Psyllid ID: psy1205

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------87

MSCQMNTCNCPVTQPGPTLASTCGGSAYMLFMGLLEVFIRSQCDLEDPCNRPLSRGFPDRDYDFIVIGGGSSGAVVANRLSEMNTCNCPVTQPGPTLASTCGGSAYMLFMGLLEVFIRSQCDLEDPCNRPLSRGFPDRDYDFIVIGGGSSGAVVANRLSEVPNWRVLLIEAGGDEPTGTQIPSMFLNFLGSSIDYGYKTEPEDMACLNNEERRCNWPRGKVPNWRVLLIEAGGDEPTGTQIPSMFLNFLGSSIDYGYKTEPEDMACLNNEERRCNWPRGKCAIRRNTGAENHQAGSCKMGPASDPSAVVSPELKVHGVDRLRVVDCSIMPAVTSGSAPLGGIQALRITRQDLVRWDQHLILALSCHRNSKSMVWTGSVLWTAVSCLLSPVLGGTSVLNGMMYIRGSRADYDNWAKAGNPGWSYQDVLPYFLKSEDNQQATMMDQGFHGVGGYLTVTQFPYHPPLSHSILQGAMELGMPVRDLNGVSHTGFMIAQTTTRNGSRLSTSKAFLRPIISRNNLHILLNTTVTRVIVDPLTKAAIGVEFLTNGRLERLQAKNEVIVCAGAVDSPRILLLSGIGPREELRRLNIAPIHDLPGVGKNLHNHVAHFLNFFINDTDTTALNWATAMEYLLFRDGLMSGTGLSEVTGFVHSRLSNPAEDNPDLQIFFSGYLANCARTGQVGERSDGMNNSTPVPQRTISIFPTVLHPKSRGYLTLKDNNPQTPPLIFARYLTHPDDVKTLVDGIKIAIRLTQTAALQKYGFRIDTTPVKGCENLPFGCDAYWECAIRRNTGAENHQAGSCKMGPASDPSAVVSPELKVHGVDRLRVVDCSIMPAVTSGNTNAPAIMIAEKASDLIKQQWIGKRAWNKW

ccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEcccHHHHHHHHccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEcccccccccccccccHHHHHccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHHcccccccccccHHHHHHccccccccccccccccccccEEEEccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHccccccccccEEEcccEEEEEEEEccccEEEEEEEEEccEEEEEEEccEEEEcccccHHHHHHHHcccccHHHHHHcccccEEccccccccccccccccEEEEEcccccccccHHHHHHHHHHccccccccccccEEEEEEccccccccccccEEEEEEcccccccccccccccccccccccccccccEEEEEEcccccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHccccccccc

ccccccccccccccccccHHHcccHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEEcccHHHHHHHHHcccccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHHcccccccccccccHccccEEEEEEEcccHHHHHHHHHHcccccccEEEEccccccccEEcccHHccccccccccccEcccccccHHHHccccEccccccccccEEEEEEEcccccccccccEEEcccccccHHHHHHHHHHHccccccHHccccccccHHHHHHHHccccccccccccccccccccEEEccccEEEEccccEEEEccccccccccccccccEEEEEcccccHHcccccccHHHccccccccccccEcccccccccccccEEccccHHHEEEEEEccHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccccccccEEEcccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHcccccEEEEEEEEEEEEEcccccEEEEEEEEEccEEEEEEEEEEEEEccHHHHHHHHHHHccEEcHHHHHHccccccEEcccccEEEEccEEEEEEEEccccccHHHHHHHHHHHHHcccccccccccHEEEEEEEccccccccccccEEEEEEcccEccccccEEEEEcccccccEcccccEEEEEEccccccccEEEEEEcccccccccEcccccccHHHHHHHHHHHHHHHHHHccHHHHHccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccEEEccccEEEEccccEEEEccccccccccccccHHHHHHHHHHHHHHcccccccccccc

mscqmntcncpvtqpgptlastcggsAYMLFMGLLEVFIRsqcdledpcnrplsrgfpdrdydfIVIGGGSSGAVVANRLsemntcncpvtqpgptlastcggsAYMLFMGLLEVFIRsqcdledpcnrplsrgfpdrdydfIVIGGGSSGAVVANRLSEVPNWRVLLIEaggdeptgtqipsMFLNFLGssidygyktepedmaclnneerrcnwprgkvpnWRVLLIEaggdeptgtqipsMFLNFLGssidygyktepedmaclnneerrcnwprgkcairrntgaenhqagsckmgpasdpsavvspelkvhgvdrlrvvdcsimpavtsgsaplggiQALRITRQDLVRWDQHLILALSChrnsksmvwTGSVLWTAVSCllspvlggtsvlNGMMYIRgsradydnwakagnpgwsyqdvlpyflksednqqatmmdqgfhgvggyltvtqfpyhpplshsILQGAMelgmpvrdlngvshtGFMIAQTttrngsrlstskaflrpiisrnnlhiLLNTTVTRVIVDPLTKAAIGVEFLTNGRLERLQAKNEVIVCagavdsprilllsgigpreelrrlniapihdlpgvgknLHNHVAHFLNFFINDTDTTALNWATAMEYLLFRDglmsgtglseVTGFVhsrlsnpaednpdlqiffsgylancartgqvgersdgmnnstpvpqrtisifptvlhpksrgyltlkdnnpqtpplIFARylthpddvktLVDGIKIAIRLTQTAALQKYgfridttpvkgcenlpfgcdaYWECAIrrntgaenhqagsckmgpasdpsavvspelkvhgvdrlrvvdcsimpavtsgntnapAIMIAEKASDLIKQQWIgkrawnkw

MSCQMNTCNCPVTQPGPTLASTCGGSAYMLFMGLLEVFIRSQCDLEDPCNRPLSRGFPDRDYDFIVIGGGSSGAVVANRLSEMNTCNCPVTQPGPTLASTCGGSAYMLFMGLLEVFIRSQCDLEDPCNRPLSRGFPDRDYDFIVIGGGSSGAVVANRLSEVPNWRVLLIEAGGDEPTGTQIPSMFLNFLGSSIDYGYKTEPEDMACLNNEerrcnwprgkvpNWRVLLIEAGGDEPTGTQIPSMFLNFLGSSIDYGYKTEPEDMACLNNEERRCNWPRGKCAIRRNTGAENHQAGSCKMGPASDPSAVVSPELKVHGVDRLRVVDCSIMPAvtsgsaplggiQALRITRQDLVRWDQHLILALSCHRNSKSMVWTGSVLWTAVSCLLSPVLGGTSVLNGMMYIRGSRADYDNWAKAGNPGWSYQDVLPYFLKSEDNQQATMMDQGFHGVGGYLTVTQFPYHPPLSHSILQGAMELGMPVRDLNGVSHTGFMIAqtttrngsrlstSKAFLRPIISRNNLHILLNTTVTRVIVDPLTKAAIGVEFLTNGRLERLQAKNEVIVcagavdspriLLLSGIGPREELRRLNIAPIHDLPGVGKNLHNHVAHFLNFFINDTDTTALNWATAMEYLLFRDGLMSGTGLSEVTGFVHSRLSNPAEDNPDLQIFFSGYLANCARTGQVgersdgmnnstpvpqRTISIFPTVLHPKSRGYLTLKDNNPQTPPLIFARYLTHPDDVKTLVDGIKIAIRLTQTAALQKYGFRIDTTPVKGCENLPFGCDAYWECAIRRNTGAENHQAGSCKMGPASDPSAVVSPELKVHGVDRLRVVDCSIMPavtsgntnapAIMIAEKASDLIKQQWIGKRAWNKW

MSCQMNTCNCPVTQPGPTLASTCGGSAYMLFMGLLEVFIRSQCDLEDPCNRPLSRGFPDRDYDFivigggssgavvaNRLSEMNTCNCPVTQPGPTLASTCGGSAYMLFMGLLEVFIRSQCDLEDPCNRPLSRGFPDRDYDFivigggssgavvaNRLSEVPNWRVLLIEAGGDEPTGTQIPSMFLNFLGSSIDYGYKTEPEDMACLNNEERRCNWPRGKVPNWRVLLIEAGGDEPTGTQIPSMFLNFLGSSIDYGYKTEPEDMACLNNEERRCNWPRGKCAIRRNTGAENHQAGSCKMGPASDPSAVVSPELKVHGVDRLRVVDCSIMPAVTSGSAPLGGIQALRITRQDLVRWDQHLILALSCHRNSKSMVWTGSVLWTAVSCLLSPVLGGTSVLNGMMYIRGSRADYDNWAKAGNPGWSYQDVLPYFLKSEDNQQATMMDQGFHGVGGYLTVTQFPYHPPLSHSILQGAMELGMPVRDLNGVSHTGFMIAQTTTRNGSRLSTSKAFLRPIISRNNLHILLNTTVTRVIVDPLTKAAIGVEFLTNGRLERLQAKNEVIVCAGAVDSPRILLLSGIGPREELRRLNIAPIHDLPGVGKNLHNHVAHFLNFFINDTDTTALNWATAMEYLLFRDGLMSGTGLSEVTGFVHSRLSNPAEDNPDLQIFFSGYLANCARTGQVGERSDGMNNSTPVPQRTISIFPTVLHPKSRGYLTLKDNNPQTPPLIFARYLTHPDDVKTLVDGIKIAIRLTQTAALQKYGFRIDTTPVKGCENLPFGCDAYWECAIRRNTGAENHQAGSCKMGPASDPSAVVSPELKVHGVDRLRVVDCSIMPAVTSGNTNAPAIMIAEKASDLIKQQWIGKRAWNKW

*******CNCPVTQPGPTLASTCGGSAYMLFMGLLEVFIRSQCDLEDPCNRPLSRGFPDRDYDFIVIGGGSSGAVVANRLSEMNTCNCPVTQPGPTLASTCGGSAYMLFMGLLEVFIRSQCDLEDPCNRPLSRGFPDRDYDFIVIGGGSSGAVVANRLSEVPNWRVLLIEAGGDEPTGTQIPSMFLNFLGSSIDYGYKTEPEDMACLNNEERRCNWPRGKVPNWRVLLIEAGGDEPTGTQIPSMFLNFLGSSIDYGYKTEPEDMACLNNEERRCNWPRGKCAIR****************************LKVHGVDRLRVVDCSIMPAVTSGSAPLGGIQALRITRQDLVRWDQHLILALSCHRNSKSMVWTGSVLWTAVSCLLSPVLGGTSVLNGMMYIRGSRADYDNWAKAGNPGWSYQDVLPYFLKSEDNQQATMMDQGFHGVGGYLTVTQFPYHPPLSHSILQGAMELGMPVRDLNGVSHTGFMIAQTTTRNGSRLSTSKAFLRPIISRNNLHILLNTTVTRVIVDPLTKAAIGVEFLTNGRLERLQAKNEVIVCAGAVDSPRILLLSGIGPREELRRLNIAPIHDLPGVGKNLHNHVAHFLNFFINDTDTTALNWATAMEYLLFRDGLMSGTGLSEVTGFVHSRL*******PDLQIFFSGYLANCARTG******************TISIFPTVLHPKSRGYLTLKDNNPQTPPLIFARYLTHPDDVKTLVDGIKIAIRLTQTAALQKYGFRIDTTPVKGCENLPFGCDAYWECAIRRN*************************ELKVHGVDRLRVVDCSIMPAVTSGNTNAPAIMIAEKASDLIKQQWIGKRAW***

*************QPGPTLASTCGGSAYMLFMGLLEVFIRSQCDLE************DRDYDFIVIGGGSSGAVVANRLSEMNTCNCPVTQPGPTLASTCGGSAYMLFMGLLEVFIRSQCDLEDPCN******FPDRDYDFIVIGGGSSGAVVANRLSEVPNWRVLLIEAGGDEPTGTQIPSMFLNFLGSSIDYGYKTEPEDMACLNNEERRCNWPRGKVPNWRVLLI**GGDEPTGTQIPSMFLNFLGSSIDYGYKTEPEDMACLNNEERRCNWPRGKCAIRRNTGAENHQAGSCKMGPASDPSAVVSPELKVHGVDRLRVVDCSIMPAVTSGSAPLGGIQALRITRQDLVRWDQHLILALSCHRNSKSMVWTGSVLWTAVSCLLSPVLGGTSVLNGMMYIRGSRADYDNWAKAGNPGWSYQDVLPYFLKSEDNQQATMMDQGFHGVGGYLTVTQFPYHPPLSHSILQGAMELGMPVRDLNGVSHTGFMIAQTTTRNGSRLSTSKAFLRPIISRNNLHILLNTTVTRVIVDPLTKAAIGVEFLTNGRLERLQAKNEVIVCAGAVDSPRILLLSGIGPREELRRLNIAPIHDLPGVGKNLHNHVAHFLNFFINDTDTTALNWATAMEYLLFRDGLMSGTGLSEVTGFVHSRLSNPAEDNPDLQIFFSGYLANCARTGQVGERSDGMNNSTPVPQRTISIFPTVLHPKSRGYLTLKDNNPQTPPLIFARYLTHPDDVKTLVDGIKIAIRLTQTAALQKYGFRIDTTPVKGCENLPFGCDAYWECAIRRNTGAENHQAGSCKMGPASDPSAVVSPELKVHGVDRLRVVDCSIMPAVTSGNTNAPAIMIAEKASDLIKQQW*********

MSCQMNTCNCPVTQPGPTLASTCGGSAYMLFMGLLEVFIRSQCDLEDPCNRPLSRGFPDRDYDFIVIGGGSSGAVVANRLSEMNTCNCPVTQPGPTLASTCGGSAYMLFMGLLEVFIRSQCDLEDPCNRPLSRGFPDRDYDFIVIGGGSSGAVVANRLSEVPNWRVLLIEAGGDEPTGTQIPSMFLNFLGSSIDYGYKTEPEDMACLNNEERRCNWPRGKVPNWRVLLIEAGGDEPTGTQIPSMFLNFLGSSIDYGYKTEPEDMACLNNEERRCNWPRGKCAIRRNT********************VVSPELKVHGVDRLRVVDCSIMPAVTSGSAPLGGIQALRITRQDLVRWDQHLILALSCHRNSKSMVWTGSVLWTAVSCLLSPVLGGTSVLNGMMYIRGSRADYDNWAKAGNPGWSYQDVLPYFLKSEDNQQATMMDQGFHGVGGYLTVTQFPYHPPLSHSILQGAMELGMPVRDLNGVSHTGFMIAQTTTRNGSRLSTSKAFLRPIISRNNLHILLNTTVTRVIVDPLTKAAIGVEFLTNGRLERLQAKNEVIVCAGAVDSPRILLLSGIGPREELRRLNIAPIHDLPGVGKNLHNHVAHFLNFFINDTDTTALNWATAMEYLLFRDGLMSGTGLSEVTGFVHSRLSNPAEDNPDLQIFFSGYLANCARTGQVGERSDGMNNSTPVPQRTISIFPTVLHPKSRGYLTLKDNNPQTPPLIFARYLTHPDDVKTLVDGIKIAIRLTQTAALQKYGFRIDTTPVKGCENLPFGCDAYWECAIRRNTGA******************VVSPELKVHGVDRLRVVDCSIMPAVTSGNTNAPAIMIAEKASDLIKQQWIGKRAWNKW

******TCNCPVTQPGPTLASTCGGSAYMLFMGLLEVFIRSQCDLEDPCNRPLSRGFPDRDYDFIVIGGGSSGAVVANRLSEMNTCNCPVTQPGPTLASTCGGSAYMLFMGLLEVFIRSQCDLEDPCNRPLSRGFPDRDYDFIVIGGGSSGAVVANRLSEVPNWRVLLIEAGGDEPTGTQIPSMFLNFLGSSIDYGYKTEPEDMACLNNEERRCNWPRGKVPNWRVLLIEAGGDEPTGTQIPSMFLNFLGSSIDYGYKTEPEDMACLNNEERRCNWPRGKCAIRRNTGAENHQAGSCKMGPASDPSAVVSPELKVHGVDRLRVVDCSIMPAVTSGSAPLGGIQALRITRQDLVRWDQHLILALSCHRNSKSMVWTGSVLWTAVSCLLSPVLGGTSVLNGMMYIRGSRADYDNWAKAGNPGWSYQDVLPYFLKSEDNQQATMMDQGFHGVGGYLTVTQFPYHPPLSHSILQGAMELGMPVRDLNGVSHTGFMIAQTTTRNGSRLSTSKAFLRPIISRNNLHILLNTTVTRVIVDPLTKAAIGVEFLTNGRLERLQAKNEVIVCAGAVDSPRILLLSGIGPREELRRLNIAPIHDLPGVGKNLHNHVAHFLNFFINDTDTTALNWATAMEYLLFRDGLMSGTGLSEVTGFVHSRLSNPAEDNPDLQIFFSGYLANCARTGQVGERSDGMNNSTPVPQRTISIFPTVLHPKSRGYLTLKDNNPQTPPLIFARYLTHPDDVKTLVDGIKIAIRLTQTAALQKYGFRIDTTPVKGCENLPFGCDAYWECAIRRNTGAENHQAGSCKMGPASDPSAVVSPELKVHGVDRLRVVDCSIMPAVTSGNTNAPAIMIAEKASDLIKQQWI********

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		868	2.2.26 [Sep-21-2011]
P18172		625	Glucose dehydrogenase [ac	yes	N/A	0.535	0.744	0.628	1e-174
P18173		625	Glucose dehydrogenase [ac	yes	N/A	0.535	0.744	0.611	1e-170
Q985M5		550	Choline dehydrogenase OS=	no	N/A	0.495	0.781	0.354	5e-69
Q6UPE0		599	Choline dehydrogenase, mi	yes	N/A	0.498	0.722	0.347	8e-69
Q8BJ64		596	Choline dehydrogenase, mi	yes	N/A	0.497	0.724	0.345	2e-68
Q9WWW2		552	Alcohol dehydrogenase [ac	yes	N/A	0.542	0.853	0.335	9e-68
Q8NE62		594	Choline dehydrogenase, mi	yes	N/A	0.501	0.732	0.342	6e-67
Q00593		558	Alcohol dehydrogenase [ac	N/A	N/A	0.533	0.829	0.330	2e-66
P64264		528	Uncharacterized GMC-type	yes	N/A	0.506	0.833	0.351	6e-66
P64263		528	Uncharacterized GMC-type	yes	N/A	0.506	0.833	0.351	6e-66

>sp\|P18172\|DHGL_DROPS Glucose dehydrogenase [acceptor] OS=Drosophila pseudoobscura pseudoobscura GN=Gld PE=3 SV=4	Back alignment and function desciption

 Score =  611 bits (1575), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 298/474 (62%), Positives = 369/474 (77%), Gaps = 9/474 (1%)

Query: 390 VLGGTSVLNGMMYIRGSRADYDNWAKAGNPGWSYQDVLPYFLKSEDNQQATMMDQGFHGV 449
           VLGGTSV+NGMMYIRG+R DYD+WA  GNPGWSYQDVLP+F KSEDN +   +   +H  
Sbjct: 146 VLGGTSVMNGMMYIRGNREDYDDWAAQGNPGWSYQDVLPFFKKSEDNLELDAVGTEYHAK 205

Query: 450 GGYLTVTQFPYHPPLSHSILQGAMELGMPVRDLNGVSHTGFMIAQTTTRNGSRLSTSKAF 509
           GG L V +FPY+PPLS+++L+   E+G  V+DLNG + TGFMIAQ T RNG R S+++AF
Sbjct: 206 GGLLPVGKFPYNPPLSYALLKAGEEMGFSVQDLNGQNSTGFMIAQMTARNGIRYSSARAF 265

Query: 510 LRPIISRNNLHILLNTTVTRVIVDPLTKAAIGVEFLTN-GRLERLQAKNEVIVCAGAVDS 568
           LRP   RNNLHILLNTTVT+V++ P TK  +GVE     G + ++  K EVIV  GAV+S
Sbjct: 266 LRPARMRNNLHILLNTTVTKVLIHPGTKNVVGVEVSDQFGSMRKILVKKEVIVSGGAVNS 325

Query: 569 PRILLLSGIGPREELRRLNIAPIHDLPGVGKNLHNHVAHFLNFFINDTDTTALNWATAME 628
           P+ILLLSG+GP+E+L+++N+ P+H LPGVGKNLHNHVA+F NFFI+D DT  LNWATAME
Sbjct: 326 PQILLLSGVGPKEDLQKVNVRPVHHLPGVGKNLHNHVAYFTNFFIDDADTAPLNWATAME 385

Query: 629 YLLFRDGLMSGTGLSEVTGFVHSRLSNPAEDNPDLQIFFSGYLANCARTGQVGERSDGMN 688
           YLLFRDGLMSGTG+S+VT  + +R ++   + PDLQ++F GYLA+CARTGQVGE     N
Sbjct: 386 YLLFRDGLMSGTGISDVTAKMATRWAD-RPNLPDLQLYFGGYLASCARTGQVGELLS--N 442

Query: 689 NSTPVPQRTISIFPTVLHPKSRGYLTLKDNNPQTPPLIFARYLTHPDDVKTLVDGIKIAI 748
           NS     R I IFP VL+PKSRGY+TL+  +P  PP IFA YLT   DVKTLV+GIK AI
Sbjct: 443 NS-----RAIQIFPAVLNPKSRGYITLRSADPLDPPRIFANYLTDERDVKTLVEGIKFAI 497

Query: 749 RLTQTAALQKYGFRIDTTPVKGCENLPFGCDAYWECAIRRNTGAENHQAGSCKMGPASDP 808
           RL+QT+ L++YG R+D T VKGCE+  F  DAYWECA+R+NTG ENHQAGSCKMGP+ DP
Sbjct: 498 RLSQTSPLKQYGMRLDKTVVKGCESHAFASDAYWECAVRQNTGPENHQAGSCKMGPSHDP 557

Query: 809 SAVVSPELKVHGVDRLRVVDCSIMPAVTSGNTNAPAIMIAEKASDLIKQQWIGK 862
            AVV+ EL+VHGV  LRV+D SIMP VT+GNT+APA+MIAEK + L+K+ W  K
Sbjct: 558 MAVVNHELRVHGVRGLRVMDTSIMPKVTAGNTHAPAVMIAEKGAYLLKRAWGAK 611

Drosophila pseudoobscura pseudoobscura (taxid: 46245)
EC: 1EC: .EC: 1EC: .EC: 9EC: 9EC: .EC: 1EC: 0

>sp\|P18173\|DHGL_DROME Glucose dehydrogenase [acceptor] OS=Drosophila melanogaster GN=Gld PE=3 SV=3	Back alignment and function description

>sp\|Q985M5\|BETA_RHILO Choline dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=betA PE=3 SV=1	Back alignment and function description

>sp\|Q6UPE0\|CHDH_RAT Choline dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Chdh PE=1 SV=1	Back alignment and function description

>sp\|Q8BJ64\|CHDH_MOUSE Choline dehydrogenase, mitochondrial OS=Mus musculus GN=Chdh PE=1 SV=1	Back alignment and function description

>sp\|Q9WWW2\|ALKJ_PSEPU Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida GN=alkJ PE=3 SV=1	Back alignment and function description

>sp\|Q8NE62\|CHDH_HUMAN Choline dehydrogenase, mitochondrial OS=Homo sapiens GN=CHDH PE=2 SV=2	Back alignment and function description

>sp\|Q00593\|ALKJ_PSEOL Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans GN=alkJ PE=1 SV=1	Back alignment and function description

>sp\|P64264\|Y1310_MYCBO Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1310 PE=3 SV=1	Back alignment and function description

>sp\|P64263\|Y1279_MYCTU Uncharacterized GMC-type oxidoreductase Rv1279/MT1316 OS=Mycobacterium tuberculosis GN=Rv1279 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		868
193713741		615	PREDICTED: glucose dehydrogenase [accept	0.569	0.803	0.662	0.0
91084191		623	PREDICTED: similar to AGAP002557-PA [Tri	0.539	0.751	0.669	0.0
242011451		616	glucose dehydrogenase precursor, putativ	0.533	0.751	0.680	0.0
345481521		601	PREDICTED: glucose dehydrogenase [accept	0.533	0.770	0.639	0.0
357618099		627	hypothetical protein KGM_08630 [Danaus p	0.534	0.740	0.643	0.0
380013230		599	PREDICTED: glucose dehydrogenase [accept	0.533	0.772	0.656	1e-179
328783045		601	PREDICTED: glucose dehydrogenase [accept	0.533	0.770	0.652	1e-179
332023410		824	Glucose dehydrogenase [Acromyrmex echina	0.533	0.561	0.646	1e-178
340728960		601	PREDICTED: glucose dehydrogenase [accept	0.533	0.770	0.644	1e-177
383860608		601	PREDICTED: glucose dehydrogenase [accept	0.533	0.770	0.650	1e-177

>gi\|193713741\|ref\|XP_001944712.1\| PREDICTED: glucose dehydrogenase [acceptor]-like [Acyrthosiphon pisum]	Back alignment and taxonomy information

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/509 (66%), Positives = 404/509 (79%), Gaps = 15/509 (2%)

Query: 371 SMVWTGSVLWTAVSCLLSP----------VLGGTSVLNGMMYIRGSRADYDNWAKAGNPG 420
           S+ W+ +     ++CL SP          VLGGTSV+NGMMY+RGSR D+D WAK GNPG
Sbjct: 111 SIDWSYNTEPEEMACLSSPERRCNWPRGKVLGGTSVMNGMMYMRGSRHDFDGWAKMGNPG 170

Query: 421 WSYQDVLPYFLKSEDNQQATMMDQGFHGVGGYLTVTQFPYHPPLSHSILQGAMELGMPVR 480
           WSYQDVLPYFLKSEDN QAT MD G+HGVGG + V QFPYHPPLSH+ILQ  +ELG  VR
Sbjct: 171 WSYQDVLPYFLKSEDNHQATTMDAGYHGVGGPMPVGQFPYHPPLSHAILQAGLELGYQVR 230

Query: 481 DLNGVSHTGFMIAQTTTRNGSRLSTSKAFLRPIISRNNLHILLNTTVTRVIVDPLTKAAI 540
           DLNG  HTGF IAQTT++NGSR S ++AFLRP   R NLH++LN TVTRV++DP  KAA 
Sbjct: 231 DLNGALHTGFAIAQTTSKNGSRYSMARAFLRPAKDRANLHVMLNATVTRVLIDPKKKAAY 290

Query: 541 GVEFLTNGRLERLQAKNEVIVCAGAVDSPRILLLSGIGPREELRRLNIAPIHDLPGVGKN 600
           GVE  TNGR   + A+ EVI+  GAV SP++LLLSG+GP+++LR + +  +HDLPGVG+N
Sbjct: 291 GVEVYTNGRTITIGARQEVILSGGAVASPQLLLLSGVGPKDDLRAVGVPVVHDLPGVGRN 350

Query: 601 LHNHVAHFLNFFINDTDTTALNWATAMEYLLFRDGLMSGTGLSEVTGFVHSRLSNPAEDN 660
           LHNHVA F+NF INDT TT LNWATAMEYLLFRDGLMSGTG+SEVT  + S+  NPA+DN
Sbjct: 351 LHNHVAFFVNFRINDTSTTPLNWATAMEYLLFRDGLMSGTGISEVTAVLPSKYVNPADDN 410

Query: 661 PDLQIFFSGYLANCARTGQVGERS-DGMNNSTPVPQRTISIFPTVLHPKSRGYLTLKDNN 719
           PDLQ FF GYLA+CA+TGQVGE+S  G+ +     +RTI++ P VLHPKSRG L LK ++
Sbjct: 411 PDLQFFFGGYLADCAKTGQVGEKSGSGVGDG----RRTINMIPAVLHPKSRGQLKLKSSD 466

Query: 720 PQTPPLIFARYLTHPDDVKTLVDGIKIAIRLTQTAALQKYGFRIDTTPVKGCENLPFGCD 779
           P   P I+ARYL+HPDDV  LV+GIKIAI+L++T AL KYG  +D TP  GCE+L FGCD
Sbjct: 467 PLAHPAIYARYLSHPDDVAVLVEGIKIAIKLSETPALSKYGMELDRTPAMGCEDLEFGCD 526

Query: 780 AYWECAIRRNTGAENHQAGSCKMGPASDPSAVVSPELKVHGVDRLRVVDCSIMPAVTSGN 839
           AYWECA+RRNTG ENHQAGSC+MGP SDP AVV  EL+VHGVDRLRVVD S+MPAVTSGN
Sbjct: 527 AYWECAVRRNTGPENHQAGSCRMGPPSDPGAVVDAELRVHGVDRLRVVDASVMPAVTSGN 586

Query: 840 TNAPAIMIAEKASDLIKQQWIGKRAWNKW 868
           TNAP +MIAEKASD+IK +W+G++ W+KW
Sbjct: 587 TNAPVVMIAEKASDMIKARWVGRKPWSKW 615

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom:

>gi\|91084191\|ref\|XP_967340.1\| PREDICTED: similar to AGAP002557-PA [Tribolium castaneum] gi\|270008779\|gb\|EFA05227.1\| hypothetical protein TcasGA2_TC015371 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|242011451\|ref\|XP_002426463.1\| glucose dehydrogenase precursor, putative [Pediculus humanus corporis] gi\|212510575\|gb\|EEB13725.1\| glucose dehydrogenase precursor, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|345481521\|ref\|XP_001607948.2\| PREDICTED: glucose dehydrogenase [acceptor]-like [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|357618099\|gb\|EHJ71193.1\| hypothetical protein KGM_08630 [Danaus plexippus]	Back alignment and taxonomy information

>gi\|380013230\|ref\|XP_003690668.1\| PREDICTED: glucose dehydrogenase [acceptor]-like [Apis florea]	Back alignment and taxonomy information

>gi\|328783045\|ref\|XP_003250229.1\| PREDICTED: glucose dehydrogenase [acceptor]-like [Apis mellifera]	Back alignment and taxonomy information

>gi\|332023410\|gb\|EGI63653.1\| Glucose dehydrogenase [Acromyrmex echinatior]	Back alignment and taxonomy information

>gi\|340728960\|ref\|XP_003402779.1\| PREDICTED: glucose dehydrogenase [acceptor]-like [Bombus terrestris]	Back alignment and taxonomy information

>gi\|383860608\|ref\|XP_003705781.1\| PREDICTED: glucose dehydrogenase [acceptor]-like [Megachile rotundata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		868
FB\|FBgn0001112		625	Gld "Glucose dehydrogenase" [D	0.535	0.744	0.611	4.2e-209
FB\|FBgn0030598		626	CG9503 [Drosophila melanogaste	0.540	0.749	0.459	2e-130
FB\|FBgn0030592		726	CG9514 [Drosophila melanogaste	0.540	0.646	0.437	3.9e-125
FB\|FBgn0030590		703	CG9518 [Drosophila melanogaste	0.540	0.667	0.443	2.1e-124
FB\|FBgn0030591		865	CG9517 [Drosophila melanogaste	0.543	0.545	0.444	3.2e-121
FB\|FBgn0039415		616	CG6142 [Drosophila melanogaste	0.538	0.758	0.416	1.2e-108
FB\|FBgn0030588		621	CG9521 [Drosophila melanogaste	0.536	0.750	0.383	2.1e-103
FB\|FBgn0030587		616	CG9522 [Drosophila melanogaste	0.539	0.759	0.415	3.6e-103
FB\|FBgn0030589		622	CG9519 [Drosophila melanogaste	0.535	0.747	0.374	2.6e-98
FB\|FBgn0030586		626	CG12539 [Drosophila melanogast	0.540	0.749	0.403	1.6e-96

FB\|FBgn0001112 Gld "Glucose dehydrogenase" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 1524 (541.5 bits), Expect = 4.2e-209, Sum P(3) = 4.2e-209
 Identities = 290/474 (61%), Positives = 361/474 (76%)

Query:   390 VLGGTSVLNGMMYIRGSRADYDNWAKAGNPGWSYQDVLPYFLKSEDNQQATMMDQGFHGV 449
             VLGGTSVLNGMMY+RG+R DYD+WA  GNPGW+Y DVLP+F KSEDN     +   +H  
Sbjct:   146 VLGGTSVLNGMMYVRGNREDYDDWAADGNPGWAYNDVLPFFKKSEDNLDLDEVGTEYHAK 205

Query:   450 GGYLTVTQFPYHPPLSHSILQGAMELGMPVRDLNGVSHTGFMIAQTTTRNGSRLSTSKAF 509
             GG L V +FPY+PPLS++IL+   ELG  V DLNG + TGFMIAQ T RNG R S+++AF
Sbjct:   206 GGLLPVGKFPYNPPLSYAILKAGEELGFSVHDLNGQNSTGFMIAQMTARNGIRYSSARAF 265

Query:   510 LRPIISRNNLHILLNTTVTRVIVDPLTKAAIGVEFLTN-GRLERLQAKNEVIVCAGAVDS 568
             LRP   RNNLHILLNTT T++++ P TK  +GVE     G   ++  K EV++ AGAV+S
Sbjct:   266 LRPARMRNNLHILLNTTATKILIHPHTKNVLGVEVSDQFGSTRKILVKKEVVLSAGAVNS 325

Query:   569 PRILLLSGIGPREELRRLNIAPIHDLPGVGKNLHNHVAHFLNFFINDTDTTALNWATAME 628
             P ILLLSG+GP++EL+++N+  +H+LPGVGKNLHNHV +F NFFI+D DT  LNWATAME
Sbjct:   326 PHILLLSGVGPKDELQQVNVRTVHNLPGVGKNLHNHVTYFTNFFIDDADTAPLNWATAME 385

Query:   629 YLLFRDGLMSGTGLSEVTGFVHSRLSNPAEDNPDLQIFFSGYLANCARTGQVGERSDGMN 688
             YLLFRDGLMSGTG+S+VT  + +R ++  E  PDLQ++F GYLA+CARTGQVGE     N
Sbjct:   386 YLLFRDGLMSGTGISDVTAKLATRYADSPE-RPDLQLYFGGYLASCARTGQVGELLS--N 442

Query:   689 NSTPVPQRTISIFPTVLHPKSRGYLTLKDNNPQTPPLIFARYLTHPDDVKTLVDGIKIAI 748
             NS     R+I IFP VL+P+SRG++ L+  +P  PP I A YLTH  DVKTLV+GIK  I
Sbjct:   443 NS-----RSIQIFPAVLNPRSRGFIGLRSADPLEPPRIVANYLTHEQDVKTLVEGIKFVI 497

Query:   749 RLTQTAALQKYGFRIDTTPVKGCENLPFGCDAYWECAIRRNTGAENHQAGSCKMGPASDP 808
             RL+QT  L++YG R+D T VKGCE   FG DAYWECA+R+NTG ENHQAGSCKMGP+ DP
Sbjct:   498 RLSQTTPLKQYGMRLDKTVVKGCEAHAFGSDAYWECAVRQNTGPENHQAGSCKMGPSHDP 557

Query:   809 SAVVSPELKVHGVDRLRVVDCSIMPAVTSGNTNAPAIMIAEKASDLIKQQWIGK 862
              AVV+ EL+VHG+  LRV+D SIMP V+SGNT+APA+MIAEK + L+K+ W  K
Sbjct:   558 MAVVNHELRVHGIRGLRVMDTSIMPKVSSGNTHAPAVMIAEKGAYLLKRAWGAK 611

GO:0004344 "glucose dehydrogenase activity" evidence=NAS;TAS

GO:0006006 "glucose metabolic process" evidence=TAS

GO:0008364 "pupal chitin-based cuticle development" evidence=TAS

GO:0042335 "cuticle development" evidence=NAS

GO:0005576 "extracellular region" evidence=NAS

GO:0046693 "sperm storage" evidence=IMP;TAS

GO:0008812 "choline dehydrogenase activity" evidence=IEA

GO:0006066 "alcohol metabolic process" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA

FB\|FBgn0030598 CG9503 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030592 CG9514 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030590 CG9518 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030591 CG9517 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0039415 CG6142 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030588 CG9521 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030587 CG9522 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030589 CG9519 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

FB\|FBgn0030586 CG12539 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P18172	DHGL_DROPS	1, ., 1, ., 9, 9, ., 1, 0	0.6286	0.5357	0.744	yes	N/A
P18173	DHGL_DROME	1, ., 1, ., 9, 9, ., 1, 0	0.6118	0.5357	0.744	yes	N/A

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.1.99	0.921

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		868
PRK02106		560	PRK02106, PRK02106, choline dehydrogenase; Validat	1e-114
COG2303		542	COG2303, BetA, Choline dehydrogenase and related f	6e-99
TIGR01810		532	TIGR01810, betA, choline dehydrogenase	2e-98
pfam00732		218	pfam00732, GMC_oxred_N, GMC oxidoreductase	9e-48
pfam05199		139	pfam05199, GMC_oxred_C, GMC oxidoreductase	5e-42
TIGR03970		487	TIGR03970, Rv0697, dehydrogenase, Rv0697 family	1e-35
TIGR03970		487	TIGR03970, Rv0697, dehydrogenase, Rv0697 family	5e-20
PRK02106		560	PRK02106, PRK02106, choline dehydrogenase; Validat	1e-17
pfam05199		139	pfam05199, GMC_oxred_C, GMC oxidoreductase	2e-17
PRK02106		560	PRK02106, PRK02106, choline dehydrogenase; Validat	2e-13
TIGR01810		532	TIGR01810, betA, choline dehydrogenase	7e-13
COG2303		542	COG2303, BetA, Choline dehydrogenase and related f	3e-12
PLN02785		587	PLN02785, PLN02785, Protein HOTHEAD	5e-12
TIGR01810		532	TIGR01810, betA, choline dehydrogenase	8e-11
COG2303		542	COG2303, BetA, Choline dehydrogenase and related f	2e-10
TIGR03970		487	TIGR03970, Rv0697, dehydrogenase, Rv0697 family	9e-09
PLN02785		587	PLN02785, PLN02785, Protein HOTHEAD	8e-07
PRK02106		560	PRK02106, PRK02106, choline dehydrogenase; Validat	1e-04
TIGR03970		487	TIGR03970, Rv0697, dehydrogenase, Rv0697 family	1e-04
PRK02106		560	PRK02106, PRK02106, choline dehydrogenase; Validat	2e-04
PLN02785		587	PLN02785, PLN02785, Protein HOTHEAD	8e-04
COG2303		542	COG2303, BetA, Choline dehydrogenase and related f	0.001
COG0579		429	COG0579, COG0579, Predicted dehydrogenase [General	0.001
TIGR03970		487	TIGR03970, Rv0697, dehydrogenase, Rv0697 family	0.002
PRK06370		463	PRK06370, PRK06370, mercuric reductase; Validated	0.003
PRK06292		460	PRK06292, PRK06292, dihydrolipoamide dehydrogenase	0.003
PTZ00058		561	PTZ00058, PTZ00058, glutathione reductase; Provisi	0.004
pfam01266		234	pfam01266, DAO, FAD dependent oxidoreductase	0.004

>gnl\|CDD\|235000 PRK02106, PRK02106, choline dehydrogenase; Validated	Back alignment and domain information

 Score =  360 bits (926), Expect = e-114
 Identities = 185/490 (37%), Positives = 251/490 (51%), Gaps = 67/490 (13%)

Query: 390 VLGGTSVLNGMMYIRGSRADYDNWAK-AGNPGWSYQDVLPYFLKSEDNQQATMMDQGFHG 448
           VLGG+S +NGM+YIRG+  DYDNWA+  G  GWSY D LPYF K+E        +  + G
Sbjct: 87  VLGGSSSINGMVYIRGNAMDYDNWAELPGLEGWSYADCLPYFKKAETRDGG---EDDYRG 143

Query: 449 VGGYLTVTQ-FPYHPPLSHSILQGAMELGMPV-RDLNGVSHTGFMIAQTTTRNGSRLSTS 506
             G L+VT+  P   PL  + ++  ++ G P   DLNG    GF     T  NG R S +
Sbjct: 144 GDGPLSVTRGKPGTNPLFQAFVEAGVQAGYPRTDDLNGYQQEGFGPMDRTVTNGRRWSAA 203

Query: 507 KAFLRPIISRNNLHILLNTTVTRVIVDPLTKAAIGVEFLTNGRLERLQAKNEVIVCAGAV 566
           +A+L P + R NL I+ +    R++ +   K A+GVE+   G  E  +A+ EVI+ AGA+
Sbjct: 204 RAYLDPALKRPNLTIVTHALTDRILFEG--KRAVGVEYERGGGRETARARREVILSAGAI 261

Query: 567 DSPRILLLSGIGPREELRRLNIAPIHDLPGVGKNLHNHVAHFLNFFINDTDT------TA 620
           +SP++L LSGIGP E L+ L I  +HDLPGVG+NL +H    L  +I            A
Sbjct: 262 NSPQLLQLSGIGPAEHLKELGIPVVHDLPGVGENLQDH----LEVYIQYECKQPVSLYPA 317

Query: 621 LNW----ATAMEYLLFRDGLMSGTGLS---EVTGFVHSRLSNPAEDNPDLQIFFSGYLAN 673
           L W        E+L    GL    G S   E  GF+ SR      D P++Q  F   L  
Sbjct: 318 LKWWNKPKIGAEWLFTGTGL----GASNHFEAGGFIRSR---AGVDWPNIQYHF---LPV 367

Query: 674 CAR-TGQVGERSDGMNNSTPVPQRTISIFPTVLHPKSRGYLTLKDNNPQTPPLIFARYLT 732
             R  G    +  G             + P  +   SRG + LK  +P+  P I   Y++
Sbjct: 368 AIRYDGSNAVKGHGF---------QAHVGP--MRSPSRGSVKLKSADPRAHPSILFNYMS 416

Query: 733 HPDDVKTLVDGIKIAIRLTQTAALQKYGFRIDTTPVKGCENLPFGC----DAYWECAIRR 788
              D +   D I++   +    AL  Y         +G E  P G     D   +  +R 
Sbjct: 417 TEQDWREFRDAIRLTREIMAQPALDPY---------RGREISP-GADVQTDEEIDAFVRE 466

Query: 789 NTGAEN--HQAGSCKMGPASDPSAVVSPELKVHGVDRLRVVDCSIMPAVTSGNTNAPAIM 846
           +  AE   H + +CKMG   DP AVV PE +VHGV+ LRVVD SIMP +T+GN NAP IM
Sbjct: 467 H--AETAYHPSCTCKMGT--DPMAVVDPEGRVHGVEGLRVVDASIMPTITNGNLNAPTIM 522

Query: 847 IAEKASDLIK 856
           IAEKA+DLI+
Sbjct: 523 IAEKAADLIR 532

Length = 560

>gnl\|CDD\|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|233581 TIGR01810, betA, choline dehydrogenase	Back alignment and domain information

>gnl\|CDD\|216089 pfam00732, GMC_oxred_N, GMC oxidoreductase	Back alignment and domain information

>gnl\|CDD\|218493 pfam05199, GMC_oxred_C, GMC oxidoreductase	Back alignment and domain information

>gnl\|CDD\|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family	Back alignment and domain information

>gnl\|CDD\|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family	Back alignment and domain information

>gnl\|CDD\|235000 PRK02106, PRK02106, choline dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|218493 pfam05199, GMC_oxred_C, GMC oxidoreductase	Back alignment and domain information

>gnl\|CDD\|235000 PRK02106, PRK02106, choline dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|233581 TIGR01810, betA, choline dehydrogenase	Back alignment and domain information

>gnl\|CDD\|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|215420 PLN02785, PLN02785, Protein HOTHEAD	Back alignment and domain information

>gnl\|CDD\|233581 TIGR01810, betA, choline dehydrogenase	Back alignment and domain information

>gnl\|CDD\|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family	Back alignment and domain information

>gnl\|CDD\|215420 PLN02785, PLN02785, Protein HOTHEAD	Back alignment and domain information

>gnl\|CDD\|235000 PRK02106, PRK02106, choline dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family	Back alignment and domain information

>gnl\|CDD\|235000 PRK02106, PRK02106, choline dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|215420 PLN02785, PLN02785, Protein HOTHEAD	Back alignment and domain information

>gnl\|CDD\|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|223652 COG0579, COG0579, Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family	Back alignment and domain information

>gnl\|CDD\|235787 PRK06370, PRK06370, mercuric reductase; Validated	Back alignment and domain information

>gnl\|CDD\|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|185420 PTZ00058, PTZ00058, glutathione reductase; Provisional	Back alignment and domain information

>gnl\|CDD\|216400 pfam01266, DAO, FAD dependent oxidoreductase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		868
KOG1238\|consensus		623		100.0
PRK02106		560	choline dehydrogenase; Validated	100.0
TIGR01810		532	betA choline dehydrogenase. This enzyme is a membe	100.0
PLN02785		587	Protein HOTHEAD	100.0
COG2303		542	BetA Choline dehydrogenase and related flavoprotei	100.0
TIGR02462		544	pyranose_ox pyranose oxidase. Pyranose oxidase (al	100.0
PF00732		296	GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001	100.0
KOG1238\|consensus		623		99.98
PF05199		144	GMC_oxred_C: GMC oxidoreductase; InterPro: IPR0078	99.97
TIGR01810		532	betA choline dehydrogenase. This enzyme is a membe	99.97
PRK02106		560	choline dehydrogenase; Validated	99.97
COG2303		542	BetA Choline dehydrogenase and related flavoprotei	99.94
PLN02785		587	Protein HOTHEAD	99.81
PF05199		144	GMC_oxred_C: GMC oxidoreductase; InterPro: IPR0078	99.77
PF00732		296	GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001	99.13
TIGR02462		544	pyranose_ox pyranose oxidase. Pyranose oxidase (al	98.75
PRK12845		564	3-ketosteroid-delta-1-dehydrogenase; Reviewed	98.65
PRK12835		584	3-ketosteroid-delta-1-dehydrogenase; Reviewed	98.61
PRK12837		513	3-ketosteroid-delta-1-dehydrogenase; Provisional	98.56
PRK12844		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	98.55
PRK07121		492	hypothetical protein; Validated	98.51
PF00890		417	FAD_binding_2: FAD binding domain of the Pfam fami	98.47
PRK07843		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	98.34
PRK08274		466	tricarballylate dehydrogenase; Validated	98.26
PLN02815		594	L-aspartate oxidase	98.23
PRK06452		566	sdhA succinate dehydrogenase flavoprotein subunit;	98.23
TIGR01813		439	flavo_cyto_c flavocytochrome c. This model describ	98.23
PRK08958		588	sdhA succinate dehydrogenase flavoprotein subunit;	98.2
PRK07573		640	sdhA succinate dehydrogenase flavoprotein subunit;	98.2
TIGR01811		603	sdhA_Bsu succinate dehydrogenase or fumarate reduc	98.2
PRK07395		553	L-aspartate oxidase; Provisional	98.2
PLN00128		635	Succinate dehydrogenase [ubiquinone] flavoprotein	98.16
PRK06175		433	L-aspartate oxidase; Provisional	98.15
PRK06481		506	fumarate reductase flavoprotein subunit; Validated	98.15
PTZ00306		1167	NADH-dependent fumarate reductase; Provisional	98.1
PRK08641		589	sdhA succinate dehydrogenase flavoprotein subunit;	98.08
PRK06263		543	sdhA succinate dehydrogenase flavoprotein subunit;	98.07
PRK12839		572	hypothetical protein; Provisional	98.06
PTZ00139		617	Succinate dehydrogenase [ubiquinone] flavoprotein	98.05
TIGR01176		580	fum_red_Fp fumarate reductase, flavoprotein subuni	98.04
PRK06134		581	putative FAD-binding dehydrogenase; Reviewed	98.03
PRK12843		578	putative FAD-binding dehydrogenase; Reviewed	98.03
TIGR01812		566	sdhA_frdA_Gneg succinate dehydrogenase or fumarate	98.02
PRK12834		549	putative FAD-binding dehydrogenase; Reviewed	98.01
PRK09231		582	fumarate reductase flavoprotein subunit; Validated	97.99
PRK12842		574	putative succinate dehydrogenase; Reviewed	97.99
PRK09078		598	sdhA succinate dehydrogenase flavoprotein subunit;	97.98
PRK05945		575	sdhA succinate dehydrogenase flavoprotein subunit;	97.98
PRK08626		657	fumarate reductase flavoprotein subunit; Provision	97.95
PRK07804		541	L-aspartate oxidase; Provisional	97.94
PRK07057		591	sdhA succinate dehydrogenase flavoprotein subunit;	97.92
PRK07512		513	L-aspartate oxidase; Provisional	97.92
TIGR00551		488	nadB L-aspartate oxidase. L-aspartate oxidase is t	97.9
PRK09077		536	L-aspartate oxidase; Provisional	97.87
PRK06069		577	sdhA succinate dehydrogenase flavoprotein subunit;	97.86
PRK07803		626	sdhA succinate dehydrogenase flavoprotein subunit;	97.84
PRK08071		510	L-aspartate oxidase; Provisional	97.82
TIGR02485		432	CobZ_N-term precorrin 3B synthase CobZ. CobZ is es	97.79
PRK08205		583	sdhA succinate dehydrogenase flavoprotein subunit;	97.77
PRK08275		554	putative oxidoreductase; Provisional	97.7
PRK11101		546	glpA sn-glycerol-3-phosphate dehydrogenase subunit	97.68
PRK06854		608	adenylylsulfate reductase subunit alpha; Validated	97.59
PF01266		358	DAO: FAD dependent oxidoreductase; InterPro: IPR00	97.59
TIGR02061		614	aprA adenosine phosphosulphate reductase, alpha su	97.52
PRK05675		570	sdhA succinate dehydrogenase flavoprotein subunit;	97.52
COG0029		518	NadB Aspartate oxidase [Coenzyme metabolism]	97.5
PRK08401		466	L-aspartate oxidase; Provisional	97.42
PRK13800		897	putative oxidoreductase/HEAT repeat-containing pro	97.33
COG1053		562	SdhA Succinate dehydrogenase/fumarate reductase, f	97.27
PRK13977		576	myosin-cross-reactive antigen; Provisional	97.22
TIGR01816		565	sdhA_forward succinate dehydrogenase, flavoprotein	97.17
PTZ00058		561	glutathione reductase; Provisional	97.15
KOG2404\|consensus		477		97.13
COG0644		396	FixC Dehydrogenases (flavoproteins) [Energy produc	97.1
PRK10157		428	putative oxidoreductase FixC; Provisional	97.1
PF01946		230	Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K.	97.06
KOG1298\|consensus		509		97.02
PRK12409		410	D-amino acid dehydrogenase small subunit; Provisio	96.98
PRK10015		429	oxidoreductase; Provisional	96.98
COG0579		429	Predicted dehydrogenase [General function predicti	96.98
PF03486		409	HI0933_like: HI0933-like protein; InterPro: IPR004	96.81
COG2081		408	Predicted flavoproteins [General function predicti	96.78
TIGR00292		254	thiazole biosynthesis enzyme. This enzyme is invol	96.78
PLN00093		450	geranylgeranyl diphosphate reductase; Provisional	96.74
PTZ00363		443	rab-GDP dissociation inhibitor; Provisional	96.71
TIGR01423		486	trypano_reduc trypanothione-disulfide reductase. T	96.63
TIGR01421		450	gluta_reduc_1 glutathione-disulfide reductase, ani	96.6
COG1249		454	Lpd Pyruvate/2-oxoglutarate dehydrogenase complex,	96.59
PRK06115		466	dihydrolipoamide dehydrogenase; Reviewed	96.58
PF13450		68	NAD_binding_8: NAD(P)-binding Rossmann-like domain	96.57
PRK08010		441	pyridine nucleotide-disulfide oxidoreductase; Prov	96.56
PRK11728		393	hydroxyglutarate oxidase; Provisional	96.51
PRK06467		471	dihydrolipoamide dehydrogenase; Reviewed	96.49
PRK04176		257	ribulose-1,5-biphosphate synthetase; Provisional	96.47
TIGR01424		446	gluta_reduc_2 glutathione-disulfide reductase, pla	96.46
COG0562		374	Glf UDP-galactopyranose mutase [Cell envelope biog	96.43
PRK04176		257	ribulose-1,5-biphosphate synthetase; Provisional	96.41
PLN02661		357	Putative thiazole synthesis	96.41
PRK06416		462	dihydrolipoamide dehydrogenase; Reviewed	96.41
PRK05257		494	malate:quinone oxidoreductase; Validated	96.4
PRK05249		461	soluble pyridine nucleotide transhydrogenase; Prov	96.4
PLN02661		357	Putative thiazole synthesis	96.38
TIGR02032		295	GG-red-SF geranylgeranyl reductase family. This mo	96.35
TIGR02023		388	BchP-ChlP geranylgeranyl reductase. This model rep	96.34
TIGR01320		483	mal_quin_oxido malate:quinone-oxidoreductase. This	96.34
PRK05976		472	dihydrolipoamide dehydrogenase; Validated	96.33
PRK13339		497	malate:quinone oxidoreductase; Reviewed	96.33
PF12831		428	FAD_oxidored: FAD dependent oxidoreductase; PDB: 3	96.32
TIGR01350		461	lipoamide_DH dihydrolipoamide dehydrogenase. The m	96.32
PRK00711		416	D-amino acid dehydrogenase small subunit; Validate	96.31
PRK06116		450	glutathione reductase; Validated	96.31
PRK13748		561	putative mercuric reductase; Provisional	96.31
PLN02464		627	glycerol-3-phosphate dehydrogenase	96.31
PLN02507		499	glutathione reductase	96.3
PRK07251		438	pyridine nucleotide-disulfide oxidoreductase; Prov	96.29
PTZ00153		659	lipoamide dehydrogenase; Provisional	96.29
PRK14694		468	putative mercuric reductase; Provisional	96.23
PRK12409		410	D-amino acid dehydrogenase small subunit; Provisio	96.21
COG1635		262	THI4 Ribulose 1,5-bisphosphate synthetase, convert	96.19
PRK05192		618	tRNA uridine 5-carboxymethylaminomethyl modificati	96.19
TIGR01377		380	soxA_mon sarcosine oxidase, monomeric form. Sarcos	96.17
PRK12845		564	3-ketosteroid-delta-1-dehydrogenase; Reviewed	96.15
COG0579		429	Predicted dehydrogenase [General function predicti	96.14
TIGR00292		254	thiazole biosynthesis enzyme. This enzyme is invol	96.14
PRK11728		393	hydroxyglutarate oxidase; Provisional	96.13
PF01494		356	FAD_binding_3: FAD binding domain; InterPro: IPR00	96.1
PTZ00383		497	malate:quinone oxidoreductase; Provisional	96.1
PRK06370		463	mercuric reductase; Validated	96.1
PLN02546		558	glutathione reductase	96.08
TIGR01373		407	soxB sarcosine oxidase, beta subunit family, heter	96.06
TIGR03329		460	Phn_aa_oxid putative aminophosphonate oxidoreducta	96.05
PRK08020		391	ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin	96.05
TIGR00031		377	UDP-GALP_mutase UDP-galactopyranose mutase. The ge	96.05
PRK13369		502	glycerol-3-phosphate dehydrogenase; Provisional	96.03
TIGR02053		463	MerA mercuric reductase. This model represents the	96.03
TIGR03377		516	glycerol3P_GlpA glycerol-3-phosphate dehydrogenase	96.03
PRK11101		546	glpA sn-glycerol-3-phosphate dehydrogenase subunit	96.02
TIGR01789		370	lycopene_cycl lycopene cyclase. This model represe	96.02
PRK07608		388	ubiquinone biosynthesis hydroxylase family protein	96.01
PF05834		374	Lycopene_cycl: Lycopene cyclase protein; InterPro:	95.98
PF12831		428	FAD_oxidored: FAD dependent oxidoreductase; PDB: 3	95.96
PF03486		409	HI0933_like: HI0933-like protein; InterPro: IPR004	95.96
PRK09126		392	hypothetical protein; Provisional	95.93
PLN02463		447	lycopene beta cyclase	95.92
TIGR02028		398	ChlP geranylgeranyl reductase. This model represen	95.92
PRK06327		475	dihydrolipoamide dehydrogenase; Validated	95.9
TIGR03364		365	HpnW_proposed FAD dependent oxidoreductase TIGR033	95.89
PRK06481		506	fumarate reductase flavoprotein subunit; Validated	95.87
COG0578		532	GlpA Glycerol-3-phosphate dehydrogenase [Energy pr	95.87
PRK11259		376	solA N-methyltryptophan oxidase; Provisional	95.87
PRK07121		492	hypothetical protein; Validated	95.86
PRK07364		415	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	95.86
TIGR03329		460	Phn_aa_oxid putative aminophosphonate oxidoreducta	95.84
PF01266		358	DAO: FAD dependent oxidoreductase; InterPro: IPR00	95.83
PRK12266		508	glpD glycerol-3-phosphate dehydrogenase; Reviewed	95.83
PRK11445		351	putative oxidoreductase; Provisional	95.82
PRK12835		584	3-ketosteroid-delta-1-dehydrogenase; Reviewed	95.8
PRK07333		403	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	95.8
TIGR01373		407	soxB sarcosine oxidase, beta subunit family, heter	95.79
PRK12837		513	3-ketosteroid-delta-1-dehydrogenase; Provisional	95.79
TIGR01320		483	mal_quin_oxido malate:quinone-oxidoreductase. This	95.78
PLN02985		514	squalene monooxygenase	95.74
PRK07494		388	2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio	95.73
PRK07045		388	putative monooxygenase; Reviewed	95.73
PRK07818		466	dihydrolipoamide dehydrogenase; Reviewed	95.71
PRK06292		460	dihydrolipoamide dehydrogenase; Validated	95.71
PRK14727		479	putative mercuric reductase; Provisional	95.68
KOG3855\|consensus		481		95.68
PRK08773		392	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	95.68
COG1233		487	Phytoene dehydrogenase and related proteins [Secon	95.68
PLN02464		627	glycerol-3-phosphate dehydrogenase	95.68
PRK01747		662	mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans	95.67
PLN02697		529	lycopene epsilon cyclase	95.66
TIGR01377		380	soxA_mon sarcosine oxidase, monomeric form. Sarcos	95.66
KOG0405\|consensus		478		95.65
PTZ00052		499	thioredoxin reductase; Provisional	95.6
PRK08274		466	tricarballylate dehydrogenase; Validated	95.6
PRK08013		400	oxidoreductase; Provisional	95.59
TIGR01790		388	carotene-cycl lycopene cyclase family protein. Thi	95.53
PRK00711		416	D-amino acid dehydrogenase small subunit; Validate	95.5
PRK12842		574	putative succinate dehydrogenase; Reviewed	95.49
PRK05714		405	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	95.48
TIGR03364		365	HpnW_proposed FAD dependent oxidoreductase TIGR033	95.47
PRK12844		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	95.45
TIGR01989		437	COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T	95.39
TIGR02730		493	carot_isom carotene isomerase. Members of this fam	95.38
PF00890		417	FAD_binding_2: FAD binding domain of the Pfam fami	95.37
PTZ00367		567	squalene epoxidase; Provisional	95.35
PRK06996		398	hypothetical protein; Provisional	95.32
COG2081		408	Predicted flavoproteins [General function predicti	95.24
KOG0042\|consensus		680		95.23
TIGR01988		385	Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub	95.22
PTZ00383		497	malate:quinone oxidoreductase; Provisional	95.22
TIGR03452		452	mycothione_red mycothione reductase. Mycothiol, a	95.21
KOG2665\|consensus		453		95.19
PRK08849		384	2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy	95.18
PRK06185		407	hypothetical protein; Provisional	95.15
PRK13369		502	glycerol-3-phosphate dehydrogenase; Provisional	95.15
PRK07846		451	mycothione reductase; Reviewed	95.12
TIGR00275		400	flavoprotein, HI0933 family. The model when search	95.12
PRK06617		374	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	95.12
TIGR01984		382	UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T	95.06
TIGR01292		300	TRX_reduct thioredoxin-disulfide reductase. This m	95.05
PF01946		230	Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K.	95.03
PRK05732		395	2-octaprenyl-6-methoxyphenyl hydroxylase; Validate	94.98
PRK08244		493	hypothetical protein; Provisional	94.9
TIGR01438		484	TGR thioredoxin and glutathione reductase selenopr	94.86
PRK08850		405	2-octaprenyl-6-methoxyphenol hydroxylase; Validate	94.86
TIGR01813		439	flavo_cyto_c flavocytochrome c. This model describ	94.85
PRK07190		487	hypothetical protein; Provisional	94.81
PRK11259		376	solA N-methyltryptophan oxidase; Provisional	94.79
PRK06834		488	hypothetical protein; Provisional	94.78
COG3380		331	Predicted NAD/FAD-dependent oxidoreductase [Genera	94.74
PF01134		392	GIDA: Glucose inhibited division protein A; InterP	94.7
PRK08243		392	4-hydroxybenzoate 3-monooxygenase; Validated	94.69
PRK08275		554	putative oxidoreductase; Provisional	94.68
PRK05257		494	malate:quinone oxidoreductase; Validated	94.66
PRK06854		608	adenylylsulfate reductase subunit alpha; Validated	94.66
PRK06184		502	hypothetical protein; Provisional	94.63
COG0654		387	UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and	94.63
PLN02576		496	protoporphyrinogen oxidase	94.56
PRK07843		557	3-ketosteroid-delta-1-dehydrogenase; Reviewed	94.54
PRK07395		553	L-aspartate oxidase; Provisional	94.54
PRK06183		538	mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va	94.53
TIGR02360		390	pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase.	94.52
KOG2415\|consensus		621		94.47
PRK05945		575	sdhA succinate dehydrogenase flavoprotein subunit;	94.46
PRK12834		549	putative FAD-binding dehydrogenase; Reviewed	94.44
TIGR00562		462	proto_IX_ox protoporphyrinogen oxidase. This prote	94.41
PF13738		203	Pyr_redox_3: Pyridine nucleotide-disulphide oxidor	94.39
PRK07588		391	hypothetical protein; Provisional	94.39
PRK06175		433	L-aspartate oxidase; Provisional	94.38
TIGR03143		555	AhpF_homolog putative alkyl hydroperoxide reductas	94.37
COG3573		552	Predicted oxidoreductase [General function predict	94.32
PRK11883		451	protoporphyrinogen oxidase; Reviewed	94.3
PRK07804		541	L-aspartate oxidase; Provisional	94.3
PRK06753		373	hypothetical protein; Provisional	94.29
PRK06847		375	hypothetical protein; Provisional	94.28
TIGR02733		492	desat_CrtD C-3',4' desaturase CrtD. Members of thi	94.28
TIGR02352		337	thiamin_ThiO glycine oxidase ThiO. This family con	94.27
PRK12843		578	putative FAD-binding dehydrogenase; Reviewed	94.27
COG2072		443	TrkA Predicted flavoprotein involved in K+ transpo	94.19
COG1231		450	Monoamine oxidase [Amino acid transport and metabo	94.14
PRK05329		422	anaerobic glycerol-3-phosphate dehydrogenase subun	94.13
PRK07236		386	hypothetical protein; Provisional	94.07
KOG0029\|consensus		501		94.0
PRK07208		479	hypothetical protein; Provisional	93.98
PRK12839		572	hypothetical protein; Provisional	93.97
PRK09077		536	L-aspartate oxidase; Provisional	93.96
PLN02268		435	probable polyamine oxidase	93.94
PTZ00139		617	Succinate dehydrogenase [ubiquinone] flavoprotein	93.92
PRK06134		581	putative FAD-binding dehydrogenase; Reviewed	93.83
PRK12266		508	glpD glycerol-3-phosphate dehydrogenase; Reviewed	93.78
PRK08958		588	sdhA succinate dehydrogenase flavoprotein subunit;	93.78
PRK08205		583	sdhA succinate dehydrogenase flavoprotein subunit;	93.76
PRK08163		396	salicylate hydroxylase; Provisional	93.76
PRK06126		545	hypothetical protein; Provisional	93.75
PRK09231		582	fumarate reductase flavoprotein subunit; Validated	93.74
PRK07538		413	hypothetical protein; Provisional	93.74
PRK06452		566	sdhA succinate dehydrogenase flavoprotein subunit;	93.73
PRK08401		466	L-aspartate oxidase; Provisional	93.67
COG0665		387	DadA Glycine/D-amino acid oxidases (deaminating) [	93.67
PRK08294		634	phenol 2-monooxygenase; Provisional	93.66
PLN02172		461	flavin-containing monooxygenase FMO GS-OX	93.65
COG1635		262	THI4 Ribulose 1,5-bisphosphate synthetase, convert	93.64
PRK07803		626	sdhA succinate dehydrogenase flavoprotein subunit;	93.59
PLN02815		594	L-aspartate oxidase	93.59
PF07992		201	Pyr_redox_2: Pyridine nucleotide-disulphide oxidor	93.58
PRK08132		547	FAD-dependent oxidoreductase; Provisional	93.57
PRK06069		577	sdhA succinate dehydrogenase flavoprotein subunit;	93.57
PLN02676		487	polyamine oxidase	93.57
PLN02172		461	flavin-containing monooxygenase FMO GS-OX	93.56
PRK09078		598	sdhA succinate dehydrogenase flavoprotein subunit;	93.55
KOG4716\|consensus		503		93.48
TIGR01176		580	fum_red_Fp fumarate reductase, flavoprotein subuni	93.47
COG3573		552	Predicted oxidoreductase [General function predict	93.44
PRK06912		458	acoL dihydrolipoamide dehydrogenase; Validated	93.35
PRK07057		591	sdhA succinate dehydrogenase flavoprotein subunit;	93.34
PRK10157		428	putative oxidoreductase FixC; Provisional	93.18
PRK06263		543	sdhA succinate dehydrogenase flavoprotein subunit;	93.15
PF01134		392	GIDA: Glucose inhibited division protein A; InterP	93.09
TIGR02734		502	crtI_fam phytoene desaturase. Phytoene is converte	93.07
PLN00128		635	Succinate dehydrogenase [ubiquinone] flavoprotein	93.04
PLN02568		539	polyamine oxidase	93.03
PRK08626		657	fumarate reductase flavoprotein subunit; Provision	93.03
TIGR01812		566	sdhA_frdA_Gneg succinate dehydrogenase or fumarate	93.01
PRK12416		463	protoporphyrinogen oxidase; Provisional	93.01
TIGR00136		617	gidA glucose-inhibited division protein A. GidA, t	92.98
PRK05868		372	hypothetical protein; Validated	92.95
PRK08071		510	L-aspartate oxidase; Provisional	92.93
PRK07573		640	sdhA succinate dehydrogenase flavoprotein subunit;	92.92
COG0578		532	GlpA Glycerol-3-phosphate dehydrogenase [Energy pr	92.9
PRK07233		434	hypothetical protein; Provisional	92.84
PTZ00306		1167	NADH-dependent fumarate reductase; Provisional	92.82
PRK05335		436	tRNA (uracil-5-)-methyltransferase Gid; Reviewed	92.74
PF06039		488	Mqo: Malate:quinone oxidoreductase (Mqo); InterPro	92.68
PF06039		488	Mqo: Malate:quinone oxidoreductase (Mqo); InterPro	92.6
PRK05192		618	tRNA uridine 5-carboxymethylaminomethyl modificati	92.57
PF04820		454	Trp_halogenase: Tryptophan halogenase; InterPro: I	92.5
COG0492		305	TrxB Thioredoxin reductase [Posttranslational modi	92.46
COG3380		331	Predicted NAD/FAD-dependent oxidoreductase [Genera	92.43
TIGR00551		488	nadB L-aspartate oxidase. L-aspartate oxidase is t	92.41
TIGR03378		419	glycerol3P_GlpB glycerol-3-phosphate dehydrogenase	92.16
PRK08641		589	sdhA succinate dehydrogenase flavoprotein subunit;	92.08
PRK10262		321	thioredoxin reductase; Provisional	92.02
TIGR03219		414	salicylate_mono salicylate 1-monooxygenase. Member	91.95
TIGR00275		400	flavoprotein, HI0933 family. The model when search	91.87
TIGR02061		614	aprA adenosine phosphosulphate reductase, alpha su	91.84
TIGR03315		1012	Se_ygfK putative selenate reductase, YgfK subunit.	91.77
PRK13800		897	putative oxidoreductase/HEAT repeat-containing pro	91.7
PF00996		438	GDI: GDP dissociation inhibitor; InterPro: IPR0182	91.5
PLN02927		668	antheraxanthin epoxidase/zeaxanthin epoxidase	91.25
COG1232		444	HemY Protoporphyrinogen oxidase [Coenzyme metaboli	91.23
COG1053		562	SdhA Succinate dehydrogenase/fumarate reductase, f	91.19
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	91.06
PRK07512		513	L-aspartate oxidase; Provisional	91.0
TIGR00137		433	gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo	90.95
COG1252		405	Ndh NADH dehydrogenase, FAD-containing subunit [En	90.9
TIGR02731		453	phytoene_desat phytoene desaturase. Plants and cya	90.88
PRK06475		400	salicylate hydroxylase; Provisional	90.84
KOG2820\|consensus		399		90.82
TIGR01316		449	gltA glutamate synthase (NADPH), homotetrameric. T	90.71
COG2509		486	Uncharacterized FAD-dependent dehydrogenases [Gene	90.68
PRK12831		464	putative oxidoreductase; Provisional	90.67
PRK12810		471	gltD glutamate synthase subunit beta; Reviewed	90.63
KOG2960\|consensus		328		90.48
PRK11749		457	dihydropyrimidine dehydrogenase subunit A; Provisi	90.3
PRK10015		429	oxidoreductase; Provisional	90.22
TIGR01372		985	soxA sarcosine oxidase, alpha subunit family, hete	90.12
COG3349		485	Uncharacterized conserved protein [Function unknow	89.99
PF13738		203	Pyr_redox_3: Pyridine nucleotide-disulphide oxidor	89.82
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	89.68
KOG1335\|consensus		506		89.51
PRK01747		662	mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans	89.41
PRK07845		466	flavoprotein disulfide reductase; Reviewed	89.25
KOG0685\|consensus		498		89.18
COG3075		421	GlpB Anaerobic glycerol-3-phosphate dehydrogenase	88.75
PLN02612		567	phytoene desaturase	88.68
PF00070		80	Pyr_redox: Pyridine nucleotide-disulphide oxidored	88.6
PLN02529		738	lysine-specific histone demethylase 1	88.41
PLN02852		491	ferredoxin-NADP+ reductase	88.23
PRK13977		576	myosin-cross-reactive antigen; Provisional	88.22
TIGR02732		474	zeta_caro_desat carotene 7,8-desaturase. Carotene	88.08
PRK12770		352	putative glutamate synthase subunit beta; Provisio	88.08
PRK08255		765	salicylyl-CoA 5-hydroxylase; Reviewed	87.97
COG0665		387	DadA Glycine/D-amino acid oxidases (deaminating) [	87.92
PRK12775		1006	putative trifunctional 2-polyprenylphenol hydroxyl	87.78
KOG2614\|consensus		420		87.78
COG0445		621	GidA Flavin-dependent tRNA uridine 5-carboxymethyl	87.62
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	87.29
PRK12778		752	putative bifunctional 2-polyprenylphenol hydroxyla	87.06
TIGR03378		419	glycerol3P_GlpB glycerol-3-phosphate dehydrogenase	87.06
PRK09853		1019	putative selenate reductase subunit YgfK; Provisio	86.94
TIGR01811		603	sdhA_Bsu succinate dehydrogenase or fumarate reduc	86.93
PLN02487		569	zeta-carotene desaturase	86.82
PRK12814		652	putative NADPH-dependent glutamate synthase small	86.79
KOG2853\|consensus		509		86.71
PLN02328		808	lysine-specific histone demethylase 1 homolog	86.63
PRK05329		422	anaerobic glycerol-3-phosphate dehydrogenase subun	86.44
COG1148		622	HdrA Heterodisulfide reductase, subunit A and rela	85.88
PLN02976		1713	amine oxidase	85.65
KOG1399\|consensus		448		85.43
PF00743		531	FMO-like: Flavin-binding monooxygenase-like; Inter	85.3
KOG2404\|consensus		477		85.24
PRK09897		534	hypothetical protein; Provisional	85.07
TIGR01318		467	gltD_gamma_fam glutamate synthase small subunit fa	84.99
TIGR00136		617	gidA glucose-inhibited division protein A. GidA, t	84.51
KOG0042\|consensus		680		84.38
COG2072		443	TrkA Predicted flavoprotein involved in K+ transpo	84.08
COG0029		518	NadB Aspartate oxidase [Coenzyme metabolism]	83.65
PF13450		68	NAD_binding_8: NAD(P)-binding Rossmann-like domain	83.48
TIGR03862		376	flavo_PP4765 uncharacterized flavoprotein, PP_4765	83.41
PRK13339		497	malate:quinone oxidoreductase; Reviewed	83.3
PRK12779		944	putative bifunctional glutamate synthase subunit b	83.21
TIGR01317		485	GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal	83.13
PLN03000		881	amine oxidase	83.06
PF13434		341	K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi	82.7
TIGR02485		432	CobZ_N-term precorrin 3B synthase CobZ. CobZ is es	82.6
KOG2311\|consensus		679		82.51
KOG4254\|consensus		561		82.42
KOG2755\|consensus		334		81.85
KOG3851\|consensus		446		81.84
KOG1439\|consensus		440		81.83
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	81.41
PTZ00318		424	NADH dehydrogenase-like protein; Provisional	80.78
PRK06184		502	hypothetical protein; Provisional	80.48
PRK09754		396	phenylpropionate dioxygenase ferredoxin reductase	80.37
PRK13512		438	coenzyme A disulfide reductase; Provisional	80.25
PTZ00188		506	adrenodoxin reductase; Provisional	80.21

>KOG1238\|consensus	Back alignment and domain information

Probab=100.00  E-value=4.7e-113  Score=954.59  Aligned_cols=471  Identities=46%  Similarity=0.775  Sum_probs=425.7

Q ss_pred             eeechhHHhhhccccCChHHHHHHHHcCCCCCChhchHHHHHHhccCCCCCCCCCCccCCCcceeeccCCCCChhHHHHH
Q psy1205         390 VLGGTSVLNGMMYIRGSRADYDNWAKAGNPGWSYQDVLPYFLKSEDNQQATMMDQGFHGVGGYLTVTQFPYHPPLSHSIL  469 (868)
Q Consensus       390 ~lGGsS~in~~~~~r~~~~df~~W~~~G~~~Ws~~~l~pyy~k~e~~~~~~~~~~~~~g~~Gp~~~~~~~~~~~~~~~~~  469 (868)
                      +|||||++|+|+|.|++++|||+|++.|++||+|++++|||+|+|+.........++|+..||..++...+.+++...+.
T Consensus       139 VLGGsS~iN~m~Y~RG~r~Dyd~W~~~gnpgW~y~~vl~yf~k~E~~~~~~~~~~~y~~~~g~~~ve~~~~~~~~~~~~~  218 (623)
T KOG1238|consen  139 VLGGSSVLNAMFYVRGNRRDYDRWAAEGNPGWSYDEVLPYFKKSEDKVVPDPELTPYHGAGGPLLVEAGVYPNNLFTAFH  218 (623)
T ss_pred             eecccccccceEEecCCccchHHHHHhcCCCCCHHHHHHHHHHHhhccCCCcccCcccccCCcceeccccccCchhhHhH
Confidence            99999999999999999999999999999999999999999999998766666667999999999999999999999999


Q ss_pred             HHHHHCCCCCCCCCCCCcceeeeeeccCCCCcccchhhhhhhhccC-CCCeEEEccceEeEEEEcCCCCeEEEEEEEEC-
Q psy1205         470 QGAMELGMPVRDLNGVSHTGFMIAQTTTRNGSRLSTSKAFLRPIIS-RNNLHILLNTTVTRVIVDPLTKAAIGVEFLTN-  547 (868)
Q Consensus       470 ~a~~~lG~~~~~~n~~~~~G~~~~~~~~~~g~R~s~~~~~L~~~~~-~~nl~I~~~~~V~rIl~d~~~~~a~GV~~~~~-  547 (868)
                      ++..++|.+..|+||..+.|+...+.+.++|.|+++..+|+.++.. |+||+|..++.|+||++|+.++++.||++.++ 
T Consensus       219 ~ag~e~G~~~~D~nG~~~tg~~~l~~t~~~g~R~s~~~a~l~~~~~~R~NL~~~~~~~vtrvl~D~~~~~a~gv~~~~~~  298 (623)
T KOG1238|consen  219 RAGTEIGGSIFDRNGERHTGASLLQYTIRNGIRVSLAKAYLKPIRLTRPNLHISRNAAVTRVLIDPAGKRAKGVEFVRDG  298 (623)
T ss_pred             HhHHhcCCCccCCCCccccchhhhhccccCCEEEEehhhhhhhhhccCccccccccceEEEEEEcCCCceEEEEEEEecC
Confidence            9999999888999999999999999999999999999999999988 89999999999999999999999999999998 


Q ss_pred             CeEEEEEeccEEEEccCCcCchHHHHhcCCCChhhhhhcCCCcccCCCCCcccccccccceEEEEEcCCcccc----cCH
Q psy1205         548 GRLERLQAKNEVIVCAGAVDSPRILLLSGIGPREELRRLNIAPIHDLPGVGKNLHNHVAHFLNFFINDTDTTA----LNW  623 (868)
Q Consensus       548 g~~~~v~A~k~VILAAGai~SP~LLl~SGIGp~~~L~~~gI~~~~dlp~VG~nL~dH~~~~~~~~~~~~~~~~----~~~  623 (868)
                      +++++|+|+||||||||||+||||||+|||||++||+++|||++.|||+||+|||||+..++......+....    ...
T Consensus       299 ~~~~~v~a~kEVILSAGAi~SPQLLMLSGIGP~~~L~~~gIpvv~dLP~VG~nLqDH~~~~~~~~~~~~~~~~~~~~~~~  378 (623)
T KOG1238|consen  299 GKEHTVKARKEVILSAGAINSPQLLMLSGIGPADHLKKLGIPVVLDLPGVGQNLQDHPMNPGFVFSTNPVELSLIRLVGI  378 (623)
T ss_pred             ceeeeecccceEEEeccccCCHHHHHHcCCCcHHHHHhcCCCeeccCcccccccccccccceeeecCCCccccccccccc
Confidence            8999999999999999999999999999999999999999999999999999999999997776665543222    235


Q ss_pred             HHHHHHHHhCCCCCcCCCcceEEEEEecCCCCCCCCCCCeEEEeecccccccccCc----cccccCCCCCCCCCCCCeEE
Q psy1205         624 ATAMEYLLFRDGLMSGTGLSEVTGFVHSRLSNPAEDNPDLQIFFSGYLANCARTGQ----VGERSDGMNNSTPVPQRTIS  699 (868)
Q Consensus       624 ~~~~~~~~~~~G~~~~~g~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~  699 (868)
                      ..+.+|+..++|++...+ .+..+|+++.......++||+|+++............    .++..+.+.. .....+.+.
T Consensus       379 ~~~~~yl~~~~G~~~~~~-~e~~~f~~t~~~~~~~~~PD~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~-~~~~~~~~~  456 (623)
T KOG1238|consen  379 TTVGQYLEGGSGPLASPG-VETLGFINTVSSNLSLDWPDIELHFVAGSLSSDGLTALRKALGEIYQALFG-ELTNSDSFV  456 (623)
T ss_pred             hHHHHHHHcCCCCcccCc-ceeeEEeccccccCcCCCCCeeEEeccccccccchhhhhhhcchHHHHhhh-hhhcCceeE
Confidence            678899999999998877 7889999999888778999999877654433221111    1111111110 011234688


Q ss_pred             EEEeeeecCCCcEEEecCCCCCCCCeeccCCCCChhHHHHHHHHHHHHHHHHcchhHhhcCcccccCCCCCCCCCCCCCH
Q psy1205         700 IFPTVLHPKSRGYLTLKDNNPQTPPLIFARYLTHPDDVKTLVDGIKIAIRLTQTAALQKYGFRIDTTPVKGCENLPFGCD  779 (868)
Q Consensus       700 ~~~~~~~P~s~G~V~L~s~d~~~~P~i~~~y~~~~~D~~~~~~~~~~~~~i~~~~~~~~~g~~~~~~p~~~~~~~~~~sd  779 (868)
                      ++..+++|+|||+|+|+|+||++.|+|++||+.+|+|+++++++++.+.++.++++|++++..+...+.++|+.+.+.+|
T Consensus       457 i~~~~l~P~SrG~l~L~s~nP~~~P~I~~NY~~~p~Dv~~~vegi~~~~~l~~s~af~~~~~r~~~~~~~~c~~~~~~sd  536 (623)
T KOG1238|consen  457 IFPKLLRPKSRGRLKLRSTNPRDNPLITPNYFTHPEDVATLVEGIRTIIRLSNSKAFQRFGARLWKKPVPGCDLLAFLSD  536 (623)
T ss_pred             EeehhcCCCccceEEecCCCCCcCceeccCcCCCHHHHHHHHHHHHHHHHHHcCHHHHHhcchhccccCCCcccccCCCH
Confidence            88899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhccCCcccccccccccCCCCCCCccCCCCcEeccCCcEEeccCCCCCCCCccchHHHHHHHHHHHHHHHHHh
Q psy1205         780 AYWECAIRRNTGAENHQAGSCKMGPASDPSAVVSPELKVHGVDRLRVVDCSIMPAVTSGNTNAPAIMIAEKASDLIKQQW  859 (868)
Q Consensus       780 ~~~~~~i~~~~~t~~H~~GTcrMG~~~dp~~VVD~~lrV~Gv~nL~V~DaSv~P~~~~~NP~~Ti~alAeraAd~I~~~~  859 (868)
                      +||+|++|....|.||++|||+|||+.||.+|||+++||||++||||+||||||.++++||++|+||||||+||+|+++|
T Consensus       537 ~yw~c~~R~~~~TiyH~~GtckMGp~~D~~aVVD~~lrV~Gv~~LRVVDaSimP~~psgN~nA~v~MIgek~ad~Ik~~~  616 (623)
T KOG1238|consen  537 AYWECFCRHTVVTIYHYSGTCKMGPSSDPTAVVDPQLRVHGVRGLRVVDASIMPESPSGNPNAPVMMIGEKAADMIKEEW  616 (623)
T ss_pred             HHHHHHHHhccceeeccCCceEeCCccCCCcccCCcceeccccCceEeeccccCCCCCCCccHHHHHHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccc
Q psy1205         860 IGK  862 (868)
Q Consensus       860 ~~~  862 (868)
                      ...
T Consensus       617 ~~~  619 (623)
T KOG1238|consen  617 LAN  619 (623)
T ss_pred             hhc
Confidence            764

>PRK02106 choline dehydrogenase; Validated	Back alignment and domain information

>TIGR01810 betA choline dehydrogenase	Back alignment and domain information

>PLN02785 Protein HOTHEAD	Back alignment and domain information

>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02462 pyranose_ox pyranose oxidase	Back alignment and domain information

>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>KOG1238\|consensus	Back alignment and domain information

>PF05199 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR007867 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>TIGR01810 betA choline dehydrogenase	Back alignment and domain information

>PRK02106 choline dehydrogenase; Validated	Back alignment and domain information

>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02785 Protein HOTHEAD	Back alignment and domain information

>PF05199 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR007867 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ]	Back alignment and domain information

>TIGR02462 pyranose_ox pyranose oxidase	Back alignment and domain information

>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK07121 hypothetical protein; Validated	Back alignment and domain information

>PF00890 FAD_binding_2: FAD binding domain of the Pfam family	Back alignment and domain information

>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK08274 tricarballylate dehydrogenase; Validated	Back alignment and domain information

>PLN02815 L-aspartate oxidase	Back alignment and domain information

>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR01813 flavo_cyto_c flavocytochrome c	Back alignment and domain information

>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup	Back alignment and domain information

>PRK07395 L-aspartate oxidase; Provisional	Back alignment and domain information

>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit	Back alignment and domain information

>PRK06175 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK06481 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>PTZ00306 NADH-dependent fumarate reductase; Provisional	Back alignment and domain information

>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK12839 hypothetical protein; Provisional	Back alignment and domain information

>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional	Back alignment and domain information

>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit	Back alignment and domain information

>PRK06134 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PRK12843 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup	Back alignment and domain information

>PRK12834 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PRK09231 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>PRK12842 putative succinate dehydrogenase; Reviewed	Back alignment and domain information

>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK08626 fumarate reductase flavoprotein subunit; Provisional	Back alignment and domain information

>PRK07804 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07512 L-aspartate oxidase; Provisional	Back alignment and domain information

>TIGR00551 nadB L-aspartate oxidase	Back alignment and domain information

>PRK09077 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK08071 L-aspartate oxidase; Provisional	Back alignment and domain information

>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ	Back alignment and domain information

>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK08275 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional	Back alignment and domain information

>PRK06854 adenylylsulfate reductase subunit alpha; Validated	Back alignment and domain information

>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1	Back alignment and domain information

>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit	Back alignment and domain information

>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>COG0029 NadB Aspartate oxidase [Coenzyme metabolism]	Back alignment and domain information

>PRK08401 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional	Back alignment and domain information

>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion]	Back alignment and domain information

>PRK13977 myosin-cross-reactive antigen; Provisional	Back alignment and domain information

>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E	Back alignment and domain information

>PTZ00058 glutathione reductase; Provisional	Back alignment and domain information

>KOG2404\|consensus	Back alignment and domain information

>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion]	Back alignment and domain information

>PRK10157 putative oxidoreductase FixC; Provisional	Back alignment and domain information

>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K	Back alignment and domain information

>KOG1298\|consensus	Back alignment and domain information

>PRK12409 D-amino acid dehydrogenase small subunit; Provisional	Back alignment and domain information

>PRK10015 oxidoreductase; Provisional	Back alignment and domain information

>COG0579 Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases	Back alignment and domain information

>COG2081 Predicted flavoproteins [General function prediction only]	Back alignment and domain information

>TIGR00292 thiazole biosynthesis enzyme	Back alignment and domain information

>PLN00093 geranylgeranyl diphosphate reductase; Provisional	Back alignment and domain information

>PTZ00363 rab-GDP dissociation inhibitor; Provisional	Back alignment and domain information

>TIGR01423 trypano_reduc trypanothione-disulfide reductase	Back alignment and domain information

>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial	Back alignment and domain information

>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion]	Back alignment and domain information

>PRK06115 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G	Back alignment and domain information

>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>PRK11728 hydroxyglutarate oxidase; Provisional	Back alignment and domain information

>PRK06467 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional	Back alignment and domain information

>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant	Back alignment and domain information

>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional	Back alignment and domain information

>PLN02661 Putative thiazole synthesis	Back alignment and domain information

>PRK06416 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK05257 malate:quinone oxidoreductase; Validated	Back alignment and domain information

>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional	Back alignment and domain information

>PLN02661 Putative thiazole synthesis	Back alignment and domain information

>TIGR02032 GG-red-SF geranylgeranyl reductase family	Back alignment and domain information

>TIGR02023 BchP-ChlP geranylgeranyl reductase	Back alignment and domain information

>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase	Back alignment and domain information

>PRK05976 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK13339 malate:quinone oxidoreductase; Reviewed	Back alignment and domain information

>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A	Back alignment and domain information

>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase	Back alignment and domain information

>PRK00711 D-amino acid dehydrogenase small subunit; Validated	Back alignment and domain information

>PRK06116 glutathione reductase; Validated	Back alignment and domain information

>PRK13748 putative mercuric reductase; Provisional	Back alignment and domain information

>PLN02464 glycerol-3-phosphate dehydrogenase	Back alignment and domain information

>PLN02507 glutathione reductase	Back alignment and domain information

>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional	Back alignment and domain information

>PTZ00153 lipoamide dehydrogenase; Provisional	Back alignment and domain information

>PRK14694 putative mercuric reductase; Provisional	Back alignment and domain information

>PRK12409 D-amino acid dehydrogenase small subunit; Provisional	Back alignment and domain information

>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated	Back alignment and domain information

>TIGR01377 soxA_mon sarcosine oxidase, monomeric form	Back alignment and domain information

>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>COG0579 Predicted dehydrogenase [General function prediction only]	Back alignment and domain information

>TIGR00292 thiazole biosynthesis enzyme	Back alignment and domain information

>PRK11728 hydroxyglutarate oxidase; Provisional	Back alignment and domain information

>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways	Back alignment and domain information

>PTZ00383 malate:quinone oxidoreductase; Provisional	Back alignment and domain information

>PRK06370 mercuric reductase; Validated	Back alignment and domain information

>PLN02546 glutathione reductase	Back alignment and domain information

>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form	Back alignment and domain information

>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase	Back alignment and domain information

>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed	Back alignment and domain information

>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase	Back alignment and domain information

>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>TIGR02053 MerA mercuric reductase	Back alignment and domain information

>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit	Back alignment and domain information

>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional	Back alignment and domain information

>TIGR01789 lycopene_cycl lycopene cyclase	Back alignment and domain information

>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional	Back alignment and domain information

>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins	Back alignment and domain information

>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A	Back alignment and domain information

>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases	Back alignment and domain information

>PRK09126 hypothetical protein; Provisional	Back alignment and domain information

>PLN02463 lycopene beta cyclase	Back alignment and domain information

>TIGR02028 ChlP geranylgeranyl reductase	Back alignment and domain information

>PRK06327 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364	Back alignment and domain information

>PRK06481 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PRK11259 solA N-methyltryptophan oxidase; Provisional	Back alignment and domain information

>PRK07121 hypothetical protein; Validated	Back alignment and domain information

>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase	Back alignment and domain information

>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1	Back alignment and domain information

>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed	Back alignment and domain information

>PRK11445 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form	Back alignment and domain information

>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional	Back alignment and domain information

>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase	Back alignment and domain information

>PLN02985 squalene monooxygenase	Back alignment and domain information

>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional	Back alignment and domain information

>PRK07045 putative monooxygenase; Reviewed	Back alignment and domain information

>PRK07818 dihydrolipoamide dehydrogenase; Reviewed	Back alignment and domain information

>PRK06292 dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK14727 putative mercuric reductase; Provisional	Back alignment and domain information

>KOG3855\|consensus	Back alignment and domain information

>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated	Back alignment and domain information

>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PLN02464 glycerol-3-phosphate dehydrogenase	Back alignment and domain information

>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed	Back alignment and domain information

>PLN02697 lycopene epsilon cyclase	Back alignment and domain information

>TIGR01377 soxA_mon sarcosine oxidase, monomeric form	Back alignment and domain information

>KOG0405\|consensus	Back alignment and domain information

>PTZ00052 thioredoxin reductase; Provisional	Back alignment and domain information

>PRK08274 tricarballylate dehydrogenase; Validated	Back alignment and domain information

>PRK08013 oxidoreductase; Provisional	Back alignment and domain information

>TIGR01790 carotene-cycl lycopene cyclase family protein	Back alignment and domain information

>PRK00711 D-amino acid dehydrogenase small subunit; Validated	Back alignment and domain information

>PRK12842 putative succinate dehydrogenase; Reviewed	Back alignment and domain information

>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364	Back alignment and domain information

>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6	Back alignment and domain information

>TIGR02730 carot_isom carotene isomerase	Back alignment and domain information

>PF00890 FAD_binding_2: FAD binding domain of the Pfam family	Back alignment and domain information

>PTZ00367 squalene epoxidase; Provisional	Back alignment and domain information

>PRK06996 hypothetical protein; Provisional	Back alignment and domain information

>COG2081 Predicted flavoproteins [General function prediction only]	Back alignment and domain information

>KOG0042\|consensus	Back alignment and domain information

>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family	Back alignment and domain information

>PTZ00383 malate:quinone oxidoreductase; Provisional	Back alignment and domain information

>TIGR03452 mycothione_red mycothione reductase	Back alignment and domain information

>KOG2665\|consensus	Back alignment and domain information

>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional	Back alignment and domain information

>PRK06185 hypothetical protein; Provisional	Back alignment and domain information

>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK07846 mycothione reductase; Reviewed	Back alignment and domain information

>TIGR00275 flavoprotein, HI0933 family	Back alignment and domain information

>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase	Back alignment and domain information

>TIGR01292 TRX_reduct thioredoxin-disulfide reductase	Back alignment and domain information

>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K	Back alignment and domain information

>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated	Back alignment and domain information

>PRK08244 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein	Back alignment and domain information

>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated	Back alignment and domain information

>TIGR01813 flavo_cyto_c flavocytochrome c	Back alignment and domain information

>PRK07190 hypothetical protein; Provisional	Back alignment and domain information

>PRK11259 solA N-methyltryptophan oxidase; Provisional	Back alignment and domain information

>PRK06834 hypothetical protein; Provisional	Back alignment and domain information

>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria	Back alignment and domain information

>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated	Back alignment and domain information

>PRK08275 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK05257 malate:quinone oxidoreductase; Validated	Back alignment and domain information

>PRK06854 adenylylsulfate reductase subunit alpha; Validated	Back alignment and domain information

>PRK06184 hypothetical protein; Provisional	Back alignment and domain information

>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]	Back alignment and domain information

>PLN02576 protoporphyrinogen oxidase	Back alignment and domain information

>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed	Back alignment and domain information

>PRK07395 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated	Back alignment and domain information

>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase	Back alignment and domain information

>KOG2415\|consensus	Back alignment and domain information

>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK12834 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>TIGR00562 proto_IX_ox protoporphyrinogen oxidase	Back alignment and domain information

>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A	Back alignment and domain information

>PRK07588 hypothetical protein; Provisional	Back alignment and domain information

>PRK06175 L-aspartate oxidase; Provisional	Back alignment and domain information

>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit	Back alignment and domain information

>COG3573 Predicted oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK11883 protoporphyrinogen oxidase; Reviewed	Back alignment and domain information

>PRK07804 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK06753 hypothetical protein; Provisional	Back alignment and domain information

>PRK06847 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02733 desat_CrtD C-3',4' desaturase CrtD	Back alignment and domain information

>TIGR02352 thiamin_ThiO glycine oxidase ThiO	Back alignment and domain information

>PRK12843 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1231 Monoamine oxidase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated	Back alignment and domain information

>PRK07236 hypothetical protein; Provisional	Back alignment and domain information

>KOG0029\|consensus	Back alignment and domain information

>PRK07208 hypothetical protein; Provisional	Back alignment and domain information

>PRK12839 hypothetical protein; Provisional	Back alignment and domain information

>PRK09077 L-aspartate oxidase; Provisional	Back alignment and domain information

>PLN02268 probable polyamine oxidase	Back alignment and domain information

>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional	Back alignment and domain information

>PRK06134 putative FAD-binding dehydrogenase; Reviewed	Back alignment and domain information

>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed	Back alignment and domain information

>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK08163 salicylate hydroxylase; Provisional	Back alignment and domain information

>PRK06126 hypothetical protein; Provisional	Back alignment and domain information

>PRK09231 fumarate reductase flavoprotein subunit; Validated	Back alignment and domain information

>PRK07538 hypothetical protein; Provisional	Back alignment and domain information

>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK08401 L-aspartate oxidase; Provisional	Back alignment and domain information

>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]	Back alignment and domain information

>PRK08294 phenol 2-monooxygenase; Provisional	Back alignment and domain information

>PLN02172 flavin-containing monooxygenase FMO GS-OX	Back alignment and domain information

>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PLN02815 L-aspartate oxidase	Back alignment and domain information

>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>PRK08132 FAD-dependent oxidoreductase; Provisional	Back alignment and domain information

>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PLN02676 polyamine oxidase	Back alignment and domain information

>PLN02172 flavin-containing monooxygenase FMO GS-OX	Back alignment and domain information

>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>KOG4716\|consensus	Back alignment and domain information

>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit	Back alignment and domain information

>COG3573 Predicted oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated	Back alignment and domain information

>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK10157 putative oxidoreductase FixC; Provisional	Back alignment and domain information

>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria	Back alignment and domain information

>TIGR02734 crtI_fam phytoene desaturase	Back alignment and domain information

>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit	Back alignment and domain information

>PLN02568 polyamine oxidase	Back alignment and domain information

>PRK08626 fumarate reductase flavoprotein subunit; Provisional	Back alignment and domain information

>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup	Back alignment and domain information

>PRK12416 protoporphyrinogen oxidase; Provisional	Back alignment and domain information

>TIGR00136 gidA glucose-inhibited division protein A	Back alignment and domain information

>PRK05868 hypothetical protein; Validated	Back alignment and domain information

>PRK08071 L-aspartate oxidase; Provisional	Back alignment and domain information

>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]	Back alignment and domain information

>PRK07233 hypothetical protein; Provisional	Back alignment and domain information

>PTZ00306 NADH-dependent fumarate reductase; Provisional	Back alignment and domain information

>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed	Back alignment and domain information

>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle	Back alignment and domain information

>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle	Back alignment and domain information

>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated	Back alignment and domain information

>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan	Back alignment and domain information

>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

>TIGR00551 nadB L-aspartate oxidase	Back alignment and domain information

>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit	Back alignment and domain information

>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed	Back alignment and domain information

>PRK10262 thioredoxin reductase; Provisional	Back alignment and domain information

>TIGR03219 salicylate_mono salicylate 1-monooxygenase	Back alignment and domain information

>TIGR00275 flavoprotein, HI0933 family	Back alignment and domain information

>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit	Back alignment and domain information

>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit	Back alignment and domain information

>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional	Back alignment and domain information

>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function	Back alignment and domain information

>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase	Back alignment and domain information

>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism]	Back alignment and domain information

>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion]	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>PRK07512 L-aspartate oxidase; Provisional	Back alignment and domain information

>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase	Back alignment and domain information

>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion]	Back alignment and domain information

>TIGR02731 phytoene_desat phytoene desaturase	Back alignment and domain information

>PRK06475 salicylate hydroxylase; Provisional	Back alignment and domain information

>KOG2820\|consensus	Back alignment and domain information

>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric	Back alignment and domain information

>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only]	Back alignment and domain information

>PRK12831 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK12810 gltD glutamate synthase subunit beta; Reviewed	Back alignment and domain information

>KOG2960\|consensus	Back alignment and domain information

>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional	Back alignment and domain information

>PRK10015 oxidoreductase; Provisional	Back alignment and domain information

>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form	Back alignment and domain information

>COG3349 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>KOG1335\|consensus	Back alignment and domain information

>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed	Back alignment and domain information

>PRK07845 flavoprotein disulfide reductase; Reviewed	Back alignment and domain information

>KOG0685\|consensus	Back alignment and domain information

>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02612 phytoene desaturase	Back alignment and domain information

>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ]

Back alignment and domain information

>PLN02529 lysine-specific histone demethylase 1	Back alignment and domain information

>PLN02852 ferredoxin-NADP+ reductase	Back alignment and domain information

>PRK13977 myosin-cross-reactive antigen; Provisional	Back alignment and domain information

>TIGR02732 zeta_caro_desat carotene 7,8-desaturase	Back alignment and domain information

>PRK12770 putative glutamate synthase subunit beta; Provisional	Back alignment and domain information

>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed	Back alignment and domain information

>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]	Back alignment and domain information

>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional	Back alignment and domain information

>KOG2614\|consensus	Back alignment and domain information

>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional	Back alignment and domain information

>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit	Back alignment and domain information

>PRK09853 putative selenate reductase subunit YgfK; Provisional	Back alignment and domain information

>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup	Back alignment and domain information

>PLN02487 zeta-carotene desaturase	Back alignment and domain information

>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional	Back alignment and domain information

>KOG2853\|consensus	Back alignment and domain information

>PLN02328 lysine-specific histone demethylase 1 homolog	Back alignment and domain information

>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated	Back alignment and domain information

>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]	Back alignment and domain information

>PLN02976 amine oxidase	Back alignment and domain information

>KOG1399\|consensus	Back alignment and domain information

>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes []	Back alignment and domain information

>KOG2404\|consensus	Back alignment and domain information

>PRK09897 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial	Back alignment and domain information

>TIGR00136 gidA glucose-inhibited division protein A	Back alignment and domain information

>KOG0042\|consensus	Back alignment and domain information

>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG0029 NadB Aspartate oxidase [Coenzyme metabolism]	Back alignment and domain information

>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G	Back alignment and domain information

>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family	Back alignment and domain information

>PRK13339 malate:quinone oxidoreductase; Reviewed	Back alignment and domain information

>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional	Back alignment and domain information

>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit	Back alignment and domain information

>PLN03000 amine oxidase	Back alignment and domain information

>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B	Back alignment and domain information

>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ	Back alignment and domain information

>KOG2311\|consensus	Back alignment and domain information

>KOG4254\|consensus	Back alignment and domain information

>KOG2755\|consensus	Back alignment and domain information

>KOG3851\|consensus	Back alignment and domain information

>KOG1439\|consensus	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PTZ00318 NADH dehydrogenase-like protein; Provisional	Back alignment and domain information

>PRK06184 hypothetical protein; Provisional	Back alignment and domain information

>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional	Back alignment and domain information

>PRK13512 coenzyme A disulfide reductase; Provisional	Back alignment and domain information

>PTZ00188 adrenodoxin reductase; Provisional	Back alignment and domain information

Homologous Structure Templates