Psyllid ID: psy1202
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 136 | ||||||
| 312373543 | 425 | hypothetical protein AND_17307 [Anophele | 0.911 | 0.291 | 0.395 | 2e-19 | |
| 158288060 | 525 | AGAP011564-PA [Anopheles gambiae str. PE | 0.801 | 0.207 | 0.440 | 2e-19 | |
| 170054183 | 509 | UDP-glucuronosyltransferase 2C1 [Culex q | 0.801 | 0.214 | 0.449 | 3e-19 | |
| 270009828 | 424 | hypothetical protein TcasGA2_TC009142 [T | 0.926 | 0.297 | 0.380 | 4e-19 | |
| 189239024 | 493 | PREDICTED: similar to glucosyl/glucurono | 0.926 | 0.255 | 0.380 | 5e-19 | |
| 91089885 | 489 | PREDICTED: similar to AGAP007029-PA [Tri | 0.801 | 0.222 | 0.394 | 8e-19 | |
| 189235761 | 479 | PREDICTED: similar to glucosyl/glucurono | 0.948 | 0.269 | 0.379 | 1e-18 | |
| 270013655 | 1427 | hypothetical protein TcasGA2_TC012282 [T | 0.801 | 0.076 | 0.394 | 1e-18 | |
| 194754012 | 557 | GF12118 [Drosophila ananassae] gi|190620 | 0.801 | 0.195 | 0.385 | 2e-18 | |
| 189240668 | 454 | PREDICTED: similar to glucosyl/glucurono | 0.801 | 0.240 | 0.394 | 3e-18 |
| >gi|312373543|gb|EFR21259.1| hypothetical protein AND_17307 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
Score = 100 bits (249), Expect = 2e-19, Method: Compositional matrix adjust.
Identities = 49/124 (39%), Positives = 75/124 (60%)
Query: 4 GHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGD 63
GH N +LFITHGG+ S+ E++YHGVPV+ +P F DQ+ N E G GL+ P++ I+ +
Sbjct: 255 GHPNVRLFITHGGLLSTTESMYHGVPVIGIPVFGDQYLNMGKAERTGYGLLLPYKEISEE 314
Query: 64 ILYITIREVLNNPRYRDTVGRLSKQVRSLPYSNLDQAVRWAEHVAANKGVLGYTPAAQQT 123
L TI ++L++ YR +S + R P + LD AV W E+V +KG + A Q+
Sbjct: 315 RLATTIAKILSDSSYRTVAQSISARYRDQPQNPLDLAVFWVEYVIRHKGAVHLKSAGQEL 374
Query: 124 SVMR 127
++
Sbjct: 375 GFLQ 378
|
Source: Anopheles darlingi Species: Anopheles darlingi Genus: Anopheles Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|158288060|ref|XP_309943.4| AGAP011564-PA [Anopheles gambiae str. PEST] gi|157019292|gb|EAA05688.4| AGAP011564-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|170054183|ref|XP_001863009.1| UDP-glucuronosyltransferase 2C1 [Culex quinquefasciatus] gi|167874529|gb|EDS37912.1| UDP-glucuronosyltransferase 2C1 [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|270009828|gb|EFA06276.1| hypothetical protein TcasGA2_TC009142 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|189239024|ref|XP_974898.2| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|91089885|ref|XP_972090.1| PREDICTED: similar to AGAP007029-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|189235761|ref|XP_969321.2| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270013655|gb|EFA10103.1| hypothetical protein TcasGA2_TC012282 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|194754012|ref|XP_001959299.1| GF12118 [Drosophila ananassae] gi|190620597|gb|EDV36121.1| GF12118 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|189240668|ref|XP_972240.2| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 136 | ||||||
| ZFIN|ZDB-GENE-080721-22 | 532 | ugt2a3 "UDP glucuronosyltransf | 0.801 | 0.204 | 0.440 | 4.6e-19 | |
| ZFIN|ZDB-GENE-080721-23 | 533 | ugt2a4 "UDP glucuronosyltransf | 0.801 | 0.204 | 0.440 | 4.6e-19 | |
| ZFIN|ZDB-GENE-081104-3 | 529 | ugt2a6 "UDP glucuronosyltransf | 0.801 | 0.206 | 0.422 | 9.6e-19 | |
| UNIPROTKB|F1NMB3 | 518 | Gga.29991 "Uncharacterized pro | 0.860 | 0.225 | 0.418 | 1.2e-18 | |
| ZFIN|ZDB-GENE-080721-20 | 543 | ugt2a1 "UDP glucuronosyltransf | 0.801 | 0.200 | 0.431 | 2.2e-18 | |
| UNIPROTKB|E1BJU8 | 529 | UGT2B17 "Uncharacterized prote | 0.845 | 0.217 | 0.435 | 2.6e-18 | |
| ZFIN|ZDB-GENE-060929-796 | 532 | ugt2a5 "UDP glucuronosyltransf | 0.801 | 0.204 | 0.431 | 2.6e-18 | |
| FB|FBgn0040261 | 539 | Ugt36Bb "Ugt36Bb" [Drosophila | 0.808 | 0.204 | 0.436 | 2.7e-18 | |
| ZFIN|ZDB-GENE-061103-373 | 524 | ugt5a2 "UDP glucuronosyltransf | 0.801 | 0.208 | 0.422 | 3.3e-18 | |
| ZFIN|ZDB-GENE-080721-21 | 534 | ugt2a2 "UDP glucuronosyltransf | 0.801 | 0.204 | 0.422 | 3.4e-18 |
| ZFIN|ZDB-GENE-080721-22 ugt2a3 "UDP glucuronosyltransferase 2 family, polypeptide A3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 236 (88.1 bits), Expect = 4.6e-19, P = 4.6e-19
Identities = 48/109 (44%), Positives = 64/109 (58%)
Query: 4 GHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGD 63
GH K FITHGG + EA+YHGVP+V +P F+DQ N M+ KG ++ T+
Sbjct: 361 GHPKTKAFITHGGTNGLYEAIYHGVPMVGLPLFADQPDNLLHMKTKGAAVVLDINTLESK 420
Query: 64 ILYITIREVLNNPRYRDTVGRLSKQVRSLPYSNLDQAVRWAEHVAANKG 112
L ++ VLNNP Y++++ RLS+ P LDQAV W E V NKG
Sbjct: 421 DLVDALKTVLNNPSYKESIMRLSRIHHDQPMKPLDQAVYWIEFVMRNKG 469
|
|
| ZFIN|ZDB-GENE-080721-23 ugt2a4 "UDP glucuronosyltransferase 2 family, polypeptide A4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-081104-3 ugt2a6 "UDP glucuronosyltransferase 2 family, polypeptide A6" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NMB3 Gga.29991 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-080721-20 ugt2a1 "UDP glucuronosyltransferase 2 family, polypeptide A1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BJU8 UGT2B17 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060929-796 ugt2a5 "UDP glucuronosyltransferase 2 family, polypeptide A5" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0040261 Ugt36Bb "Ugt36Bb" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-061103-373 ugt5a2 "UDP glucuronosyltransferase 5 family, polypeptide A2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-080721-21 ugt2a2 "UDP glucuronosyltransferase 2 family, polypeptide A2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 136 | |||
| pfam00201 | 500 | pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosy | 9e-27 | |
| PHA03392 | 507 | PHA03392, egt, ecdysteroid UDP-glucosyltransferase | 1e-20 | |
| COG1819 | 406 | COG1819, COG1819, Glycosyl transferases, related t | 8e-17 | |
| TIGR01426 | 392 | TIGR01426, MGT, glycosyltransferase, MGT family | 5e-15 | |
| cd03784 | 401 | cd03784, GT1_Gtf_like, This family includes the Gt | 1e-10 | |
| PLN02152 | 455 | PLN02152, PLN02152, indole-3-acetate beta-glucosyl | 3e-08 | |
| PLN02173 | 449 | PLN02173, PLN02173, UDP-glucosyl transferase famil | 3e-06 | |
| PLN02448 | 459 | PLN02448, PLN02448, UDP-glycosyltransferase family | 6e-06 | |
| PLN02210 | 456 | PLN02210, PLN02210, UDP-glucosyl transferase | 6e-06 | |
| PLN02555 | 480 | PLN02555, PLN02555, limonoid glucosyltransferase | 8e-06 | |
| PLN00164 | 480 | PLN00164, PLN00164, glucosyltransferase; Provision | 2e-05 | |
| PLN02992 | 481 | PLN02992, PLN02992, coniferyl-alcohol glucosyltran | 8e-05 | |
| PLN02534 | 491 | PLN02534, PLN02534, UDP-glycosyltransferase | 1e-04 | |
| TIGR00661 | 321 | TIGR00661, MJ1255, conserved hypothetical protein | 3e-04 | |
| PLN03015 | 470 | PLN03015, PLN03015, UDP-glucosyl transferase | 3e-04 | |
| PLN03004 | 451 | PLN03004, PLN03004, UDP-glycosyltransferase | 4e-04 | |
| PLN02670 | 472 | PLN02670, PLN02670, transferase, transferring glyc | 4e-04 | |
| PLN02554 | 481 | PLN02554, PLN02554, UDP-glycosyltransferase family | 6e-04 | |
| pfam13528 | 317 | pfam13528, Glyco_trans_1_3, Glycosyl transferase f | 6e-04 | |
| COG0707 | 357 | COG0707, MurG, UDP-N-acetylglucosamine:LPS N-acety | 9e-04 | |
| PLN02207 | 468 | PLN02207, PLN02207, UDP-glycosyltransferase | 0.002 |
| >gnl|CDD|201077 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosyl transferase | Back alignment and domain information |
|---|
Score = 103 bits (258), Expect = 9e-27
Identities = 47/118 (39%), Positives = 64/118 (54%)
Query: 4 GHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGD 63
GH + F+TH G + EA+ HGVP+V MP F DQ N K ME KG + T+T +
Sbjct: 338 GHPKTRAFVTHAGSNGVYEAICHGVPMVGMPLFGDQMDNAKHMEAKGAAVTLNVLTMTSE 397
Query: 64 ILYITIREVLNNPRYRDTVGRLSKQVRSLPYSNLDQAVRWAEHVAANKGVLGYTPAAQ 121
L ++ V+N+P Y++ + RLS P LD+AV W E V +KG PAA
Sbjct: 398 DLLNALKTVINDPSYKENIMRLSSIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRPAAH 455
|
Length = 500 |
| >gnl|CDD|223071 PHA03392, egt, ecdysteroid UDP-glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224732 COG1819, COG1819, Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|233407 TIGR01426, MGT, glycosyltransferase, MGT family | Back alignment and domain information |
|---|
| >gnl|CDD|99960 cd03784, GT1_Gtf_like, This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin | Back alignment and domain information |
|---|
| >gnl|CDD|177813 PLN02152, PLN02152, indole-3-acetate beta-glucosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|177830 PLN02173, PLN02173, UDP-glucosyl transferase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|215247 PLN02448, PLN02448, UDP-glycosyltransferase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|215127 PLN02210, PLN02210, UDP-glucosyl transferase | Back alignment and domain information |
|---|
| >gnl|CDD|178170 PLN02555, PLN02555, limonoid glucosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|215084 PLN00164, PLN00164, glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178572 PLN02992, PLN02992, coniferyl-alcohol glucosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|215293 PLN02534, PLN02534, UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|233077 TIGR00661, MJ1255, conserved hypothetical protein | Back alignment and domain information |
|---|
| >gnl|CDD|178589 PLN03015, PLN03015, UDP-glucosyl transferase | Back alignment and domain information |
|---|
| >gnl|CDD|178581 PLN03004, PLN03004, UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|178275 PLN02670, PLN02670, transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >gnl|CDD|215304 PLN02554, PLN02554, UDP-glycosyltransferase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|222200 pfam13528, Glyco_trans_1_3, Glycosyl transferase family 1 | Back alignment and domain information |
|---|
| >gnl|CDD|223779 COG0707, MurG, UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|177857 PLN02207, PLN02207, UDP-glycosyltransferase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| PF00201 | 500 | UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera | 100.0 | |
| PHA03392 | 507 | egt ecdysteroid UDP-glucosyltransferase; Provision | 100.0 | |
| KOG1192|consensus | 496 | 99.94 | ||
| PLN02670 | 472 | transferase, transferring glycosyl groups | 99.9 | |
| PLN02554 | 481 | UDP-glycosyltransferase family protein | 99.89 | |
| PLN02208 | 442 | glycosyltransferase family protein | 99.89 | |
| PLN02562 | 448 | UDP-glycosyltransferase | 99.88 | |
| PLN02207 | 468 | UDP-glycosyltransferase | 99.87 | |
| PLN02410 | 451 | UDP-glucoronosyl/UDP-glucosyl transferase family p | 99.87 | |
| COG1819 | 406 | Glycosyl transferases, related to UDP-glucuronosyl | 99.86 | |
| PLN02764 | 453 | glycosyltransferase family protein | 99.86 | |
| PLN00414 | 446 | glycosyltransferase family protein | 99.86 | |
| PLN02210 | 456 | UDP-glucosyl transferase | 99.86 | |
| PLN02167 | 475 | UDP-glycosyltransferase family protein | 99.86 | |
| PLN03004 | 451 | UDP-glycosyltransferase | 99.85 | |
| PLN02555 | 480 | limonoid glucosyltransferase | 99.85 | |
| PLN02992 | 481 | coniferyl-alcohol glucosyltransferase | 99.85 | |
| PLN03007 | 482 | UDP-glucosyltransferase family protein | 99.84 | |
| PLN00164 | 480 | glucosyltransferase; Provisional | 99.84 | |
| PLN02863 | 477 | UDP-glucoronosyl/UDP-glucosyl transferase family p | 99.84 | |
| PLN02448 | 459 | UDP-glycosyltransferase family protein | 99.84 | |
| PLN02173 | 449 | UDP-glucosyl transferase family protein | 99.84 | |
| PLN02152 | 455 | indole-3-acetate beta-glucosyltransferase | 99.83 | |
| TIGR01426 | 392 | MGT glycosyltransferase, MGT family. This model de | 99.82 | |
| PLN03015 | 470 | UDP-glucosyl transferase | 99.81 | |
| cd03784 | 401 | GT1_Gtf_like This family includes the Gtfs, a grou | 99.8 | |
| PLN02534 | 491 | UDP-glycosyltransferase | 99.8 | |
| COG0707 | 357 | MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami | 99.59 | |
| PF04101 | 167 | Glyco_tran_28_C: Glycosyltransferase family 28 C-t | 99.55 | |
| PRK12446 | 352 | undecaprenyldiphospho-muramoylpentapeptide beta-N- | 99.55 | |
| PRK00726 | 357 | murG undecaprenyldiphospho-muramoylpentapeptide be | 99.52 | |
| PF13528 | 318 | Glyco_trans_1_3: Glycosyl transferase family 1 | 99.43 | |
| TIGR00661 | 321 | MJ1255 conserved hypothetical protein. This model | 99.39 | |
| TIGR01133 | 348 | murG undecaprenyldiphospho-muramoylpentapeptide be | 99.31 | |
| PRK13608 | 391 | diacylglycerol glucosyltransferase; Provisional | 99.31 | |
| cd03785 | 350 | GT1_MurG MurG is an N-acetylglucosaminyltransferas | 99.27 | |
| PLN02605 | 382 | monogalactosyldiacylglycerol synthase | 99.24 | |
| PRK13609 | 380 | diacylglycerol glucosyltransferase; Provisional | 99.18 | |
| COG1519 | 419 | KdtA 3-deoxy-D-manno-octulosonic-acid transferase | 99.03 | |
| TIGR03492 | 396 | conserved hypothetical protein. This protein famil | 99.01 | |
| COG4671 | 400 | Predicted glycosyl transferase [General function p | 98.89 | |
| PRK00025 | 380 | lpxB lipid-A-disaccharide synthase; Reviewed | 98.89 | |
| PRK05749 | 425 | 3-deoxy-D-manno-octulosonic-acid transferase; Revi | 98.87 | |
| TIGR00215 | 385 | lpxB lipid-A-disaccharide synthase. Lipid-A precur | 98.78 | |
| KOG3349|consensus | 170 | 98.46 | ||
| cd03814 | 364 | GT1_like_2 This family is most closely related to | 98.33 | |
| TIGR00236 | 365 | wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras | 98.3 | |
| PRK14089 | 347 | ipid-A-disaccharide synthase; Provisional | 98.12 | |
| PF00534 | 172 | Glycos_transf_1: Glycosyl transferases group 1; In | 98.1 | |
| cd03820 | 348 | GT1_amsD_like This family is most closely related | 98.06 | |
| cd03786 | 363 | GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th | 98.01 | |
| cd05844 | 367 | GT1_like_7 Glycosyltransferases catalyze the trans | 97.99 | |
| COG5017 | 161 | Uncharacterized conserved protein [Function unknow | 97.98 | |
| cd03801 | 374 | GT1_YqgM_like This family is most closely related | 97.98 | |
| PF13524 | 92 | Glyco_trans_1_2: Glycosyl transferases group 1 | 97.97 | |
| COG3980 | 318 | spsG Spore coat polysaccharide biosynthesis protei | 97.96 | |
| cd03808 | 359 | GT1_cap1E_like This family is most closely related | 97.95 | |
| cd03823 | 359 | GT1_ExpE7_like This family is most closely related | 97.95 | |
| cd03794 | 394 | GT1_wbuB_like This family is most closely related | 97.94 | |
| cd03822 | 366 | GT1_ecORF704_like This family is most closely rela | 97.88 | |
| cd03807 | 365 | GT1_WbnK_like This family is most closely related | 97.86 | |
| cd03821 | 375 | GT1_Bme6_like This family is most closely related | 97.85 | |
| TIGR03088 | 374 | stp2 sugar transferase, PEP-CTERM/EpsH1 system ass | 97.84 | |
| TIGR03087 | 397 | stp1 sugar transferase, PEP-CTERM/EpsH1 system ass | 97.84 | |
| cd03795 | 357 | GT1_like_4 This family is most closely related to | 97.83 | |
| cd04962 | 371 | GT1_like_5 This family is most closely related to | 97.83 | |
| TIGR02149 | 388 | glgA_Coryne glycogen synthase, Corynebacterium fam | 97.83 | |
| PRK15427 | 406 | colanic acid biosynthesis glycosyltransferase WcaL | 97.83 | |
| cd04946 | 407 | GT1_AmsK_like This family is most closely related | 97.78 | |
| TIGR02472 | 439 | sucr_P_syn_N sucrose-phosphate synthase, putative, | 97.74 | |
| cd03800 | 398 | GT1_Sucrose_synthase This family is most closely r | 97.71 | |
| TIGR03449 | 405 | mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino | 97.7 | |
| cd03817 | 374 | GT1_UGDG_like This family is most closely related | 97.67 | |
| cd03818 | 396 | GT1_ExpC_like This family is most closely related | 97.67 | |
| PRK15484 | 380 | lipopolysaccharide 1,2-N-acetylglucosaminetransfer | 97.63 | |
| cd03825 | 365 | GT1_wcfI_like This family is most closely related | 97.63 | |
| cd03792 | 372 | GT1_Trehalose_phosphorylase Trehalose phosphorylas | 97.62 | |
| cd03798 | 377 | GT1_wlbH_like This family is most closely related | 97.55 | |
| PLN02871 | 465 | UDP-sulfoquinovose:DAG sulfoquinovosyltransferase | 97.54 | |
| cd03799 | 355 | GT1_amsK_like This is a family of GT1 glycosyltran | 97.5 | |
| cd04951 | 360 | GT1_WbdM_like This family is most closely related | 97.49 | |
| cd03816 | 415 | GT1_ALG1_like This family is most closely related | 97.44 | |
| cd03813 | 475 | GT1_like_3 This family is most closely related to | 97.35 | |
| cd04949 | 372 | GT1_gtfA_like This family is most closely related | 97.34 | |
| PRK09922 | 359 | UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D | 97.3 | |
| cd03812 | 358 | GT1_CapH_like This family is most closely related | 97.3 | |
| PF13844 | 468 | Glyco_transf_41: Glycosyl transferase family 41; P | 97.29 | |
| cd03819 | 355 | GT1_WavL_like This family is most closely related | 97.23 | |
| PRK10307 | 412 | putative glycosyl transferase; Provisional | 97.22 | |
| cd03811 | 353 | GT1_WabH_like This family is most closely related | 97.07 | |
| TIGR03590 | 279 | PseG pseudaminic acid biosynthesis-associated prot | 97.04 | |
| cd03809 | 365 | GT1_mtfB_like This family is most closely related | 97.03 | |
| cd03804 | 351 | GT1_wbaZ_like This family is most closely related | 96.86 | |
| cd03805 | 392 | GT1_ALG2_like This family is most closely related | 96.82 | |
| TIGR02468 | 1050 | sucrsPsyn_pln sucrose phosphate synthase/possible | 96.78 | |
| cd04955 | 363 | GT1_like_6 This family is most closely related to | 96.7 | |
| PHA01630 | 331 | putative group 1 glycosyl transferase | 96.56 | |
| COG0381 | 383 | WecB UDP-N-acetylglucosamine 2-epimerase [Cell env | 96.54 | |
| PRK09814 | 333 | beta-1,6-galactofuranosyltransferase; Provisional | 96.49 | |
| PRK10017 | 426 | colanic acid biosynthesis protein; Provisional | 96.43 | |
| PF02350 | 346 | Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; | 96.41 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 96.37 | |
| cd03796 | 398 | GT1_PIG-A_like This family is most closely related | 96.31 | |
| PLN00142 | 815 | sucrose synthase | 96.27 | |
| PF04007 | 335 | DUF354: Protein of unknown function (DUF354); Inte | 96.27 | |
| TIGR02470 | 784 | sucr_synth sucrose synthase. This model represents | 96.22 | |
| TIGR02918 | 500 | accessory Sec system glycosylation protein GtfA. M | 96.12 | |
| PHA01633 | 335 | putative glycosyl transferase group 1 | 96.01 | |
| TIGR03713 | 519 | acc_sec_asp1 accessory Sec system protein Asp1. Th | 95.97 | |
| PRK15490 | 578 | Vi polysaccharide biosynthesis protein TviE; Provi | 95.89 | |
| PRK01021 | 608 | lpxB lipid-A-disaccharide synthase; Reviewed | 95.84 | |
| TIGR02095 | 473 | glgA glycogen/starch synthases, ADP-glucose type. | 95.76 | |
| cd03791 | 476 | GT1_Glycogen_synthase_DULL1_like This family is mo | 95.75 | |
| PLN02275 | 371 | transferase, transferring glycosyl groups | 95.67 | |
| PF13692 | 135 | Glyco_trans_1_4: Glycosyl transferases group 1; PD | 95.58 | |
| PLN02846 | 462 | digalactosyldiacylglycerol synthase | 95.45 | |
| PLN02949 | 463 | transferase, transferring glycosyl groups | 95.44 | |
| TIGR03568 | 365 | NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, | 95.44 | |
| PRK00654 | 466 | glgA glycogen synthase; Provisional | 95.32 | |
| PF02684 | 373 | LpxB: Lipid-A-disaccharide synthetase; InterPro: I | 95.2 | |
| cd04950 | 373 | GT1_like_1 Glycosyltransferases catalyze the trans | 94.9 | |
| COG0763 | 381 | LpxB Lipid A disaccharide synthetase [Cell envelop | 94.61 | |
| cd03806 | 419 | GT1_ALG11_like This family is most closely related | 94.43 | |
| cd03802 | 335 | GT1_AviGT4_like This family is most closely relate | 94.3 | |
| TIGR02400 | 456 | trehalose_OtsA alpha,alpha-trehalose-phosphate syn | 94.25 | |
| PRK14099 | 485 | glycogen synthase; Provisional | 94.08 | |
| PLN02501 | 794 | digalactosyldiacylglycerol synthase | 94.05 | |
| PF04464 | 369 | Glyphos_transf: CDP-Glycerol:Poly(glycerophosphate | 93.29 | |
| PRK10125 | 405 | putative glycosyl transferase; Provisional | 93.14 | |
| KOG0853|consensus | 495 | 92.35 | ||
| cd03788 | 460 | GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a | 92.19 | |
| COG0438 | 381 | RfaG Glycosyltransferase [Cell envelope biogenesis | 91.93 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 91.83 | |
| PRK14098 | 489 | glycogen synthase; Provisional | 91.49 | |
| PRK04885 | 265 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 91.32 | |
| COG4370 | 412 | Uncharacterized protein conserved in bacteria [Fun | 91.23 | |
| cd01635 | 229 | Glycosyltransferase_GTB_type Glycosyltransferases | 91.03 | |
| PRK02649 | 305 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 90.9 | |
| PRK02155 | 291 | ppnK NAD(+)/NADH kinase family protein; Provisiona | 90.18 | |
| KOG4626|consensus | 966 | 89.99 | ||
| PRK14077 | 287 | pnk inorganic polyphosphate/ATP-NAD kinase; Provis | 89.68 | |
| cd03793 | 590 | GT1_Glycogen_synthase_GSY2_like Glycogen synthase, | 89.29 | |
| PRK01911 | 292 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 89.21 | |
| PLN02316 | 1036 | synthase/transferase | 88.92 | |
| PRK03372 | 306 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 88.8 | |
| PRK04539 | 296 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 88.37 | |
| TIGR02919 | 438 | accessory Sec system glycosyltransferase GtfB. Mem | 88.1 | |
| PRK03501 | 264 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 88.04 | |
| PLN03063 | 797 | alpha,alpha-trehalose-phosphate synthase (UDP-form | 87.88 | |
| PRK01185 | 271 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 87.88 | |
| PRK03378 | 292 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 87.86 | |
| PRK14075 | 256 | pnk inorganic polyphosphate/ATP-NAD kinase; Provis | 87.67 | |
| PRK02231 | 272 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 86.35 | |
| COG1817 | 346 | Uncharacterized protein conserved in archaea [Func | 86.12 | |
| PLN02935 | 508 | Bifunctional NADH kinase/NAD(+) kinase | 86.09 | |
| PRK03708 | 277 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 86.01 | |
| PRK01231 | 295 | ppnK inorganic polyphosphate/ATP-NAD kinase; Provi | 85.49 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 84.89 | |
| PRK14076 | 569 | pnk inorganic polyphosphate/ATP-NAD kinase; Provis | 84.36 | |
| PF06506 | 176 | PrpR_N: Propionate catabolism activator; InterPro: | 81.77 | |
| PLN02727 | 986 | NAD kinase | 80.75 | |
| PLN02929 | 301 | NADH kinase | 80.44 |
| >PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.6e-39 Score=252.75 Aligned_cols=134 Identities=40% Similarity=0.609 Sum_probs=82.4
Q ss_pred CCCCCCCccEEEeCCChhHHHHHHHhCCCEEeecCCcChHHHHHHHHHcCceeEcCCCCCCHHHHHHHHHHHhcChHHHH
Q psy1202 1 MPTGHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGDILYITIREVLNNPRYRD 80 (136)
Q Consensus 1 ~~L~h~~~~~~I~hgG~~s~~Eal~~g~P~i~~P~~~dq~~na~~~~~~G~g~~l~~~~~~~~~l~~~i~~ll~~~~~~~ 80 (136)
+||+||++++||||||.||+.||+++|||+|++|+++||..||+++++.|+|+.++.++++.+++.++|+++++|++|++
T Consensus 335 ~lL~hp~v~~fitHgG~~s~~Ea~~~gvP~l~~P~~~DQ~~na~~~~~~G~g~~l~~~~~~~~~l~~ai~~vl~~~~y~~ 414 (500)
T PF00201_consen 335 DLLAHPRVKLFITHGGLNSTQEALYHGVPMLGIPLFGDQPRNAARVEEKGVGVVLDKNDLTEEELRAAIREVLENPSYKE 414 (500)
T ss_dssp HHHTSTTEEEEEES--HHHHHHHHHCT--EEE-GCSTTHHHHHHHHHHTTSEEEEGGGC-SHHHHHHHHHHHHHSHHHHH
T ss_pred hhhhcccceeeeeccccchhhhhhhccCCccCCCCcccCCccceEEEEEeeEEEEEecCCcHHHHHHHHHHHHhhhHHHH
Confidence 37899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHhcCCCChHHHHHHHHHHHHHcCCCCCCcccccCCChhhhhccCCC
Q psy1202 81 TVGRLSKQVRSLPYSNLDQAVRWAEHVAANKGVLGYTPAAQQTSVMRLLEGPRF 134 (136)
Q Consensus 81 ~~~~~~~~~~~~~~~~~~~~~~~ie~~~~~~~~~~l~~~~~~~~~~~~~~~d~~ 134 (136)
+++++++.++++|.+|.+++++|||+++++++.+||++.+.++||||||++||+
T Consensus 415 ~a~~ls~~~~~~p~~p~~~~~~~ie~v~~~~~~~~l~~~~~~l~~~~~~~lDv~ 468 (500)
T PF00201_consen 415 NAKRLSSLFRDRPISPLERAVWWIEYVARHGGAPHLRSPARDLSFYQYYLLDVI 468 (500)
T ss_dssp HHHHHHHTTT--------------------------------------------
T ss_pred HHHHHHHHHhcCCCCHHHHHHHHHHHHHhcCCCcccCChhhcCCHHHHHHHHHH
Confidence 999999999999999999999999999999999999999999999999999996
|
This family currently consist of: Mammalian UDP-glucuronosyl transferases (2.4.1.17 from EC) (UDPGT) []. A large family of membrane-bound microsomal enzymes which catalyze the transfer of glucuronic acid to a wide variety of exogenous and endogenous lipophilic substrates. These enzymes are of major importance in the detoxification and subsequent elimination of xenobiotics such as drugs and carcinogens. A large number of putative UDPGT from Caenorhabditis elegans. Mammalian 2-hydroxyacylsphingosine 1-beta-galactosyltransferase [] (2.4.1.45 from EC) (also known as UDP-galactose-ceramide galactosyltransferase). This enzyme catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system. Plants flavonol O(3)-glucosyltransferase (2.4.1.91 from EC). An enzyme [] that catalyzes the transfer of glucose from UDP-glucose to a flavanol. This reaction is essential and one of the last steps in anthocyanin pigment biosynthesis. Baculoviruses ecdysteroid UDP-glucosyltransferase (2.4.1 from EC) [] (egt). This enzyme catalyzes the transfer of glucose from UDP-glucose to ectysteroids which are insect molting hormones. The expression of egt in the insect host interferes with the normal insect development by blocking the molting process. Prokaryotic zeaxanthin glucosyltransferase (2.4.1 from EC) (gene crtX), an enzyme involved in carotenoid biosynthesis and that catalyses the glycosylation reaction which converts zeaxanthin to zeaxanthin-beta-diglucoside. Streptomyces macrolide glycosyltransferases (2.4.1 from EC) []. These enzymes specifically inactivates macrolide anitibiotics via 2'-O-glycosylation using UDP-glucose. These enzymes share a conserved domain of about 50 amino acid residues located in their C-terminal section.; GO: 0016758 transferase activity, transferring hexosyl groups, 0008152 metabolic process; PDB: 3HBJ_A 3HBF_A 2PQ6_A 3IA7_B 3RSC_A 3IAA_B 2IYA_A 2IYF_B 2O6L_A 2VCH_A .... |
| >PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1192|consensus | Back alignment and domain information |
|---|
| >PLN02670 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PLN02554 UDP-glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN02208 glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN02562 UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >PLN02207 UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein | Back alignment and domain information |
|---|
| >COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02764 glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN00414 glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN02210 UDP-glucosyl transferase | Back alignment and domain information |
|---|
| >PLN02167 UDP-glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN03004 UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >PLN02555 limonoid glucosyltransferase | Back alignment and domain information |
|---|
| >PLN02992 coniferyl-alcohol glucosyltransferase | Back alignment and domain information |
|---|
| >PLN03007 UDP-glucosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN00164 glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein | Back alignment and domain information |
|---|
| >PLN02448 UDP-glycosyltransferase family protein | Back alignment and domain information |
|---|
| >PLN02173 UDP-glucosyl transferase family protein | Back alignment and domain information |
|---|
| >PLN02152 indole-3-acetate beta-glucosyltransferase | Back alignment and domain information |
|---|
| >TIGR01426 MGT glycosyltransferase, MGT family | Back alignment and domain information |
|---|
| >PLN03015 UDP-glucosyl transferase | Back alignment and domain information |
|---|
| >cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin | Back alignment and domain information |
|---|
| >PLN02534 UDP-glycosyltransferase | Back alignment and domain information |
|---|
| >COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 | Back alignment and domain information |
|---|
| >TIGR00661 MJ1255 conserved hypothetical protein | Back alignment and domain information |
|---|
| >TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase | Back alignment and domain information |
|---|
| >PRK13608 diacylglycerol glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis | Back alignment and domain information |
|---|
| >PLN02605 monogalactosyldiacylglycerol synthase | Back alignment and domain information |
|---|
| >PRK13609 diacylglycerol glucosyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR03492 conserved hypothetical protein | Back alignment and domain information |
|---|
| >COG4671 Predicted glycosyl transferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00215 lpxB lipid-A-disaccharide synthase | Back alignment and domain information |
|---|
| >KOG3349|consensus | Back alignment and domain information |
|---|
| >cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase | Back alignment and domain information |
|---|
| >PRK14089 ipid-A-disaccharide synthase; Provisional | Back alignment and domain information |
|---|
| >PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) | Back alignment and domain information |
|---|
| >cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds | Back alignment and domain information |
|---|
| >COG5017 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known | Back alignment and domain information |
|---|
| >PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 | Back alignment and domain information |
|---|
| >COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated | Back alignment and domain information |
|---|
| >TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated | Back alignment and domain information |
|---|
| >cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family | Back alignment and domain information |
|---|
| >PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional | Back alignment and domain information |
|---|
| >cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain | Back alignment and domain information |
|---|
| >cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase | Back alignment and domain information |
|---|
| >cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional | Back alignment and domain information |
|---|
| >cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose | Back alignment and domain information |
|---|
| >cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase | Back alignment and domain information |
|---|
| >cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria | Back alignment and domain information |
|---|
| >cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli | Back alignment and domain information |
|---|
| >cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding | Back alignment and domain information |
|---|
| >PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A | Back alignment and domain information |
|---|
| >cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PRK10307 putative glycosyl transferase; Provisional | Back alignment and domain information |
|---|
| >cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG | Back alignment and domain information |
|---|
| >cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant | Back alignment and domain information |
|---|
| >cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PHA01630 putative group 1 glycosyl transferase | Back alignment and domain information |
|---|
| >COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK09814 beta-1,6-galactofuranosyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10017 colanic acid biosynthesis protein; Provisional | Back alignment and domain information |
|---|
| >PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PLN00142 sucrose synthase | Back alignment and domain information |
|---|
| >PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length | Back alignment and domain information |
|---|
| >TIGR02470 sucr_synth sucrose synthase | Back alignment and domain information |
|---|
| >TIGR02918 accessory Sec system glycosylation protein GtfA | Back alignment and domain information |
|---|
| >PHA01633 putative glycosyl transferase group 1 | Back alignment and domain information |
|---|
| >TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 | Back alignment and domain information |
|---|
| >PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02095 glgA glycogen/starch synthases, ADP-glucose type | Back alignment and domain information |
|---|
| >cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >PLN02275 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A | Back alignment and domain information |
|---|
| >PLN02846 digalactosyldiacylglycerol synthase | Back alignment and domain information |
|---|
| >PLN02949 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing | Back alignment and domain information |
|---|
| >PRK00654 glgA glycogen synthase; Provisional | Back alignment and domain information |
|---|
| >PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases | Back alignment and domain information |
|---|
| >cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds | Back alignment and domain information |
|---|
| >COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases | Back alignment and domain information |
|---|
| >TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] | Back alignment and domain information |
|---|
| >PRK14099 glycogen synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02501 digalactosyldiacylglycerol synthase | Back alignment and domain information |
|---|
| >PF04464 Glyphos_transf: CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase ; InterPro: IPR007554 Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of Gram-positive bacteria | Back alignment and domain information |
|---|
| >PRK10125 putative glycosyl transferase; Provisional | Back alignment and domain information |
|---|
| >KOG0853|consensus | Back alignment and domain information |
|---|
| >cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor | Back alignment and domain information |
|---|
| >COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14098 glycogen synthase; Provisional | Back alignment and domain information |
|---|
| >PRK04885 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >COG4370 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds | Back alignment and domain information |
|---|
| >PRK02649 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK02155 ppnK NAD(+)/NADH kinase family protein; Provisional | Back alignment and domain information |
|---|
| >KOG4626|consensus | Back alignment and domain information |
|---|
| >PRK14077 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >cd03793 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, which is most closely related to the GT1 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis | Back alignment and domain information |
|---|
| >PRK01911 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02316 synthase/transferase | Back alignment and domain information |
|---|
| >PRK03372 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04539 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02919 accessory Sec system glycosyltransferase GtfB | Back alignment and domain information |
|---|
| >PRK03501 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional | Back alignment and domain information |
|---|
| >PRK01185 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03378 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14075 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK02231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >COG1817 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >PLN02935 Bifunctional NADH kinase/NAD(+) kinase | Back alignment and domain information |
|---|
| >PRK03708 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PRK01231 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >PRK14076 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional | Back alignment and domain information |
|---|
| >PF06506 PrpR_N: Propionate catabolism activator; InterPro: IPR010524 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
| >PLN02929 NADH kinase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 136 | ||||
| 2o6l_A | 170 | Crystal Structure Of The Udp-Glucuronic Acid Bindin | 2e-12 | ||
| 2iya_A | 424 | The Crystal Structure Of Macrolide Glycosyltransfer | 6e-07 | ||
| 2yjn_A | 441 | Structure Of The Glycosyltransferase Eryciii From T | 9e-07 | ||
| 3tsa_A | 391 | Spinosyn Rhamnosyltransferase Spng Length = 391 | 7e-06 | ||
| 3uyk_A | 387 | Spinosyn Rhamnosyltransferase Spng Complexed With S | 1e-05 | ||
| 3d0r_A | 398 | Crystal Structure Of Calg3 From Micromonospora Echi | 7e-05 | ||
| 3iaa_A | 416 | Crystal Structure Of Calg2, Calicheamicin Glycosylt | 1e-04 | ||
| 3rsc_A | 415 | Crystal Structure Of Calg2, Calicheamicin Glycosylt | 1e-04 | ||
| 2iyf_A | 430 | The Crystal Structure Of Macrolide Glycosyltransfer | 4e-04 | ||
| 3d0q_A | 398 | Crystal Structure Of Calg3 From Micromonospora Echi | 5e-04 | ||
| 2c1x_A | 456 | Structure And Activity Of A Flavonoid 3-O Glucosylt | 7e-04 | ||
| 3hbf_A | 454 | Structure Of Ugt78g1 Complexed With Myricetin And U | 8e-04 | ||
| 2acv_A | 463 | Crystal Structure Of Medicago Truncatula Ugt71g1 Le | 9e-04 | ||
| 2acw_A | 465 | Crystal Structure Of Medicago Truncatula Ugt71g1 Co | 9e-04 |
| >pdb|2O6L|A Chain A, Crystal Structure Of The Udp-Glucuronic Acid Binding Domain Of The Human Drug Metabolizing Udp-Glucuronosyltransferase 2b7 Length = 170 | Back alignment and structure |
|
| >pdb|2IYA|A Chain A, The Crystal Structure Of Macrolide Glycosyltransferases: A Blueprint For Antibiotic Engineering Length = 424 | Back alignment and structure |
| >pdb|2YJN|A Chain A, Structure Of The Glycosyltransferase Eryciii From The Erythromycin Biosynthetic Pathway, In Complex With Its Activating Partner, Erycii Length = 441 | Back alignment and structure |
| >pdb|3TSA|A Chain A, Spinosyn Rhamnosyltransferase Spng Length = 391 | Back alignment and structure |
| >pdb|3UYK|A Chain A, Spinosyn Rhamnosyltransferase Spng Complexed With Spinosyn Aglycone Length = 387 | Back alignment and structure |
| >pdb|3D0R|A Chain A, Crystal Structure Of Calg3 From Micromonospora Echinospora Determined In Space Group P2(1) Length = 398 | Back alignment and structure |
| >pdb|3IAA|A Chain A, Crystal Structure Of Calg2, Calicheamicin Glycosyltransferase, Tdp Bound Form Length = 416 | Back alignment and structure |
| >pdb|3RSC|A Chain A, Crystal Structure Of Calg2, Calicheamicin Glycosyltransferase, Tdp And Calicheamicin T0 Bound Form Length = 415 | Back alignment and structure |
| >pdb|2IYF|A Chain A, The Crystal Structure Of Macrolide Glycosyltransferases: A Blueprint For Antibiotic Engineering Length = 430 | Back alignment and structure |
| >pdb|3D0Q|A Chain A, Crystal Structure Of Calg3 From Micromonospora Echinospora Determined In Space Group I222 Length = 398 | Back alignment and structure |
| >pdb|2C1X|A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification Length = 456 | Back alignment and structure |
| >pdb|3HBF|A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp Length = 454 | Back alignment and structure |
| >pdb|2ACV|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Length = 463 | Back alignment and structure |
| >pdb|2ACW|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose Length = 465 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 136 | |||
| 2o6l_A | 170 | UDP-glucuronosyltransferase 2B7; drug metabolism, | 5e-39 | |
| 2iya_A | 424 | OLEI, oleandomycin glycosyltransferase; carbohydra | 5e-31 | |
| 2iyf_A | 430 | OLED, oleandomycin glycosyltransferase; antibiotic | 6e-30 | |
| 3ia7_A | 402 | CALG4; glycosysltransferase, calicheamicin, enediy | 2e-27 | |
| 3rsc_A | 415 | CALG2; TDP, enediyne, structural genomics, PSI-2, | 4e-25 | |
| 2yjn_A | 441 | ERYCIII, glycosyltransferase; transferase, cytochr | 1e-21 | |
| 3otg_A | 412 | CALG1; calicheamicin, TDP, structural genomics, PS | 2e-21 | |
| 2p6p_A | 384 | Glycosyl transferase; X-RAY-diffraction,urdamycina | 1e-20 | |
| 3tsa_A | 391 | SPNG, NDP-rhamnosyltransferase; glycosyltransferas | 2e-19 | |
| 4fzr_A | 398 | SSFS6; structural genomics, PSI-biology, protein s | 1e-18 | |
| 3oti_A | 398 | CALG3; calicheamicin, TDP, structural genomics, PS | 1e-16 | |
| 1iir_A | 415 | Glycosyltransferase GTFB; rossmann fold; 1.80A {Am | 4e-14 | |
| 3h4t_A | 404 | Glycosyltransferase GTFA, glycosyltransferase; van | 6e-14 | |
| 1rrv_A | 416 | Glycosyltransferase GTFD; GT-B, glycosyltransferas | 9e-13 | |
| 2c1x_A | 456 | UDP-glucose flavonoid 3-O glycosyltransferase; WIN | 9e-11 | |
| 3hbf_A | 454 | Flavonoid 3-O-glucosyltransferase; glycosyltransfe | 3e-10 | |
| 2pq6_A | 482 | UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl | 4e-10 | |
| 2vch_A | 480 | Hydroquinone glucosyltransferase; glycosyltransfer | 1e-09 | |
| 2acv_A | 463 | Triterpene UDP-glucosyl transferase UGT71G1; glyco | 1e-09 |
| >2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
Score = 128 bits (324), Expect = 5e-39
Identities = 31/87 (35%), Positives = 51/87 (58%)
Query: 4 GHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEKGMGLITPHETITGD 63
GH + FITHGG + EA+YHG+P+V +P F+DQ N M+ +G + T++
Sbjct: 83 GHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTMSST 142
Query: 64 ILYITIREVLNNPRYRDTVGRLSKQVR 90
L ++ V+N+P Y++ V +LS+
Sbjct: 143 DLLNALKRVINDPSYKENVMKLSRIQH 169
|
| >2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Length = 424 | Back alignment and structure |
|---|
| >2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 | Back alignment and structure |
|---|
| >3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Length = 402 | Back alignment and structure |
|---|
| >3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Length = 415 | Back alignment and structure |
|---|
| >2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 441 | Back alignment and structure |
|---|
| >3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Length = 412 | Back alignment and structure |
|---|
| >2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Length = 384 | Back alignment and structure |
|---|
| >3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Length = 391 | Back alignment and structure |
|---|
| >4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Length = 398 | Back alignment and structure |
|---|
| >3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Length = 398 | Back alignment and structure |
|---|
| >1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 415 | Back alignment and structure |
|---|
| >3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} PDB: 3h4i_A* 1pn3_A* 1pnv_A* Length = 404 | Back alignment and structure |
|---|
| >1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 416 | Back alignment and structure |
|---|
| >2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Length = 456 | Back alignment and structure |
|---|
| >3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} PDB: 3hbj_A* Length = 454 | Back alignment and structure |
|---|
| >2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Length = 482 | Back alignment and structure |
|---|
| >2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Length = 480 | Back alignment and structure |
|---|
| >2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Length = 463 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| 2vch_A | 480 | Hydroquinone glucosyltransferase; glycosyltransfer | 99.89 | |
| 2c1x_A | 456 | UDP-glucose flavonoid 3-O glycosyltransferase; WIN | 99.88 | |
| 3hbf_A | 454 | Flavonoid 3-O-glucosyltransferase; glycosyltransfe | 99.88 | |
| 2pq6_A | 482 | UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl | 99.88 | |
| 2acv_A | 463 | Triterpene UDP-glucosyl transferase UGT71G1; glyco | 99.87 | |
| 1iir_A | 415 | Glycosyltransferase GTFB; rossmann fold; 1.80A {Am | 99.87 | |
| 4amg_A | 400 | Snogd; transferase, polyketide biosynthesis, GT1 f | 99.86 | |
| 2o6l_A | 170 | UDP-glucuronosyltransferase 2B7; drug metabolism, | 99.85 | |
| 1rrv_A | 416 | Glycosyltransferase GTFD; GT-B, glycosyltransferas | 99.85 | |
| 2p6p_A | 384 | Glycosyl transferase; X-RAY-diffraction,urdamycina | 99.85 | |
| 2iya_A | 424 | OLEI, oleandomycin glycosyltransferase; carbohydra | 99.85 | |
| 3h4t_A | 404 | Glycosyltransferase GTFA, glycosyltransferase; van | 99.83 | |
| 2yjn_A | 441 | ERYCIII, glycosyltransferase; transferase, cytochr | 99.83 | |
| 3rsc_A | 415 | CALG2; TDP, enediyne, structural genomics, PSI-2, | 99.8 | |
| 3tsa_A | 391 | SPNG, NDP-rhamnosyltransferase; glycosyltransferas | 99.79 | |
| 3ia7_A | 402 | CALG4; glycosysltransferase, calicheamicin, enediy | 99.78 | |
| 4fzr_A | 398 | SSFS6; structural genomics, PSI-biology, protein s | 99.77 | |
| 2iyf_A | 430 | OLED, oleandomycin glycosyltransferase; antibiotic | 99.75 | |
| 3s2u_A | 365 | UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape | 99.75 | |
| 3oti_A | 398 | CALG3; calicheamicin, TDP, structural genomics, PS | 99.73 | |
| 3otg_A | 412 | CALG1; calicheamicin, TDP, structural genomics, PS | 99.71 | |
| 1f0k_A | 364 | MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe | 99.37 | |
| 2jzc_A | 224 | UDP-N-acetylglucosamine transferase subunit ALG13; | 99.33 | |
| 3hbm_A | 282 | UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je | 98.92 | |
| 1v4v_A | 376 | UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t | 98.72 | |
| 1vgv_A | 384 | UDP-N-acetylglucosamine 2-epimerase; structural ge | 98.62 | |
| 3ot5_A | 403 | UDP-N-acetylglucosamine 2-epimerase; structural ge | 98.56 | |
| 2xci_A | 374 | KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci | 98.47 | |
| 3dzc_A | 396 | UDP-N-acetylglucosamine 2-epimerase; structural ge | 98.43 | |
| 3beo_A | 375 | UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a | 98.43 | |
| 2iw1_A | 374 | Lipopolysaccharide core biosynthesis protein RFAG; | 98.24 | |
| 4hwg_A | 385 | UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc | 98.18 | |
| 2gek_A | 406 | Phosphatidylinositol mannosyltransferase (PIMA); G | 98.13 | |
| 2f9f_A | 177 | First mannosyl transferase (WBAZ-1); alpha-beta pr | 98.04 | |
| 2x6q_A | 416 | Trehalose-synthase TRET; biosynthetic protein; 2.2 | 98.02 | |
| 2jjm_A | 394 | Glycosyl transferase, group 1 family protein; anth | 97.96 | |
| 3c48_A | 438 | Predicted glycosyltransferases; retaining glycosyl | 97.95 | |
| 3okp_A | 394 | GDP-mannose-dependent alpha-(1-6)-phosphatidylino | 97.9 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 97.89 | |
| 2bfw_A | 200 | GLGA glycogen synthase; glycosyltransferase family | 97.81 | |
| 3fro_A | 439 | GLGA glycogen synthase; glycosyltransferase family | 97.65 | |
| 3oy2_A | 413 | Glycosyltransferase B736L; rossmann fold, GDP-mann | 97.57 | |
| 3qhp_A | 166 | Type 1 capsular polysaccharide biosynthesis prote | 97.5 | |
| 2r60_A | 499 | Glycosyl transferase, group 1; rossmann-fold; 1.80 | 97.49 | |
| 1rzu_A | 485 | Glycogen synthase 1; glycosyl-transferase, GT-B fo | 97.37 | |
| 2qzs_A | 485 | Glycogen synthase; glycosyl-transferase, GT-B fold | 97.33 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 97.23 | |
| 2iuy_A | 342 | Avigt4, glycosyltransferase; antibiotics, family G | 97.06 | |
| 3s28_A | 816 | Sucrose synthase 1; glycosyltransferase, sucrose m | 97.04 | |
| 3q3e_A | 631 | HMW1C-like glycosyltransferase; N-glycosylation; 2 | 97.04 | |
| 3rhz_A | 339 | GTF3, nucleotide sugar synthetase-like protein; gl | 96.69 | |
| 2x0d_A | 413 | WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge | 95.9 | |
| 3nb0_A | 725 | Glycogen [starch] synthase isoform 2; glycogen syn | 94.39 | |
| 2hy7_A | 406 | Glucuronosyltransferase GUMK; glycosyltransferases | 94.2 | |
| 1uqt_A | 482 | Alpha, alpha-trehalose-phosphate synthase; glycosy | 93.23 | |
| 2i2c_A | 272 | Probable inorganic polyphosphate/ATP-NAD kinase 1; | 89.93 | |
| 3vue_A | 536 | GBSS-I, granule-bound starch synthase 1, chloropla | 89.48 | |
| 2iz6_A | 176 | Molybdenum cofactor carrier protein; metal transpo | 88.99 | |
| 1yt5_A | 258 | Inorganic polyphosphate/ATP-NAD kinase; domain 1: | 88.18 | |
| 3l7i_A | 729 | Teichoic acid biosynthesis protein F; GT-B fold, m | 88.02 | |
| 3t5t_A | 496 | Putative glycosyltransferase; GTB fold, pseudoglyc | 84.33 | |
| 1rcu_A | 195 | Conserved hypothetical protein VT76; structural ge | 82.71 | |
| 2an1_A | 292 | Putative kinase; structural genomics, PSI, protein | 81.47 |
| >2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* | Back alignment and structure |
|---|
Probab=99.89 E-value=4.2e-23 Score=161.29 Aligned_cols=108 Identities=19% Similarity=0.253 Sum_probs=94.5
Q ss_pred CCCCCCccEEEeCCChhHHHHHHHhCCCEEeecCCcChHHHHHHH-HHcCceeEcCCC---CCCHHHHHHHHHHHhc---
Q psy1202 2 PTGHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLM-EEKGMGLITPHE---TITGDILYITIREVLN--- 74 (136)
Q Consensus 2 ~L~h~~~~~~I~hgG~~s~~Eal~~g~P~i~~P~~~dq~~na~~~-~~~G~g~~l~~~---~~~~~~l~~~i~~ll~--- 74 (136)
+|+|+++++||||||+||++|++++|||+|++|+++||..||+++ ++.|+|+.++.. .+++++|.++|+++++
T Consensus 352 vL~h~~v~~fvtHgG~~S~~Eal~~GvP~i~~P~~~DQ~~na~~l~~~~G~g~~l~~~~~~~~~~~~l~~av~~vl~~~~ 431 (480)
T 2vch_A 352 VLAHPSTGGFLTHCGWNSTLESVVSGIPLIAWPLYAEQKMNAVLLSEDIRAALRPRAGDDGLVRREEVARVVKGLMEGEE 431 (480)
T ss_dssp HHHSTTEEEEEECCCHHHHHHHHHHTCCEEECCCSTTHHHHHHHHHHTTCCEECCCCCTTSCCCHHHHHHHHHHHHTSTH
T ss_pred HhCCCCcCeEEecccchhHHHHHHcCCCEEeccccccchHHHHHHHHHhCeEEEeecccCCccCHHHHHHHHHHHhcCcc
Confidence 688999999999999999999999999999999999999999997 689999999865 6899999999999998
Q ss_pred ChHHHHHHHHHHHHHhc---CCCChHHHHHHHHHHHHH
Q psy1202 75 NPRYRDTVGRLSKQVRS---LPYSNLDQAVRWAEHVAA 109 (136)
Q Consensus 75 ~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~ie~~~~ 109 (136)
+++||++++++++.++. ....+...+..+|+.+.+
T Consensus 432 ~~~~r~~a~~l~~~~~~a~~~gGss~~~~~~~v~~~~~ 469 (480)
T 2vch_A 432 GKGVRNKMKELKEAACRVLKDDGTSTKALSLVALKWKA 469 (480)
T ss_dssp HHHHHHHHHHHHHHHHHHTSTTSHHHHHHHHHHHHHHH
T ss_pred hHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHH
Confidence 78999999999999987 433334556666666543
|
| >2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* | Back alignment and structure |
|---|
| >3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* | Back alignment and structure |
|---|
| >2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 | Back alignment and structure |
|---|
| >2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* | Back alignment and structure |
|---|
| >1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 | Back alignment and structure |
|---|
| >4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* | Back alignment and structure |
|---|
| >2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 | Back alignment and structure |
|---|
| >2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} | Back alignment and structure |
|---|
| >2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} | Back alignment and structure |
|---|
| >2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* | Back alignment and structure |
|---|
| >3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* | Back alignment and structure |
|---|
| >3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* | Back alignment and structure |
|---|
| >2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} | Back alignment and structure |
|---|
| >3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* | Back alignment and structure |
|---|
| >3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* | Back alignment and structure |
|---|
| >1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* | Back alignment and structure |
|---|
| >2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A | Back alignment and structure |
|---|
| >3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* | Back alignment and structure |
|---|
| >1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 | Back alignment and structure |
|---|
| >1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* | Back alignment and structure |
|---|
| >3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* | Back alignment and structure |
|---|
| >3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A | Back alignment and structure |
|---|
| >2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* | Back alignment and structure |
|---|
| >4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} | Back alignment and structure |
|---|
| >2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* | Back alignment and structure |
|---|
| >2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 | Back alignment and structure |
|---|
| >2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* | Back alignment and structure |
|---|
| >2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* | Back alignment and structure |
|---|
| >3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* | Back alignment and structure |
|---|
| >3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 | Back alignment and structure |
|---|
| >3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* | Back alignment and structure |
|---|
| >3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* | Back alignment and structure |
|---|
| >3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* | Back alignment and structure |
|---|
| >1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A | Back alignment and structure |
|---|
| >2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* | Back alignment and structure |
|---|
| >3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* | Back alignment and structure |
|---|
| >3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A | Back alignment and structure |
|---|
| >3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A* | Back alignment and structure |
|---|
| >2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* | Back alignment and structure |
|---|
| >3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A* | Back alignment and structure |
|---|
| >2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* | Back alignment and structure |
|---|
| >1uqt_A Alpha, alpha-trehalose-phosphate synthase; glycosyltransferase, transferase; HET: U2F; 2.0A {Escherichia coli} SCOP: c.87.1.6 PDB: 1uqu_A* 2wtx_A* 1gz5_A* | Back alignment and structure |
|---|
| >2i2c_A Probable inorganic polyphosphate/ATP-NAD kinase 1; NADP bound of lmnadk1, transferase; HET: DTA PG4; 1.85A {Listeria monocytogenes egd-e} PDB: 2i1w_A* 2i2a_A* 2i2b_A* 2i29_A* 2i2d_A* 2i2e_A* 3v7u_A* 3v7w_A* 3v7y_A* 3v80_A* 3v8m_A* 3v8n_A* 3v8p_A* 4dy6_A* 2i2f_A* 2q5f_A* 3v8q_A* 3v8r_A* | Back alignment and structure |
|---|
| >3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* | Back alignment and structure |
|---|
| >2iz6_A Molybdenum cofactor carrier protein; metal transport; 1.60A {Chlamydomonas reinhardtii} PDB: 2iz5_A 2iz7_A | Back alignment and structure |
|---|
| >1yt5_A Inorganic polyphosphate/ATP-NAD kinase; domain 1: alpha/beta domain2: beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A* | Back alignment and structure |
|---|
| >3t5t_A Putative glycosyltransferase; GTB fold, pseudoglycosyltransferase; 1.70A {Streptomyces hygroscopicus} PDB: 4f97_A* 4f96_B* 4f9f_A* 3t7d_A* | Back alignment and structure |
|---|
| >1rcu_A Conserved hypothetical protein VT76; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.50A {Thermotoga maritima} SCOP: c.129.1.1 | Back alignment and structure |
|---|
| >2an1_A Putative kinase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, transferase; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 136 | ||||
| d2c1xa1 | 450 | c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-gluc | 8e-20 | |
| d1rrva_ | 401 | c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Am | 6e-18 | |
| d1iira_ | 401 | c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycol | 2e-17 | |
| d2pq6a1 | 473 | c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransfe | 1e-15 | |
| d2acva1 | 461 | c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transf | 4e-15 | |
| d2vcha1 | 471 | c.87.1.10 (A:6-476) Hydroquinone glucosyltransfera | 1e-13 | |
| d1pn3a_ | 391 | c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA | 1e-13 | |
| d1f0ka_ | 351 | c.87.1.2 (A:) Peptidoglycan biosynthesis glycosylt | 1e-05 |
| >d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Length = 450 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: UDP-Glycosyltransferase/glycogen phosphorylase superfamily: UDP-Glycosyltransferase/glycogen phosphorylase family: UDPGT-like domain: UDP glucose:flavonoid 3-o-glucosyltransferase species: Grape (Vitis vinifera) [TaxId: 29760]
Score = 81.7 bits (200), Expect = 8e-20
Identities = 27/116 (23%), Positives = 50/116 (43%), Gaps = 7/116 (6%)
Query: 5 HRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEEK-GMGLITPHETITGD 63
H F+TH G +S E+V GVP++ P F DQ N +++E+ +G+ T
Sbjct: 335 HEAVGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVEDVLEIGVRIEGGVFTKS 394
Query: 64 ILYITIREVLNNPRY---RDTVGRLSKQVR---SLPYSNLDQAVRWAEHVAANKGV 113
L ++L+ + R+ + L + S+ + + + V+ K V
Sbjct: 395 GLMSCFDQILSQEKGKKLRENLRALRETADRAVGPKGSSTENFITLVDLVSKPKDV 450
|
| >d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 | Back information, alignment and structure |
|---|
| >d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 | Back information, alignment and structure |
|---|
| >d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Length = 473 | Back information, alignment and structure |
|---|
| >d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Length = 461 | Back information, alignment and structure |
|---|
| >d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 471 | Back information, alignment and structure |
|---|
| >d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Length = 391 | Back information, alignment and structure |
|---|
| >d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Length = 351 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| d2c1xa1 | 450 | UDP glucose:flavonoid 3-o-glucosyltransferase {Gra | 99.94 | |
| d2pq6a1 | 473 | (Iso)flavonoid glycosyltransferase {Medicago trunc | 99.93 | |
| d2vcha1 | 471 | Hydroquinone glucosyltransferase {Thale cress (Ara | 99.93 | |
| d2acva1 | 461 | Triterpene UDP-glucosyl transferase UGT71G1 {Medic | 99.92 | |
| d1iira_ | 401 | UDP-glucosyltransferase GtfB {Amycolatopsis orient | 99.89 | |
| d1rrva_ | 401 | TDP-vancosaminyltransferase GftD {Amycolatopsis or | 99.89 | |
| d1pn3a_ | 391 | TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi | 99.87 | |
| d1f0ka_ | 351 | Peptidoglycan biosynthesis glycosyltransferase Mur | 99.77 | |
| d2iw1a1 | 370 | Lipopolysaccharide core biosynthesis protein RfaG | 98.33 | |
| d1v4va_ | 373 | UDP-N-acetylglucosamine 2-epimerase {Thermus therm | 97.6 | |
| d2bisa1 | 437 | Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI | 97.59 | |
| d2f9fa1 | 166 | First mannosyl transferase WbaZ {Archaeoglobus ful | 97.58 | |
| d2bfwa1 | 196 | Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI | 97.33 | |
| d1o6ca_ | 377 | UDP-N-acetylglucosamine 2-epimerase {Bacillus subt | 96.65 | |
| d1rzua_ | 477 | Glycogen synthase 1, GlgA {Agrobacterium tumefacie | 96.1 | |
| d1f6da_ | 376 | UDP-N-acetylglucosamine 2-epimerase {Escherichia c | 96.09 | |
| d1uqta_ | 456 | Trehalose-6-phosphate synthase, OtsA {Escherichia | 89.98 |
| >d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: UDP-Glycosyltransferase/glycogen phosphorylase superfamily: UDP-Glycosyltransferase/glycogen phosphorylase family: UDPGT-like domain: UDP glucose:flavonoid 3-o-glucosyltransferase species: Grape (Vitis vinifera) [TaxId: 29760]
Probab=99.94 E-value=1.7e-27 Score=179.82 Aligned_cols=111 Identities=23% Similarity=0.315 Sum_probs=96.7
Q ss_pred CCCCCCccEEEeCCChhHHHHHHHhCCCEEeecCCcChHHHHHHHHH-cCceeEcCCCCCCHHHHHHHHHHHhcChHHHH
Q psy1202 2 PTGHRNCKLFITHGGIHSSMEAVYHGVPVVMMPGFSDQHQNCKLMEE-KGMGLITPHETITGDILYITIREVLNNPRYRD 80 (136)
Q Consensus 2 ~L~h~~~~~~I~hgG~~s~~Eal~~g~P~i~~P~~~dq~~na~~~~~-~G~g~~l~~~~~~~~~l~~~i~~ll~~~~~~~ 80 (136)
+|.||++++||||||.||+.||+++|||++++|+++||+.||+++++ .|+|+.++.+.+++++|.++|+++|+|++|++
T Consensus 332 lL~hp~~~~fItHGG~~s~~eal~~GvP~v~~P~~~DQ~~na~rv~~~~G~G~~l~~~~~t~~~l~~ai~~vL~d~~y~~ 411 (450)
T d2c1xa1 332 VLAHEAVGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVEDVLEIGVRIEGGVFTKSGLMSCFDQILSQEKGKK 411 (450)
T ss_dssp HHTSTTEEEEEECCCHHHHHHHHHHTCCEEECCCSTTHHHHHHHHHHTSCCEEECGGGSCCHHHHHHHHHHHHHSHHHHH
T ss_pred hhccCceeEEEccCCccHHHHHHHcCCCEEecccccchHHHHHHHHHHcCcEEEecCCCcCHHHHHHHHHHHhcCcHHHH
Confidence 58999999999999999999999999999999999999999999987 69999999999999999999999999998775
Q ss_pred ---HHHHHHHHHhc---CCCChHHHHHHHHHHHHHcCC
Q psy1202 81 ---TVGRLSKQVRS---LPYSNLDQAVRWAEHVAANKG 112 (136)
Q Consensus 81 ---~~~~~~~~~~~---~~~~~~~~~~~~ie~~~~~~~ 112 (136)
+++++++.... ..+++.+.+++|||++.++|.
T Consensus 412 ~~~r~~~l~~~~~~a~~~~gss~~~~~~~~e~v~r~~~ 449 (450)
T d2c1xa1 412 LRENLRALRETADRAVGPKGSSTENFITLVDLVSKPKD 449 (450)
T ss_dssp HHHHHHHHHHHHHHHTSTTCHHHHHHHHHHHHHTSCCC
T ss_pred HHHHHHHHHHHHHHhccCCCCHHHHHHHHHHHHhhhcC
Confidence 55555444322 223458899999999999874
|
| >d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} | Back information, alignment and structure |
|---|
| >d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} | Back information, alignment and structure |
|---|
| >d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|