Psyllid ID: psy12101

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----
MAEPYLQAVKRSRVKSRIKTQETMERVNKLKTENDMLEEKIKILSRELSFLKNLFLAHAGSTNGIDMDDIDLESLLADAVDTPPSVPCTSSRSNYNSSSLSTPSF
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHccccccccccccccccccccccccccc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHcccccccccccccccccccccccccccc
MAEPYLQAVKRSRVKSRIKTQETMERVNKLKTENDMLEEKIKILSRELSFLKNLFLAhagstngidmddiDLESLLadavdtppsvpctssrsnynssslstpsf
maepylqavkrsrvksriktqetmervnklktendmLEEKIKILSRELSFLKNLFLAHAGSTNGIDMDDIDLESLLADAVDTppsvpctssrsnynssslstpsf
MAEPYLQAVKRSRVKSRIKTQETMERVNKLKTENDMLEEKIKILSRELSFLKNLFLAHAGSTNGIDMDDIDLESLLADAVDTPPSVPCTssrsnynssslstpsF
**************************************EKIKILSRELSFLKNLFLAHAGSTNGIDMDDIDLESLLA****************************
***PYLQ*V************************NDMLEEKIKILSRELSFLKNLFLAHA**********IDLE********************************
MAEPYLQAVKRSRVKSRIKTQETMERVNKLKTENDMLEEKIKILSRELSFLKNLFLAHAGSTNGIDMDDIDLESLLADAVDT***********************
**EPYLQAVKRSRVKSRIKTQETMERVNKLKTENDMLEEKIKILSRELSFLKNLFLAHAGSTNGIDMDDIDLESLLAD***************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEPYLQAVKRSRVKSRIKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFLAHAGSTNGIDMDDIDLESLLADAVDTPPSVPCTSSRSNYNSSSLSTPSF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query105 2.2.26 [Sep-21-2011]
P53568150 CCAAT/enhancer-binding pr yes N/A 0.514 0.36 0.629 2e-12
P53567150 CCAAT/enhancer-binding pr yes N/A 0.495 0.346 0.634 3e-12
P26801150 CCAAT/enhancer-binding pr yes N/A 0.495 0.346 0.634 3e-12
Q3T0B9149 CCAAT/enhancer-binding pr yes N/A 0.495 0.348 0.634 3e-12
Q05826328 CCAAT/enhancer-binding pr no N/A 0.457 0.146 0.479 1e-05
P17676345 CCAAT/enhancer-binding pr no N/A 0.457 0.139 0.479 1e-05
P28033296 CCAAT/enhancer-binding pr no N/A 0.457 0.162 0.479 2e-05
P21272297 CCAAT/enhancer-binding pr no N/A 0.457 0.161 0.479 2e-05
O02755348 CCAAT/enhancer-binding pr no N/A 0.457 0.137 0.458 4e-05
>sp|P53568|CEBPG_MOUSE CCAAT/enhancer-binding protein gamma OS=Mus musculus GN=Cebpg PE=1 SV=1 Back     alignment and function desciption
 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/54 (62%), Positives = 46/54 (85%)

Query: 8   AVKRSRVKSRIKTQETMERVNKLKTENDMLEEKIKILSRELSFLKNLFLAHAGS 61
           AVK+SR+KS+ K Q+T++RVN+LK EN+ LE KIK+L++ELS LK+LFL HA S
Sbjct: 75  AVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHS 128
Transcription factor that binds to the promoter and the enhancer of the immunoglobulin heavy chain. Binds to GPE1, a cis-acting element in the G-CSF gene promoter.
Mus musculus (taxid: 10090)
>sp|P53567|CEBPG_HUMAN CCAAT/enhancer-binding protein gamma OS=Homo sapiens GN=CEBPG PE=1 SV=1 Back     alignment and function description
>sp|P26801|CEBPG_RAT CCAAT/enhancer-binding protein gamma OS=Rattus norvegicus GN=Cebpg PE=2 SV=2 Back     alignment and function description
>sp|Q3T0B9|CEBPG_BOVIN CCAAT/enhancer-binding protein gamma OS=Bos taurus GN=CEBPG PE=2 SV=1 Back     alignment and function description
>sp|Q05826|CEBPB_CHICK CCAAT/enhancer-binding protein beta OS=Gallus gallus GN=CEBPB PE=2 SV=1 Back     alignment and function description
>sp|P17676|CEBPB_HUMAN CCAAT/enhancer-binding protein beta OS=Homo sapiens GN=CEBPB PE=1 SV=2 Back     alignment and function description
>sp|P28033|CEBPB_MOUSE CCAAT/enhancer-binding protein beta OS=Mus musculus GN=Cebpb PE=1 SV=1 Back     alignment and function description
>sp|P21272|CEBPB_RAT CCAAT/enhancer-binding protein beta OS=Rattus norvegicus GN=Cebpb PE=2 SV=1 Back     alignment and function description
>sp|O02755|CEBPB_BOVIN CCAAT/enhancer-binding protein beta OS=Bos taurus GN=CEBPB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query105
383850474123 PREDICTED: CCAAT/enhancer-binding protei 0.723 0.617 0.658 8e-22
307172367175 CCAAT/enhancer-binding protein gamma [Ca 0.809 0.485 0.604 1e-21
340728187123 PREDICTED: CCAAT/enhancer-binding protei 0.723 0.617 0.645 2e-21
322778842120 hypothetical protein SINV_09773 [Solenop 0.819 0.716 0.556 4e-21
110756201122 PREDICTED: CCAAT/enhancer-binding protei 0.685 0.590 0.671 5e-21
332022363112 CCAAT/enhancer-binding protein gamma [Ac 0.809 0.758 0.574 1e-20
242010398126 predicted protein [Pediculus humanus cor 0.676 0.563 0.661 8e-20
307199452119 CCAAT/enhancer-binding protein gamma [Ha 0.809 0.714 0.569 3e-19
345488250117 PREDICTED: CCAAT/enhancer-binding protei 0.780 0.700 0.588 3e-19
156550161124 PREDICTED: CCAAT/enhancer-binding protei 0.780 0.661 0.588 3e-19
>gi|383850474|ref|XP_003700820.1| PREDICTED: CCAAT/enhancer-binding protein gamma-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  107 bits (268), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 52/79 (65%), Positives = 70/79 (88%), Gaps = 3/79 (3%)

Query: 7   QAVKRSRVKSRIKTQETMERVNKLKTENDMLEEKIKILSRELSFLKNLFLAHAGST-NGI 65
           QAVKRSRVKS+++TQ+T+ERVN+LKTEN++LEEKIK+L++EL FLK+LFLAHAGS+ + +
Sbjct: 37  QAVKRSRVKSKLRTQQTLERVNQLKTENELLEEKIKMLTKELGFLKDLFLAHAGSSQHSV 96

Query: 66  DMDDIDLESLLADAVDTPP 84
           +  D+DL +LLAD  DT P
Sbjct: 97  NFQDLDLNALLAD--DTKP 113

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307172367|gb|EFN63838.1| CCAAT/enhancer-binding protein gamma [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340728187|ref|XP_003402409.1| PREDICTED: CCAAT/enhancer-binding protein gamma-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|322778842|gb|EFZ09258.1| hypothetical protein SINV_09773 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|110756201|ref|XP_001122278.1| PREDICTED: CCAAT/enhancer-binding protein gamma-like [Apis mellifera] gi|380011941|ref|XP_003690050.1| PREDICTED: CCAAT/enhancer-binding protein gamma-like [Apis florea] Back     alignment and taxonomy information
>gi|332022363|gb|EGI62675.1| CCAAT/enhancer-binding protein gamma [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|242010398|ref|XP_002425955.1| predicted protein [Pediculus humanus corporis] gi|212509938|gb|EEB13217.1| predicted protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307199452|gb|EFN80065.1| CCAAT/enhancer-binding protein gamma [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345488250|ref|XP_003425866.1| PREDICTED: CCAAT/enhancer-binding protein gamma-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|156550161|ref|XP_001606194.1| PREDICTED: CCAAT/enhancer-binding protein gamma-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query105
UNIPROTKB|P53567150 CEBPG "CCAAT/enhancer-binding 0.666 0.466 0.521 3.4e-13
RGD|2330150 Cebpg "CCAAT/enhancer binding 0.704 0.493 0.493 3.4e-13
MGI|MGI:104982150 Cebpg "CCAAT/enhancer binding 0.704 0.493 0.5 5.6e-13
UNIPROTKB|Q3T0B9149 CEBPG "CCAAT/enhancer-binding 0.495 0.348 0.634 1.2e-12
UNIPROTKB|E2RIW4147 CEBPG "Uncharacterized protein 0.495 0.353 0.634 1.2e-12
UNIPROTKB|F1RNW5151 CEBPG "Uncharacterized protein 0.495 0.344 0.634 1.2e-12
ZFIN|ZDB-GENE-020111-5163 cebpg "CCAAT/enhancer binding 0.495 0.319 0.634 1.9e-12
UNIPROTKB|Q98944150 C/EBP gamma "Leucine zipper tr 0.514 0.36 0.611 3.1e-12
WB|WBGene00016754100 cebp-2 [Caenorhabditis elegans 0.561 0.59 0.466 3.6e-09
MGI|MGI:88373296 Cebpb "CCAAT/enhancer binding 0.457 0.162 0.479 2e-06
UNIPROTKB|P53567 CEBPG "CCAAT/enhancer-binding protein gamma" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 173 (66.0 bits), Expect = 3.4e-13, P = 3.4e-13
 Identities = 37/71 (52%), Positives = 53/71 (74%)

Query:     8 AVKRSRVKSRIKTQETMERVNKLKTENDMLEEKIKILSRELSFLKNLFLAHAGSTNGIDM 67
             AVK+SR+KS+ K Q+T++RVN+LK EN+ LE KIK+L++ELS LK+LFL HA +    ++
Sbjct:    75 AVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLAD-NV 133

Query:    68 DDIDLESLLAD 78
               I  E+  AD
Sbjct:   134 QSISTENTTAD 144
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0003690 "double-stranded DNA binding" evidence=IEA
GO:0016071 "mRNA metabolic process" evidence=IEA
GO:0043388 "positive regulation of DNA binding" evidence=TAS
GO:0046982 "protein heterodimerization activity" evidence=IDA
GO:0006955 "immune response" evidence=ISS
GO:0045739 "positive regulation of DNA repair" evidence=IEP
GO:0003677 "DNA binding" evidence=IDA
GO:0008134 "transcription factor binding" evidence=IDA
GO:0051091 "positive regulation of sequence-specific DNA binding transcription factor activity" evidence=TAS
GO:0005634 "nucleus" evidence=ISS;IDA
GO:0043433 "negative regulation of sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0042267 "natural killer cell mediated cytotoxicity" evidence=ISS
GO:0045078 "positive regulation of interferon-gamma biosynthetic process" evidence=ISS
GO:0043353 "enucleate erythrocyte differentiation" evidence=ISS
GO:0005515 "protein binding" evidence=IPI
GO:0001889 "liver development" evidence=ISS
GO:0043565 "sequence-specific DNA binding" evidence=IDA
GO:0030183 "B cell differentiation" evidence=ISS
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=IDA
GO:0005730 "nucleolus" evidence=IDA
RGD|2330 Cebpg "CCAAT/enhancer binding protein (C/EBP), gamma" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:104982 Cebpg "CCAAT/enhancer binding protein (C/EBP), gamma" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0B9 CEBPG "CCAAT/enhancer-binding protein gamma" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RIW4 CEBPG "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RNW5 CEBPG "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020111-5 cebpg "CCAAT/enhancer binding protein (C/EBP), gamma" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q98944 C/EBP gamma "Leucine zipper transcription factor" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00016754 cebp-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
MGI|MGI:88373 Cebpb "CCAAT/enhancer binding protein (C/EBP), beta" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P53568CEBPG_MOUSENo assigned EC number0.62960.51420.36yesN/A
Q3T0B9CEBPG_BOVINNo assigned EC number0.63460.49520.3489yesN/A
P53567CEBPG_HUMANNo assigned EC number0.63460.49520.3466yesN/A
P26801CEBPG_RATNo assigned EC number0.63460.49520.3466yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 3e-08
smart0033865 smart00338, BRLZ, basic region leucin zipper 1e-05
pfam01763556 pfam01763, Herpes_UL6, Herpesvirus UL6 like 0.004
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information 
 Score = 45.7 bits (109), Expect = 3e-08
 Identities = 16/41 (39%), Positives = 27/41 (65%)

Query: 7  QAVKRSRVKSRIKTQETMERVNKLKTENDMLEEKIKILSRE 47
          +A +RSR K + + +E  ERV +L+ EN  L +K++ L +E
Sbjct: 14 EAARRSREKKKQREEELEERVKELEEENAQLRQKVEQLEKE 54

Length = 54
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information
>gnl|CDD|216687 pfam01763, Herpes_UL6, Herpesvirus UL6 like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 105
KOG3119|consensus269 99.63
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 99.34
smart0033865 BRLZ basic region leucin zipper. 99.33
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.15
KOG4571|consensus294 98.61
KOG0837|consensus279 98.05
KOG3584|consensus348 97.66
KOG4005|consensus 292 97.62
KOG4343|consensus 655 96.96
KOG4196|consensus135 96.7
KOG1414|consensus395 96.29
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 96.17
KOG1414|consensus 395 95.85
KOG0709|consensus 472 95.54
KOG3863|consensus604 95.02
TIGR0244965 conserved hypothetical protein TIGR02449. Members 94.08
PRK09413121 IS2 repressor TnpA; Reviewed 94.07
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 93.78
KOG4196|consensus135 93.38
PRK00888105 ftsB cell division protein FtsB; Reviewed 92.57
PRK13922 276 rod shape-determining protein MreC; Provisional 92.28
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 92.19
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 92.0
PRK00888105 ftsB cell division protein FtsB; Reviewed 91.71
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 91.34
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 91.2
PF1280852 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 91.12
PF0733476 IFP_35_N: Interferon-induced 35 kDa protein (IFP 3 90.89
PF07047134 OPA3: Optic atrophy 3 protein (OPA3); InterPro: IP 90.44
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 90.2
PRK10884206 SH3 domain-containing protein; Provisional 90.13
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 89.63
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 89.38
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 89.29
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 88.68
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 88.3
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 88.24
PF10018188 Med4: Vitamin-D-receptor interacting Mediator subu 88.16
PF0472856 LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 87.95
PRK10803 263 tol-pal system protein YbgF; Provisional 87.91
PF07407 420 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: 87.49
KOG3335|consensus181 87.08
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 86.92
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 86.86
PF1270987 Kinetocho_Slk19: Central kinetochore-associated; I 86.81
PRK1542279 septal ring assembly protein ZapB; Provisional 86.74
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 86.7
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 86.68
KOG1318|consensus411 86.53
PF1270987 Kinetocho_Slk19: Central kinetochore-associated; I 86.3
TIGR00219 283 mreC rod shape-determining protein MreC. MreC (mur 85.69
COG2433 652 Uncharacterized conserved protein [Function unknow 85.47
PF0116659 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 85.22
PRK0029568 hypothetical protein; Provisional 85.14
PF0116659 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 84.66
smart0033865 BRLZ basic region leucin zipper. 84.55
PF0900646 Surfac_D-trimer: Lung surfactant protein D coiled- 84.15
PF13863126 DUF4200: Domain of unknown function (DUF4200) 84.08
cd07429108 Cby_like Chibby, a nuclear inhibitor of Wnt/beta-c 83.78
TIGR0220985 ftsL_broad cell division protein FtsL. This model 83.48
PRK0440675 hypothetical protein; Provisional 83.47
PRK13922 276 rod shape-determining protein MreC; Provisional 83.39
PRK14127109 cell division protein GpsB; Provisional 83.31
PF0537755 FlaC_arch: Flagella accessory protein C (FlaC); In 83.23
PF07407 420 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: 82.97
PRK0073668 hypothetical protein; Provisional 82.8
PF03980109 Nnf1: Nnf1 ; InterPro: IPR007128 NNF1 is an essent 82.43
PF0755846 Shugoshin_N: Shugoshin N-terminal coiled-coil regi 81.87
PRK0279372 phi X174 lysis protein; Provisional 81.86
PRK0084677 hypothetical protein; Provisional 81.7
PF11382 308 DUF3186: Protein of unknown function (DUF3186); In 81.24
COG2919117 Septum formation initiator [Cell division and chro 81.22
PF0537755 FlaC_arch: Flagella accessory protein C (FlaC); In 81.11
PF10186 302 Atg14: UV radiation resistance protein and autopha 80.48
PF05308253 Mito_fiss_reg: Mitochondrial fission regulator; In 80.21
PRK10884206 SH3 domain-containing protein; Provisional 80.16
KOG3584|consensus348 80.01
>KOG3119|consensus Back     alignment and domain information 
Probab=99.63  E-value=8.8e-16  Score=121.57  Aligned_cols=61  Identities=33%  Similarity=0.468  Sum_probs=58.6

Q ss_pred             cchhhHHHHHhHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCC
Q psy12101          2 AEPYLQAVKRSRVKSRIKTQETMERVNKLKTENDMLEEKIKILSRELSFLKNLFLAHAGST   62 (105)
Q Consensus         2 reRNN~AakRSR~KrKqk~~e~~~Rv~~Le~EN~~Lr~~I~~L~kEl~~LK~ll~~h~~~~   62 (105)
                      |+|||+||||||+|+|+++++++.||.+|++||+.|+.+|++|++|+..|+++|.++....
T Consensus       199 r~rNN~A~~kSR~~~k~~~~e~~~r~~~leken~~lr~~v~~l~~el~~~~~~~~~~~~~~  259 (269)
T KOG3119|consen  199 RRRNNEAVRKSRDKRKQKEDEMAHRVAELEKENEALRTQVEQLKKELATLRRLFLQLPKPG  259 (269)
T ss_pred             HHhhhHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccc
Confidence            7899999999999999999999999999999999999999999999999999999987663

>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>KOG4571|consensus Back     alignment and domain information
>KOG0837|consensus Back     alignment and domain information
>KOG3584|consensus Back     alignment and domain information
>KOG4005|consensus Back     alignment and domain information
>KOG4343|consensus Back     alignment and domain information
>KOG4196|consensus Back     alignment and domain information
>KOG1414|consensus Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG1414|consensus Back     alignment and domain information
>KOG0709|consensus Back     alignment and domain information
>KOG3863|consensus Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>KOG4196|consensus Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi Back     alignment and domain information
>PF07334 IFP_35_N: Interferon-induced 35 kDa protein (IFP 35) N-terminus; InterPro: IPR009938 This entry represents the N terminus of interferon-induced 35 kDa protein (IFP 35) (approximately 80 residues long), which contains a leucine zipper motif in an alpha helical configuration [] Back     alignment and domain information
>PF07047 OPA3: Optic atrophy 3 protein (OPA3); InterPro: IPR010754 OPA3 deficiency causes type III 3-methylglutaconic aciduria (MGA) in humans Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>PF10018 Med4: Vitamin-D-receptor interacting Mediator subunit 4; InterPro: IPR019258 The Mediator complex is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes Back     alignment and domain information
>PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF07407 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus Back     alignment and domain information
>KOG3335|consensus Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF12709 Kinetocho_Slk19: Central kinetochore-associated; InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG1318|consensus Back     alignment and domain information
>PF12709 Kinetocho_Slk19: Central kinetochore-associated; InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF09006 Surfac_D-trimer: Lung surfactant protein D coiled-coil trimerisation; InterPro: IPR015097 This domain is found in the SFTPD family, which includes lung surfactant protein D (SFTPD), conglutinin, collectin-43 and collectin-46 Back     alignment and domain information
>PF13863 DUF4200: Domain of unknown function (DUF4200) Back     alignment and domain information
>cd07429 Cby_like Chibby, a nuclear inhibitor of Wnt/beta-catenin mediated transcription, and similar proteins Back     alignment and domain information
>TIGR02209 ftsL_broad cell division protein FtsL Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PRK14127 cell division protein GpsB; Provisional Back     alignment and domain information
>PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] Back     alignment and domain information
>PF07407 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>PF03980 Nnf1: Nnf1 ; InterPro: IPR007128 NNF1 is an essential yeast gene required for proper spindle orientation, nucleolar and nuclear envelope structure and mRNA export [] Back     alignment and domain information
>PF07558 Shugoshin_N: Shugoshin N-terminal coiled-coil region; InterPro: IPR011516 This entry represents the N-terminal domain of Shugoshin (Sgo1) kinetochore-attachment proteins Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>PF11382 DUF3186: Protein of unknown function (DUF3186); InterPro: IPR021522 This bacterial family of proteins has no known function Back     alignment and domain information
>COG2919 Septum formation initiator [Cell division and chromosome partitioning] Back     alignment and domain information
>PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF05308 Mito_fiss_reg: Mitochondrial fission regulator; InterPro: IPR007972 This family consists of several uncharacterised eukaryotic proteins of unknown function Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>KOG3584|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
1hjb_A87 Crystal Structure Of Runx-1AML1CBFALPHA RUNT DOMAIN 1e-05
2e43_A78 Crystal Structure Of CEBPBETA BZIP HOMODIMER K269A 2e-05
1io4_A78 Crystal Structure Of Runx-1AML1CBFALPHA RUNT DOMAIN 2e-05
1h89_A64 Crystal Structure Of Ternary Protein-Dna Complex2 L 2e-05
1ci6_B63 Transcription Factor Atf4-CEBP BETA BZIP HETERODIME 3e-05
2e42_A78 Crystal Structure Of CEBPBETA BZIP HOMODIMER V285A 6e-05
>pdb|1HJB|A Chain A, Crystal Structure Of Runx-1AML1CBFALPHA RUNT DOMAIN AND CEBPBETA BZIP DIMERIC BOUND TO A DNA FRAGMENT FROM THE Csf-1r Promoter Length = 87 Back     alignment and structure 
Iteration: 1

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 37/48 (77%)
Query: 8  AVKRSRVKSRIKTQETMERVNKLKTENDMLEEKIKILSRELSFLKNLF 55
          AV++SR K++++  ET  +V +L  EN+ L++K++ LSRELS L+NLF
Sbjct: 26 AVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLF 73
>pdb|2E43|A Chain A, Crystal Structure Of CEBPBETA BZIP HOMODIMER K269A MUTANT Bound To A High Affinity Dna Fragment Length = 78 Back     alignment and structure
>pdb|1IO4|A Chain A, Crystal Structure Of Runx-1AML1CBFALPHA RUNT DOMAIN- Cbfbeta Core Domain Heterodimer And CEBPBETA BZIP Homodimer Bound To A Dna Fragment From The Csf-1r Promoter Length = 78 Back     alignment and structure
>pdb|1H89|A Chain A, Crystal Structure Of Ternary Protein-Dna Complex2 Length = 64 Back     alignment and structure
>pdb|1CI6|B Chain B, Transcription Factor Atf4-CEBP BETA BZIP HETERODIMER Length = 63 Back     alignment and structure
>pdb|2E42|A Chain A, Crystal Structure Of CEBPBETA BZIP HOMODIMER V285A MUTANT Bound To A High Affinity Dna Fragment Length = 78 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 2e-10
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 4e-10
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 2e-08
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 1e-07
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 8e-07
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 4e-06
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 Back     alignment and structure
 Score = 51.4 bits (123), Expect = 2e-10
 Identities = 23/50 (46%), Positives = 37/50 (74%)

Query: 7  QAVKRSRVKSRIKTQETMERVNKLKTENDMLEEKIKILSRELSFLKNLFL 56
           AV++SR K++++  ET  +V +L  EN+ L++K++ LSRELS L+NLF 
Sbjct: 25 IAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFK 74
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query105
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 99.82
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 99.81
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.63
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.62
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.62
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 99.61
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.22
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 98.85
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 98.04
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 97.56
2wt7_B90 Transcription factor MAFB; transcription, transcri 97.55
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 97.01
2c9l_Y63 EB1, zebra, BZLF1 trans-activator protein; viral p 96.69
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 96.11
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 95.14
3ra3_A28 P1C; coiled coil domain, fiber, KIH interactions, 95.1
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 95.07
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 94.96
3m48_A33 General control protein GCN4; leucine zipper, synt 94.95
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 94.42
3m48_A33 General control protein GCN4; leucine zipper, synt 94.0
2hy6_A34 General control protein GCN4; protein design, para 93.92
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 93.61
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 93.6
4dzn_A33 Coiled-coil peptide CC-PIL; de novo protein; HET: 93.6
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 93.2
2bni_A34 General control protein GCN4; four helix bundle, a 93.06
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 93.04
3ra3_B28 P2F; coiled coil domain, fiber, KIH interactions, 92.99
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 92.97
1a93_B34 MAX protein, coiled coil, LZ; leucine zipper, 2D s 92.89
1uo4_A34 General control protein GCN4; four helix bundle, c 92.52
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 92.31
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 92.25
1uo4_A34 General control protein GCN4; four helix bundle, c 91.59
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 91.42
2xdj_A83 Uncharacterized protein YBGF; unknown function; 1. 91.34
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 90.7
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 90.51
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 90.39
1fmh_A33 General control protein GCN4; coiled coil, leucine 90.35
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 90.34
3vmx_A48 Voltage-gated hydrogen channel 1; coiled-coil, ION 90.28
1uii_A83 Geminin; human, DNA replication, cell cycle; 2.00A 90.22
2r2v_A34 GCN4 leucine zipper; coiled coils, anti-parallel t 90.0
3a2a_A58 Voltage-gated hydrogen channel 1; voltage-gated pr 89.81
1uii_A83 Geminin; human, DNA replication, cell cycle; 2.00A 89.69
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 89.56
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 89.54
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 89.53
4dzn_A33 Coiled-coil peptide CC-PIL; de novo protein; HET: 89.51
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 89.22
2hy6_A34 General control protein GCN4; protein design, para 89.16
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 89.07
2bni_A34 General control protein GCN4; four helix bundle, a 89.01
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 88.97
2r2v_A34 GCN4 leucine zipper; coiled coils, anti-parallel t 88.88
1dip_A78 Delta-sleep-inducing peptide immunoreactive peptid 88.73
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 88.39
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 88.38
1wlq_A83 Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2z 87.47
1deb_A54 APC protein, adenomatous polyposis coli protein; c 87.42
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 87.24
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 87.11
3viq_A122 SWI5-dependent recombination DNA repair protein 1; 86.86
1gk7_A39 Vimentin; intermediate filament, heptad repeat; 1. 86.67
2wvr_A209 Geminin; DNA replication license, DNA replication 86.67
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 86.61
1wlq_A83 Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2z 86.29
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 86.1
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 85.45
2wg5_A109 General control protein GCN4, proteasome-activatin 85.28
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 85.24
3cve_A72 Homer protein homolog 1; coiled coil, alternative 84.33
2wuj_A57 Septum site-determining protein diviva; bacterial 83.98
1dip_A78 Delta-sleep-inducing peptide immunoreactive peptid 83.91
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 83.37
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 83.12
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 83.04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 82.75
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 82.61
1jcd_A52 Major outer membrane lipoprotein; protein folding, 82.22
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 82.11
1t6f_A37 Geminin; coiled-coil, cell cycle; 1.47A {Synthetic 81.67
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 81.37
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 81.3
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 81.29
2wt7_B90 Transcription factor MAFB; transcription, transcri 81.26
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 81.2
3v86_A27 De novo design helix; computational design of A pr 81.14
1p9i_A31 Cortexillin I/GCN4 hybrid peptide; coiled-coil, un 80.99
1g6u_A48 Domain swapped dimer; designed three helix bundle, 80.98
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 80.87
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 80.11
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
Probab=99.82  E-value=1.1e-20  Score=126.53  Aligned_cols=58  Identities=41%  Similarity=0.539  Sum_probs=54.4

Q ss_pred             cchhhHHHHHhHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy12101          2 AEPYLQAVKRSRVKSRIKTQETMERVNKLKTENDMLEEKIKILSRELSFLKNLFLAHA   59 (105)
Q Consensus         2 reRNN~AakRSR~KrKqk~~e~~~Rv~~Le~EN~~Lr~~I~~L~kEl~~LK~ll~~h~   59 (105)
                      |+|||+||+|||+|+|+++++++.+|.+|++||..|+.+|.+|++|+..||++|++|+
T Consensus        20 R~rNN~AakrSR~krk~r~~e~~~r~~~L~~eN~~L~~~v~~L~~E~~~Lr~ll~q~p   77 (78)
T 1gu4_A           20 RERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLP   77 (78)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTC---
T ss_pred             HHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Confidence            7899999999999999999999999999999999999999999999999999999986
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>3ra3_A P1C; coiled coil domain, fiber, KIH interactions, synthetic biolo helical reconstruction, de novo protein; HET: PHI; 2.31A {Synthetic} Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>4dzn_A Coiled-coil peptide CC-PIL; de novo protein; HET: PHI; 1.59A {Synthetic} PDB: 4dzm_A* 4dzl_A* 4dzk_A 1u0i_A 1u0i_B Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>3ra3_B P2F; coiled coil domain, fiber, KIH interactions, synthetic biolo helical reconstruction, de novo protein; HET: PHI; 2.31A {Synthetic} Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>1a93_B MAX protein, coiled coil, LZ; leucine zipper, 2D solution structure, H-bonds, buried salt bridge, proto-oncogene, nuclear protein; NMR {Mus musculus} SCOP: h.1.3.1 PDB: 2a93_B Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1fmh_A General control protein GCN4; coiled coil, leucine zipper, inter-helical ION pairing, transcription; NMR {Synthetic} SCOP: k.6.1.1 PDB: 1u2u_A Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} Back     alignment and structure
>1uii_A Geminin; human, DNA replication, cell cycle; 2.00A {Homo sapiens} SCOP: h.1.28.1 Back     alignment and structure
>2r2v_A GCN4 leucine zipper; coiled coils, anti-parallel tetramer, protein design, de novo protein; HET: CIT; 1.90A {Saccharomyces cerevisiae} SCOP: h.1.3.1 Back     alignment and structure
>3a2a_A Voltage-gated hydrogen channel 1; voltage-gated proton channel, alternative splicing, coiled C transport, ionic channel, membrane, transmembrane; 2.00A {Homo sapiens} Back     alignment and structure
>1uii_A Geminin; human, DNA replication, cell cycle; 2.00A {Homo sapiens} SCOP: h.1.28.1 Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>4dzn_A Coiled-coil peptide CC-PIL; de novo protein; HET: PHI; 1.59A {Synthetic} PDB: 4dzm_A* 4dzl_A* 4dzk_A 1u0i_A 1u0i_B Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
>2r2v_A GCN4 leucine zipper; coiled coils, anti-parallel tetramer, protein design, de novo protein; HET: CIT; 1.90A {Saccharomyces cerevisiae} SCOP: h.1.3.1 Back     alignment and structure
>1dip_A Delta-sleep-inducing peptide immunoreactive peptide; structure, leucine zipper, PIG, acetylation; NMR {Sus scrofa} SCOP: h.1.12.1 Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>1wlq_A Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2zxx_A* Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure
>3viq_A SWI5-dependent recombination DNA repair protein 1; recombination activator; 2.20A {Schizosaccharomyces pombe} Back     alignment and structure
>1gk7_A Vimentin; intermediate filament, heptad repeat; 1.4A {Homo sapiens} SCOP: h.1.20.1 PDB: 3g1e_A Back     alignment and structure
>2wvr_A Geminin; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>1wlq_A Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2zxx_A* Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>2wg5_A General control protein GCN4, proteasome-activating nucleotidase; transcription hydrolase complex, nucleotide-binding; 2.10A {Saccharomyces cerevisiae} PDB: 2wg6_A Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>2wuj_A Septum site-determining protein diviva; bacterial cell division, septation, cell cycle, sporulation; 1.40A {Bacillus subtilis} PDB: 2wuk_A Back     alignment and structure
>1dip_A Delta-sleep-inducing peptide immunoreactive peptide; structure, leucine zipper, PIG, acetylation; NMR {Sus scrofa} SCOP: h.1.12.1 Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1jcd_A Major outer membrane lipoprotein; protein folding, coiled coil, helix capping, alanine-zipper, membrane protein; 1.30A {Escherichia coli} SCOP: h.1.16.1 PDB: 1eq7_A 1t8z_A* 2guv_A 2gus_A 1jcc_A 1kfn_A 1kfm_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1t6f_A Geminin; coiled-coil, cell cycle; 1.47A {Synthetic} SCOP: h.1.28.1 Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>3v86_A De novo design helix; computational design of A protein crystal, helical coil, DE designed helix, de novo protein; 2.91A {Synthetic} Back     alignment and structure
>1p9i_A Cortexillin I/GCN4 hybrid peptide; coiled-coil, unknown function; 1.17A {Synthetic} SCOP: h.1.10.1 Back     alignment and structure
>1g6u_A Domain swapped dimer; designed three helix bundle, de novo protein; 1.48A {Synthetic} SCOP: k.9.1.1 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query105
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 87.05
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 80.34
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Myc proto-oncogene protein
species: Human (Homo sapiens) [TaxId: 9606]

Probab=87.05  E-value=0.83  Score=27.76  Aligned_cols=30  Identities=17%  Similarity=0.215  Sum_probs=17.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12101         27 VNKLKTENDMLEEKIKILSRELSFLKNLFL   56 (105)
Q Consensus        27 v~~Le~EN~~Lr~~I~~L~kEl~~LK~ll~   56 (105)
                      +..|++++..|..+++.|++++..|+.-+.
T Consensus        54 I~~L~~~~~~l~~~~~~l~~~~~~L~~~l~   83 (88)
T d1nkpa_          54 ILSVQAEEQKLISEEDLLRKRREQLKHKLE   83 (88)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            455555666666666666666555555443
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure