phw_A 1g7v_A* 1gg0_A 1phq_A* 1d9e_A 1pl9_A* 1q3n_A* 1x6u_A* 1x8f_A 1g7u_A* Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>3lg3_A Isocitrate lyase; conserved, CD, proteomics evidence (cytopl periplasmic), drug target functions; 1.40A {Yersinia pestis} SCOP: c.1.12.7 PDB: 1igw_A Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>3i4e_A Isocitrate lyase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.69A {Burkholderia pseudomallei} Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Back     alignment and structure
>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} Back     alignment and structure
>3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>1o60_A 2-dehydro-3-deoxyphosphooctonate aldolase; structural genomics, transferase; 1.80A {Haemophilus influenzae} SCOP: c.1.10.4 PDB: 3e9a_A Back     alignment and structure
>3cyv_A URO-D, UPD, uroporphyrinogen decarboxylase; alpha/beta barrel, cytoplasm, lyase, porphyrin biosynthesis; 2.80A {Shigella flexneri} Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 786
d1xkya1292 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {B 5e-28
d1xkya1292 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {B 7e-04
d2a6na1292 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {E 2e-26
d2a6na1292 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {E 2e-04
d1xxxa1296 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {M 1e-25
d1xxxa1296 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {M 5e-04
d1o5ka_295 c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermo 6e-24
d1f74a_293 c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophil 2e-15
d1f74a_293 c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophil 2e-04
d2nlua1100 b.34.9.2 (A:1-100) Hepatoma-derived growth factor, 3e-11
d1khca_137 b.34.9.2 (A:) DNA methyltransferase DNMT3B {Mouse 1e-09
d2daqa197 b.34.9.2 (A:8-104) Histone-lysine N-methyltransfer 9e-09
d1hl2a_295 c.1.10.1 (A:) N-acetylneuraminate lyase {Escherich 5e-05
d1h3za_108 b.34.9.2 (A:) Hypothetical protein SPBC215.07c {Fi 9e-05
d1w3ia_293 c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Ed 0.002
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Length = 292 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: Class I aldolase
domain: Dihydrodipicolinate synthase
species: Bacillus anthracis [TaxId: 1392]

 Score =  112 bits (280), Expect = 5e-28
 Identities = 65/217 (29%), Positives = 115/217 (52%), Gaps = 9/217 (4%)

Query: 523 HTTTRATIDLTQKAAKAGANAALILCPYYFQKKMTEDLIYEHFISVADNSPIPVIIYNNT 582
              T A+IDLT+KA + G +A +++ PYY   K +++ +Y+HF ++A+++P+PV++YN  
Sbjct: 81  SNNTHASIDLTKKATEVGVDAVMLVAPYYN--KPSQEGMYQHFKAIAESTPLPVMLYNVP 138

Query: 583 FVTNIDISVDTLVKLAHHENIRGVKDTDNIKLANMA-NQTKDLNFSVFAGSAGYLLSGLL 641
             + + ISVDT+V+L+  ENI  +KD     L      +    +F+V++G  G  L  + 
Sbjct: 139 GRSIVQISVDTVVRLSEIENIVAIKDAGGDVLTMTEIIEKTADDFAVYSGDDGLTLPAMA 198

Query: 642 VGCAGGINALSAVLGGPICELYDLAKAGKWEEAMKLQHRLVKPDVTVRNVLLMKEMGVPG 701
           VG  G ++  S V+G  + E+    +AG++++A KL   LV+         L        
Sbjct: 199 VGAKGIVSVASHVIGNEMQEMIAAFQAGEFKKAQKLHQLLVRV-----TDSLFMAPSPTP 253

Query: 702 VRAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVLTE 738
           V+ A+++ G   G  R PL   L       ++ V+  
Sbjct: 254 VKTALQMVGLDVGSVRLPLL-PLTEEERVTLQSVMQS 289
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Length = 292 Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Length = 292 Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Length = 292 Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 296 Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 296 Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Length = 295 Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Length = 293 Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Length = 293 Back     information, alignment and structure
>d2nlua1 b.34.9.2 (A:1-100) Hepatoma-derived growth factor, HDGF {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1khca_ b.34.9.2 (A:) DNA methyltransferase DNMT3B {Mouse (Mus musculus) [TaxId: 10090]} Length = 137 Back     information, alignment and structure
>d2daqa1 b.34.9.2 (A:8-104) Histone-lysine N-methyltransferase NSD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Length = 295 Back     information, alignment and structure
>d1h3za_ b.34.9.2 (A:) Hypothetical protein SPBC215.07c {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 108 Back     information, alignment and structure
>d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]} Length = 293 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query786
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 100.0
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 100.0
d2a6na1292 Dihydrodipicolinate synthase {Escherichia coli [Ta 100.0
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 100.0
d1f74a_293 N-acetylneuraminate lyase {Haemophilus influenzae 100.0
d1hl2a_295 N-acetylneuraminate lyase {Escherichia coli [TaxId 100.0
d1w3ia_293 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus 100.0
d2nlua1100 Hepatoma-derived growth factor, HDGF {Human (Homo 99.68
d1khca_137 DNA methyltransferase DNMT3B {Mouse (Mus musculus) 99.67
d2daqa197 Histone-lysine N-methyltransferase NSD3 {Human (Ho 99.66
d1h3za_108 Hypothetical protein SPBC215.07c {Fission yeast (S 99.62
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 96.16
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 91.52
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 89.16
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 85.63
d2d69a1291 Ribulose 1,5-bisphosphate carboxylase-oxygenase {A 85.49
d2b4ga1312 Dihydroorotate dehydrogenase {Trypanosoma brucei [ 83.87
d1ykwa1283 Ribulose 1,5-bisphosphate carboxylase-oxygenase {C 81.74
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 81.32
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 81.19
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 80.11
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: Class I aldolase
domain: Dihydrodipicolinate synthase
species: Thermotoga maritima [TaxId: 2336]

Probab=100.00  E-value=1.6e-47  Score=396.22  Aligned_cols=251  Identities=22%  Similarity=0.354  Sum_probs=231.1

Q ss_pred             ceeee---cCCCCCCCHHHHHHHHHhCCCCCccCCCccccccCCCCCCCCCCCCCccccCCCCeEEEeCCCCCHHHHHHH
Q psy11975        456 SHYFK---AHSSTSMPIQKRKSLLRKFPLWPELEPSTSELKRSDRPMSVGPRSVRPSEREWQADLLKPQKHTTTRATIDL  532 (786)
Q Consensus       456 ~Gvf~---agE~~sLT~dER~~Lle~~~~wve~~a~~~e~~~~~~~~~~~~r~v~veevaGRVPVIaGVGa~ST~EAIEL  532 (786)
                      .|++.   +||+++||.+||+++++.   ++                         ++++||+|||+||++.++++++++
T Consensus        37 ~Gi~v~GstGE~~~Ls~~Er~~~~~~---~~-------------------------~~~~~~~~vi~gv~~~st~~ai~~   88 (295)
T d1o5ka_          37 NALIVLGTTGESPTVNEDEREKLVSR---TL-------------------------EIVDGKIPVIVGAGTNSTEKTLKL   88 (295)
T ss_dssp             CEEEESSGGGTGGGCCHHHHHHHHHH---HH-------------------------HHHTTSSCEEEECCCSCHHHHHHH
T ss_pred             CEEEECeeccchhhCCHHHHHHHhhh---hc-------------------------cccccCCceEeecccccHHHHHHH
Confidence            35555   889999999999999998   44                         356789999999999999999999


Q ss_pred             HHHHHHcCCCEEEEcCCCCCCCCCCHHHHHHHHHHHHhcCCCCEEEEeCCCCcCCccCHHHHHHHH-hCCCEEEEEeC--
Q psy11975        533 TQKAAKAGANAALILCPYYFQKKMTEDLIYEHFISVADNSPIPVIIYNNTFVTNIDISVDTLVKLA-HHENIRGVKDT--  609 (786)
Q Consensus       533 Ar~Ae~aGADAVmViPPyY~kps~S~eeLv~YFraIAeAtdLPIiLYNiP~~TGv~LSpelL~rLA-eiPNVVGIKDS--  609 (786)
                      |++|+++|||++|++||+|++++  ++++++||++|++++++||++||+|..+|..++++++.+|+ ++|||+|+|++  
T Consensus        89 a~~A~~~Gad~v~v~pP~y~~~s--~~~i~~~~~~ia~a~~~pi~iYn~P~~~g~~~~~~~~~~l~~~~~ni~~iK~~~~  166 (295)
T d1o5ka_          89 VKQAEKLGANGVLVVTPYYNKPT--QEGLYQHYKYISERTDLGIVVYNVPGRTGVNVLPETAARIAADLKNVVGIKEANP  166 (295)
T ss_dssp             HHHHHHHTCSEEEEECCCSSCCC--HHHHHHHHHHHHTTCSSCEEEEECHHHHSCCCCHHHHHHHHHHCTTEEEEEECCC
T ss_pred             HHHHHHcCCCEEEEeCCCCCCCC--HHHHHHHHHHHHhccCCCeeEEeccchhcccchhHHHHHHHhhcccccceecCCc
Confidence            99999999999999999999987  99999999999999999999999999999999999999998 59999999999  


Q ss_pred             CHHHHHHHHhh--cCCCCEEEEeCCcchhhhhhccCCccccccccccccHHHHHHHHHHHcCCHHHHHHHHHHhhhhHHH
Q psy11975        610 DNIKLANMANQ--TKDLNFSVFAGSAGYLLSGLLVGCAGGINALSAVLGGPICELYDLAKAGKWEEAMKLQHRLVKPDVT  687 (786)
Q Consensus       610 Dl~ri~~ll~~--~~~~df~Vf~G~DelLL~aL~~GAdG~Isg~aN~~Pel~vaL~eA~~aGD~eeAreLQ~rL~pLi~~  687 (786)
                      |...+.++++.  ...+++.++.|.|.+++.++.+|++|++++.+|++|+.++++|+++++||+++|+++|+++.++++.
T Consensus       167 ~~~~~~~~~~~~~~~~~~~~v~~g~~~~~~~~~~~Ga~G~i~~~~n~~p~~~~~~~~~~~~g~~~~a~~l~~~l~~l~~~  246 (295)
T d1o5ka_         167 DIDQIDRTVSLTKQARSDFMVWSGNDDRTFYLLCAGGDGVISVVSNVAPKQMVELCAEYFSGNLEKSREVHRKLRPLMKA  246 (295)
T ss_dssp             CHHHHHHHHHHHHHHCTTCEEEESSGGGHHHHHHHTCCEEEESGGGTCHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHH
T ss_pred             chhhhhhHHHHhhhcCCcceeccccccchhhhhhcCCCcccccccccccchhhHHHHHHHcCCchHHHHHHHHHHHHHHH
Confidence            77766655431  2467899999999999999999999999999999999999999999999999999999999999987


Q ss_pred             HHhhhhccccCHHHHHHHHHHcCCCCCCCCCCCCCCCCHHHHHHHHHHHHHcCCC
Q psy11975        688 VRNVLLMKEMGVPGVRAAMELYGYYGGRSRRPLPAALKPGGAEKIKQVLTEAGFL  742 (786)
Q Consensus       688 l~~~~~~~~~~ia~lKaaL~lrGI~~G~vR~PL~~pLseeekaeL~~~L~~lGll  742 (786)
                      +     ...+++.++|++|+++|++.|.+|+|+. +|+++++++|+++|+++|++
T Consensus       247 ~-----~~~~~~~~~K~~l~~~G~~~g~~R~Pl~-~l~~~~~~~l~~~l~~~gll  295 (295)
T d1o5ka_         247 L-----FVETNPIPVKAALNLMGFIENELRLPLV-PASEKTVELLRNVLKESGLL  295 (295)
T ss_dssp             T-----TSSSTTHHHHHHHHHTTSSCCCCCTTCC-CCCHHHHHHHHHHHHHTTCC
T ss_pred             H-----HccCCHHHHHHHHHHcCCCCCCCCCCCC-CCCHHHHHHHHHHHHHcCCC
Confidence            6     4556678899999999999999999999 99999999999999999985
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2nlua1 b.34.9.2 (A:1-100) Hepatoma-derived growth factor, HDGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khca_ b.34.9.2 (A:) DNA methyltransferase DNMT3B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2daqa1 b.34.9.2 (A:8-104) Histone-lysine N-methyltransferase NSD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h3za_ b.34.9.2 (A:) Hypothetical protein SPBC215.07c {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d69a1 c.1.14.1 (A:134-424) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure