Psyllid ID: psy12107


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330----
MCNIPQLLEVGTKIGATLPNFRGTIVVGGEHDKSKNIFGFKQLVTSQPPDFQLPKISPNDLAMLPYSSGTTGVPKGVKLSHNNCAVNLEQCVHPDIVNHIPTSDTSQETVLSVLPFFHIYGFNGILNVVMMYGMHMITIPKFTPETYIECVVKYKPTILFVVPSLLLFLASHPAVTPEHLASIREVTCGAAPATKSLIDKFKQKVQREDITIRQGYGMTETSPCTLYTRFAIPEAKLGSTGQLVMLGYLKNEEATKETVDSEGWLHTGDVAYYDEDGYFYIVDRTKELIKVKGNQVAPYKKLAGGVKFLETIPRNPAGKVLRNELKVFGTNPKK
cccccccHHHHHHHHHHcccccEEEEEccccccccccccHHHHHHcccccccccccccccEEEEEcccccccccccEEEcHHHHHHHHHHHcccccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHccEEEEcccccHHHHHHHHHHccccEEEccHHHHHHHHccccccccccccHHHHHcccccccHHHHHHHHHHHcccccEEEEcccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccEEEcccccEEEEccccHHHHcccccccccccccccccEEEcccccccEEEEccccccccccccc
cccHHHHHHHHHHHHHHcccccEEEEEccccccccccccHHHHHHcccccccccccccccEEEEEEccccccccccEEEcHHHHHHHHHHHHccccccccEEEcccccEEEEEEcHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHccccEccccHHHHHHHHccccccHccHHHHHHHHHccccccHHHHHHHHHHcccccEEEEEcccccccccEEEEccccccccEEEEEcccccccccccHHHHHHHHcccccEEccccEEEccccEEEEEccHHHHEEcccccccHHHHHHHHHHHHHHcccHHHEEEEccccccccccccc
MCNIPQLLEVGTkigatlpnfrgtivvggehdksknifgfkqlvtsqppdfqlpkispndlamlpyssgttgvpkgvklshnncavnleqcvhpdivnhiptsdtsqetVLSVLpffhiygfNGILNVVMMYGMhmitipkftpetYIECVVKYKPTILFVVPSLLLflashpavtpehLASIRevtcgaapatKSLIDKFKQKVQREDItirqgygmtetspctlytrfaipeaklgstgqLVMLGYlkneeatketvdsegwlhtgdvayydedgyfYIVDRTKELIKvkgnqvapykklaggvkfletiprnpagkvLRNElkvfgtnpkk
MCNIPQLLEVgtkigatlpnFRGTIVVGGEHDKSKNIFGFKQLVTSQPPDFQLPKISPNDLAMLPYSSGTTGVPKGVKLSHNNCAVNLEQCVHPDIVNHIPTSDTSQETVLSVLPFFHIYGFNGILNVVMMYGMHMITIPKFTPETYIECVVKYKPTILFVVPSLLLFLASHPAVTPEHLASIREVTCGAAPATkslidkfkqkvQREDitirqgygmtetspCTLYTRFAIPEAKLGSTGQLVMLGYLKNEEatketvdsegwlhtgdvayydeDGYFYIVDRTKELIKvkgnqvapykklaggvkfletiprnpagkvlrnelkvfgtnpkk
MCNIPQLLEVGTKIGATLPNFRGTIVVGGEHDKSKNIFGFKQLVTSQPPDFQLPKISPNDLAMLPYSSGTTGVPKGVKLSHNNCAVNLEQCVHPDIVNHIPTSDTSQETVLSVLPFFHIYGFNGILNVVMMYGMHMITIPKFTPETYIECVVKYKPTILFVVPSLLLFLASHPAVTPEHLASIREVTCGAAPATKSLIDKFKQKVQREDITIRQGYGMTETSPCTLYTRFAIPEAKLGSTGQLVMLGYLKNEEATKETVDSEGWLHTGDVAYYDEDGYFYIVDRTKELIKVKGNQVAPYKKLAGGVKFLETIPRNPAGKVLRNELKVFGTNPKK
****PQLLEVGTKIGATLPNFRGTIVVGGEHDKSKNIFGFKQLVT****************AMLPYS*GTTGVPKGVKLSHNNCAVNLEQCVHPDIVNHIPTSDTSQETVLSVLPFFHIYGFNGILNVVMMYGMHMITIPKFTPETYIECVVKYKPTILFVVPSLLLFLASHPAVTPEHLASIREVTCGAAPATKSLIDKFKQKVQREDITIRQGYGMTETSPCTLYTRFAIPEAKLGSTGQLVMLGYLKNEEATKETVDSEGWLHTGDVAYYDEDGYFYIVDRTKELIKVKGNQVAPYKKLAGGVKFLETIPRNPAGKVLRNEL*********
MCNIPQLLEVGTKIGATLPNFRGTIVVGGEHDKSKNIFGFKQLVTS*P*****PKISPNDLAMLPYSSGTTGVPKGVKLSHNNCAVNLEQCVHPDIVNHIPTSDTSQETVLSVLPFFHIYGFNGILNVVMMYGMHMITIPKFTPETYIECVVKYKPTILFVVPSLLLFLASHPAVTPEHLASIREVTCGAAPATKSLIDKFKQKVQREDITIRQGYGMTETSPCTLYTRFAIPEAKLGSTGQLVMLGYLKNEEATKETVDSEGWLHTGDVAYYDEDGYFYIVDRTKELIKVKGNQVAPYKKLAGGVKFLETIPRNPAGKVLRNELKV**T****
MCNIPQLLEVGTKIGATLPNFRGTIVVGGEHDKSKNIFGFKQLVTSQPPDFQLPKISPNDLAMLPYSSGTTGVPKGVKLSHNNCAVNLEQCVHPDIVNHIPTSDTSQETVLSVLPFFHIYGFNGILNVVMMYGMHMITIPKFTPETYIECVVKYKPTILFVVPSLLLFLASHPAVTPEHLASIREVTCGAAPATKSLIDKFKQKVQREDITIRQGYGMTETSPCTLYTRFAIPEAKLGSTGQLVMLGYLKNEEATKETVDSEGWLHTGDVAYYDEDGYFYIVDRTKELIKVKGNQVAPYKKLAGGVKFLETIPRNPAGKVLRNELKVFGTNPKK
MCNIPQLLEVGTKIGATLPNFRGTIVVGGEHDKSKNIFGFKQLVTSQPPDFQLPKISPNDLAMLPYSSGTTGVPKGVKLSHNNCAVNLEQCVHPDIVNHIPTSDTSQETVLSVLPFFHIYGFNGILNVVMMYGMHMITIPKFTPETYIECVVKYKPTILFVVPSLLLFLASHPAVTPEHLASIREVTCGAAPATKSLIDKFKQKVQREDITIRQGYGMTETSPCTLYTRFAIPEAKLGSTGQLVMLGYLKNEEATKETVDSEGWLHTGDVAYYDEDGYFYIVDRTKELIKVKGNQVAPYKKLAGGVKFLETIPRNPAGKVLRNELKVF******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCNIPQLLEVGTKIGATLPNFRGTIVVGGEHDKSKNIFGFKQLVTSQPPDFQLPKISPNDLAMLPYSSGTTGVPKGVKLSHNNCAVNLEQCVHPDIVNHIPTSDTSQETVLSVLPFFHIYGFNGILNVVMMYGMHMITIPKFTPETYIECVVKYKPTILFVVPSLLLFLASHPAVTPEHLASIREVTCGAAPATKSLIDKFKQKVQREDITIRQGYGMTETSPCTLYTRFAIPEAKLGSTGQLVMLGYLKNEEATKETVDSEGWLHTGDVAYYDEDGYFYIVDRTKELIKVKGNQVAPYKKLAGGVKFLETIPRNPAGKVLRNELKVFGTNPKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query334 2.2.26 [Sep-21-2011]
Q54P77551 Probable 4-coumarate--CoA yes N/A 0.751 0.455 0.390 3e-48
Q54P79551 Probable 4-coumarate--CoA no N/A 0.751 0.455 0.383 3e-47
Q54P78551 Probable 4-coumarate--CoA no N/A 0.754 0.457 0.371 2e-45
Q6ETN3554 Probable 4-coumarate--CoA yes N/A 0.841 0.507 0.315 6e-44
O24145547 4-coumarate--CoA ligase 1 N/A N/A 0.760 0.464 0.375 6e-44
Q9S725556 4-coumarate--CoA ligase 2 yes N/A 0.811 0.487 0.367 3e-43
P41636537 4-coumarate--CoA ligase O N/A N/A 0.739 0.459 0.363 2e-42
Q42982569 Probable 4-coumarate--CoA no N/A 0.712 0.418 0.380 7e-42
Q67W82559 Probable 4-coumarate--CoA no N/A 0.814 0.486 0.349 1e-41
Q6ZAC1539 Probable 4-coumarate--CoA no N/A 0.829 0.513 0.344 1e-40
>sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 Back     alignment and function desciption
 Score =  192 bits (488), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 116/297 (39%), Positives = 161/297 (54%), Gaps = 46/297 (15%)

Query: 37  IFGFKQLVTSQPPDFQLPKISPN-DLAMLPYSSGTTGVPKGVKLSHNNCAVNLEQCVHPD 95
           +  F QL+ +   D+ + +I P  D A++P+SSGTTG+ KGV LSH+N   N  Q     
Sbjct: 174 VMSFNQLINNNGKDYPIVRIDPKKDTAIIPFSSGTTGLFKGVCLSHHNIVSNTYQT---- 229

Query: 96  IVNHIPTSDTSQ-ETVLSVLPFFHIYGFNGILNVVMMYGMHMITIPKFTPETYIECVVKY 154
               I TS   + +TV+ +LPFFHIYG    L +++  G  ++ +PKF P  ++E + KY
Sbjct: 230 --QTIETSTYKKNDTVMGILPFFHIYGLMLFLMLMVKQGHRVVVLPKFEPVRFLELIQKY 287

Query: 155 KPTILFVVPSLLLFLASHPAVTPEHLASIREVTCGAAPATKSLIDKFKQKVQREDITIRQ 214
           K  I F+VP + +  A  P V    L+S+R +  GAAP +  + D  K++ +   + I+Q
Sbjct: 288 KVAISFIVPPVAIMFAKSPIVDKFDLSSLRTLFSGAAPLSSEVEDLIKERFKGR-LVIKQ 346

Query: 215 GYGMTETSPCTLYTRFAIPEA--KLGSTGQL----------------------------- 243
           GYG TE SP      F IP    K GS G L                             
Sbjct: 347 GYGATELSPAC----FVIPSGLVKSGSAGILLPNQLAKIISPETGENLGMGEKGEICIKG 402

Query: 244 --VMLGYLKNEEATKETVDSEGWLHTGDVAYYDEDGYFYIVDRTKELIKVKGNQVAP 298
             VMLGY  NE+AT E +D +G+L TGD+ Y DEDGY++IVDR+KELIK KG QV P
Sbjct: 403 PNVMLGYYNNEKATNEVIDKDGFLKTGDIGYVDEDGYYFIVDRSKELIKCKGFQVPP 459





Dictyostelium discoideum (taxid: 44689)
EC: 6EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 2
>sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 Back     alignment and function description
>sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 Back     alignment and function description
>sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 Back     alignment and function description
>sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 Back     alignment and function description
>sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 Back     alignment and function description
>sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 Back     alignment and function description
>sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query334
328708451 611 PREDICTED: 4-coumarate--CoA ligase 3-lik 0.877 0.479 0.618 1e-110
91081615 579 PREDICTED: similar to AMP dependent coa 0.973 0.561 0.479 7e-97
156555564 568 PREDICTED: probable 4-coumarate--CoA lig 0.886 0.521 0.531 2e-94
270005091 507 hypothetical protein TcasGA2_TC007099 [T 0.877 0.577 0.542 7e-92
332376418377 unknown [Dendroctonus ponderosae] 0.832 0.737 0.483 5e-89
357605939 586 putative AMP dependent coa ligase [Danau 0.979 0.558 0.448 3e-88
347967975 589 AGAP002503-PA [Anopheles gambiae str. PE 0.886 0.502 0.487 2e-81
157114710350 AMP dependent coa ligase [Aedes aegypti] 0.673 0.642 0.534 6e-70
345483267 563 PREDICTED: 4-coumarate--CoA ligase 2-lik 0.853 0.506 0.428 2e-56
321463518 488 hypothetical protein DAPPUDRAFT_307209 [ 0.874 0.598 0.396 4e-56
>gi|328708451|ref|XP_001951162.2| PREDICTED: 4-coumarate--CoA ligase 3-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/328 (61%), Positives = 246/328 (75%), Gaps = 35/328 (10%)

Query: 4   IPQLLEVGTKIGATLPNFRGTIVVGGEH--DKSKNIFGFKQLVTSQPPDFQLPKISPNDL 61
           I  LL V  ++  +L ++ GTIV GGE   ++   ++ FK LV+ Q P  +LPK   +++
Sbjct: 189 ISLLLPVIKEVSPSLKDYAGTIVFGGEEVANEKARVYDFKTLVSGQSPG-ELPKSFADEV 247

Query: 62  AMLPYSSGTTGVPKGVKLSHNNCAVNLEQCVHPDIVNHIPTSDTSQETVLSVLPFFHIYG 121
           A+LPYSSGTTG+PKGV L+H NCA+NLEQC++ DI+++ PT+DT QE VLSVLPFFHIYG
Sbjct: 248 ALLPYSSGTTGLPKGVMLTHRNCAINLEQCINKDIISYEPTTDTYQERVLSVLPFFHIYG 307

Query: 122 FNGILNVVMMYGMHMITIPKFTPETYIECVVKYKPTILFVVPSLLLFLASHPAVTPEHLA 181
           FNGILN V+ +G+HMITIPKFTPE+YIECV+KYKPT LFVVPSLLLFLASHP+V  EHL+
Sbjct: 308 FNGILNGVLSHGLHMITIPKFTPESYIECVLKYKPTFLFVVPSLLLFLASHPSVKAEHLS 367

Query: 182 SIREVTCGAAPATKSLIDKFKQKVQREDITIRQGYGMTETSPCTLYTRFAIPEAKLGSTG 241
           SI+E+TCGAAPA+K LID F  K Q+ DI IRQGYGMTE+SP +LYTR ++PE K GSTG
Sbjct: 368 SIKEITCGAAPASKGLIDNFLLKAQK-DIRIRQGYGMTESSPVSLYTRVSLPENKTGSTG 426

Query: 242 QL-------------------------------VMLGYLKNEEATKETVDSEGWLHTGDV 270
           QL                               VM GYL NE+ATKETVD +GWLHTGDV
Sbjct: 427 QLVLSTQARVVSLTDGSDLGPHKSGELLIRGPQVMAGYLNNEKATKETVDEDGWLHTGDV 486

Query: 271 AYYDEDGYFYIVDRTKELIKVKGNQVAP 298
           AYYDED YF+IVDRTKELIKVKGNQV+P
Sbjct: 487 AYYDEDEYFFIVDRTKELIKVKGNQVSP 514




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91081615|ref|XP_966640.1| PREDICTED: similar to AMP dependent coa ligase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|156555564|ref|XP_001604694.1| PREDICTED: probable 4-coumarate--CoA ligase 3-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|270005091|gb|EFA01539.1| hypothetical protein TcasGA2_TC007099 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332376418|gb|AEE63349.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|357605939|gb|EHJ64841.1| putative AMP dependent coa ligase [Danaus plexippus] Back     alignment and taxonomy information
>gi|347967975|ref|XP_312436.5| AGAP002503-PA [Anopheles gambiae str. PEST] gi|333468218|gb|EAA44923.5| AGAP002503-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157114710|ref|XP_001652383.1| AMP dependent coa ligase [Aedes aegypti] gi|108883536|gb|EAT47761.1| AAEL001128-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|345483267|ref|XP_001603179.2| PREDICTED: 4-coumarate--CoA ligase 2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|321463518|gb|EFX74533.1| hypothetical protein DAPPUDRAFT_307209 [Daphnia pulex] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query334
UNIPROTKB|Q5LVA1535 fadD "4-coumarate:CoA ligase" 0.661 0.413 0.346 8.3e-55
TIGR_CMR|SPO_0801535 SPO_0801 "4-coumarate:CoA liga 0.661 0.413 0.346 8.3e-55
FB|FBgn0027601597 pdgy "pudgy" [Drosophila melan 0.670 0.375 0.348 1.2e-46
WB|WBGene00008669544 acs-14 [Caenorhabditis elegans 0.643 0.395 0.368 1.8e-46
FB|FBgn0039156544 CG6178 [Drosophila melanogaste 0.652 0.400 0.329 6.6e-45
TAIR|locus:2094716556 4CL2 "4-coumarate:CoA ligase 2 0.667 0.401 0.354 1.9e-44
TAIR|locus:2094771570 4CL5 "4-coumarate:CoA ligase 5 0.616 0.361 0.319 3.7e-42
TAIR|locus:2017602561 4CL1 "4-coumarate:CoA ligase 1 0.571 0.340 0.371 1.9e-41
DICTYBASE|DDB_G0284831551 4cl1 "4-coumarate-CoA ligase" 0.730 0.442 0.340 1.4e-39
TIGR_CMR|CHY_0437556 CHY_0437 "long-chain-fatty-aci 0.550 0.330 0.36 3.3e-39
UNIPROTKB|Q5LVA1 fadD "4-coumarate:CoA ligase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
 Score = 350 (128.3 bits), Expect = 8.3e-55, Sum P(3) = 8.3e-55
 Identities = 86/248 (34%), Positives = 133/248 (53%)

Query:     6 QLLEVGTKIGATLPNF--------RGT----IVVGGEHDKSKNIFGFKQLVTSQPPDFQL 53
             QL + G ++  T+P F         GT    IVV G  D  +       L+   P + Q 
Sbjct:   123 QLNDAGAQVLVTIPAFLDTARAAIEGTGVDRIVVVG--DAPEGTLALSDLM-GPPLEHQA 179

Query:    54 PKISPNDLAMLPYSSGTTGVPKGVKLSHNNCAVNLEQCVHPDIVNHIPTSDTSQETVLSV 113
             P      + +LPYSSGTTG+PKGV L+H N  VN++Q + P  +N  P   T+     + 
Sbjct:   180 PVDVAEHVVVLPYSSGTTGMPKGVMLTHRNLVVNIDQTLLPADLN--PGEMTT-----AF 232

Query:   114 LPFFHIYGFNGILNVVMMYGMHMITIPKFTPETYIECVVKYKPTILFVVPSLLLFLASHP 173
             LPFFHIYG   ++N+ +  G  ++T+P+F  E Y++CV++Y+   L++VP + L LA HP
Sbjct:   233 LPFFHIYGLQVLMNIYLTAGGGLVTLPRFDLEQYLDCVIRYRTPRLWIVPPVALALAKHP 292

Query:   174 AVTPEHLASIREVTCGAAPATKSLIDKFKQKVQREDITIRQGYGMTETSPCTLYTRFAIP 233
              V    L+ + +V C AAP  + + +   +++      + QGYGMTE SP +  +     
Sbjct:   293 VVANYDLSCVEQVFCAAAPLGRDVAEGLGERINAR---VNQGYGMTELSPVSHVSPHG-- 347

Query:   234 EAKLGSTG 241
             E K G++G
Sbjct:   348 EGKPGASG 355


GO:0009698 "phenylpropanoid metabolic process" evidence=ISS
GO:0016207 "4-coumarate-CoA ligase activity" evidence=ISS
TIGR_CMR|SPO_0801 SPO_0801 "4-coumarate:CoA ligase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
FB|FBgn0027601 pdgy "pudgy" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00008669 acs-14 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0039156 CG6178 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2094716 4CL2 "4-coumarate:CoA ligase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094771 4CL5 "4-coumarate:CoA ligase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2017602 4CL1 "4-coumarate:CoA ligase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0284831 4cl1 "4-coumarate-CoA ligase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0437 CHY_0437 "long-chain-fatty-acid--CoA ligase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query334
cd05911487 cd05911, Firefly_Luc_like, Firefly luciferase of l 1e-92
cd05904504 cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) 5e-88
cd05936468 cd05936, FC-FACS_FadD_like, Prokaryotic long-chain 4e-69
COG0318534 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/ 9e-68
pfam00501412 pfam00501, AMP-binding, AMP-binding enzyme 1e-67
PRK06187521 PRK06187, PRK06187, long-chain-fatty-acid--CoA lig 6e-65
PLN02246537 PLN02246, PLN02246, 4-coumarate--CoA ligase 1e-64
cd05917347 cd05917, FACL_like_2, Uncharacterized subfamily of 5e-63
cd04433338 cd04433, AFD_class_I, Adenylate forming domain, Cl 6e-61
PRK07656513 PRK07656, PRK07656, long-chain-fatty-acid--CoA lig 2e-59
cd05929342 cd05929, BACL_like, Bacterial Bile acid CoA ligase 3e-57
cd05907456 cd05907, VL_LC_FACS_like, Long-chain fatty acid Co 9e-55
cd05935430 cd05935, LC_FACS_like, Putative long-chain fatty a 3e-50
cd12119517 cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synth 1e-48
PLN02574560 PLN02574, PLN02574, 4-coumarate--CoA ligase-like 2e-47
COG1022613 COG1022, FAA1, Long-chain acyl-CoA synthetases (AM 1e-45
PLN02330546 PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 1e-42
PRK06710563 PRK06710, PRK06710, long-chain-fatty-acid--CoA lig 2e-42
cd05909489 cd05909, AAS_C, C-terminal domain of the acyl-acyl 4e-41
PRK086331146 PRK08633, PRK08633, 2-acyl-glycerophospho-ethanola 5e-41
cd05934421 cd05934, FACL_DitJ_like, Uncharacterized subfamily 1e-40
cd05922350 cd05922, FACL_like_6, Uncharacterized subfamily of 1e-39
cd05926345 cd05926, FACL_fum10p_like, Subfamily of fatty acid 1e-39
PRK05605573 PRK05605, PRK05605, long-chain-fatty-acid--CoA lig 2e-39
cd05903437 cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA li 1e-38
cd05932504 cd05932, LC_FACS_bac, Bacterial long-chain fatty a 1e-38
PRK08314546 PRK08314, PRK08314, long-chain-fatty-acid--CoA lig 3e-37
cd05941430 cd05941, MCS, Malonyl-CoA synthetase (MCS) 6e-37
PRK03640483 PRK03640, PRK03640, O-succinylbenzoic acid--CoA li 7e-37
PRK12492562 PRK12492, PRK12492, long-chain-fatty-acid--CoA lig 4e-36
cd05912407 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase 2e-35
PRK12583558 PRK12583, PRK12583, acyl-CoA synthetase; Provision 1e-34
PRK08751560 PRK08751, PRK08751, putative long-chain fatty acyl 1e-34
PRK08974560 PRK08974, PRK08974, long-chain-fatty-acid--CoA lig 2e-34
COG0365528 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fat 2e-34
PRK05677562 PRK05677, PRK05677, long-chain-fatty-acid--CoA lig 2e-33
cd05959506 cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and 2e-32
PRK07786542 PRK07786, PRK07786, long-chain-fatty-acid--CoA lig 4e-32
PRK08315559 PRK08315, PRK08315, AMP-binding domain protein; Va 5e-32
PRK06839496 PRK06839, PRK06839, acyl-CoA synthetase; Validated 2e-31
cd12118520 cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synt 2e-31
PRK06188524 PRK06188, PRK06188, acyl-CoA synthetase; Validated 5e-31
PRK07514504 PRK07514, PRK07514, malonyl-CoA synthase; Validate 9e-31
cd05920483 cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP l 2e-29
cd05944359 cd05944, FACL_like_4, Uncharacterized subfamily of 2e-28
PRK08316523 PRK08316, PRK08316, acyl-CoA synthetase; Validated 1e-27
TIGR03205541 TIGR03205, pimA, dicarboxylate--CoA ligase PimA 4e-27
PRK07529 632 PRK07529, PRK07529, AMP-binding domain protein; Va 2e-26
PRK06087547 PRK06087, PRK06087, short chain acyl-CoA synthetas 2e-25
PRK08008517 PRK08008, caiC, putative crotonobetaine/carnitine- 2e-25
cd05919436 cd05919, BCL_like, Benzoate CoA ligase (BCL) and s 4e-25
TIGR01923436 TIGR01923, menE, O-succinylbenzoate-CoA ligase 5e-25
cd05970537 cd05970, MACS_AAE_MA_like, Medium-chain acyl-CoA s 2e-24
cd05972430 cd05972, MACS_like, Medium-chain acyl-CoA syntheta 7e-24
PRK07059557 PRK07059, PRK07059, Long-chain-fatty-acid--CoA lig 1e-23
PRK06018542 PRK06018, PRK06018, putative acyl-CoA synthetase; 2e-23
PRK06178567 PRK06178, PRK06178, acyl-CoA synthetase; Validated 3e-23
cd05971439 cd05971, MACS_like_3, Uncharacterized subfamily of 4e-22
PRK09088488 PRK09088, PRK09088, acyl-CoA synthetase; Validated 4e-22
PRK07787471 PRK07787, PRK07787, acyl-CoA synthetase; Validated 4e-22
PRK13295547 PRK13295, PRK13295, cyclohexanecarboxylate-CoA lig 4e-22
cd05945447 cd05945, DltA, D-alanine:D-alanyl carrier protein 9e-22
TIGR01733409 TIGR01733, AA-adenyl-dom, amino acid adenylation d 2e-21
cd05923495 cd05923, CBAL, 4-Chlorobenzoate-CoA ligase (CBAL) 4e-21
PRK08162545 PRK08162, PRK08162, acyl-CoA synthetase; Validated 9e-21
PRK06155542 PRK06155, PRK06155, crotonobetaine/carnitine-CoA l 3e-20
PRK06145497 PRK06145, PRK06145, acyl-CoA synthetase; Validated 3e-20
PRK07008539 PRK07008, PRK07008, long-chain-fatty-acid--CoA lig 4e-20
PLN02860563 PLN02860, PLN02860, o-succinylbenzoate-CoA ligase 5e-20
cd05940444 cd05940, FATP_FACS, Fatty acid transport proteins 5e-20
cd05908499 cd05908, A_NRPS_MycA_like, The adenylation domain 7e-20
PRK068141140 PRK06814, PRK06814, acylglycerophosphoethanolamine 7e-20
TIGR03098517 TIGR03098, ligase_PEP_1, acyl-CoA ligase (AMP-form 2e-19
cd05906560 cd05906, A_NRPS_TubE_like, The adenylation domain 2e-19
TIGR03208538 TIGR03208, cyc_hxne_CoA_lg, cyclohexanecarboxylate 3e-19
cd05933 594 cd05933, ACSBG_like, Bubblegum-like very long-chai 3e-19
PRK07768545 PRK07768, PRK07768, long-chain-fatty-acid--CoA lig 4e-19
cd05914448 cd05914, FACL_like_3, Uncharacterized subfamily of 3e-18
TIGR02262508 TIGR02262, benz_CoA_lig, benzoate-CoA ligase famil 9e-18
cd05921559 cd05921, FCS, Feruloyl-CoA synthetase (FCS) 1e-17
cd05927539 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty 1e-17
PRK12406509 PRK12406, PRK12406, long-chain-fatty-acid--CoA lig 1e-17
PRK07470528 PRK07470, PRK07470, acyl-CoA synthetase; Validated 2e-17
cd05918447 cd05918, A_NRPS_SidN3_like, The adenylation (A) do 2e-17
PRK07788549 PRK07788, PRK07788, acyl-CoA synthetase; Validated 2e-17
PRK04319570 PRK04319, PRK04319, acetyl-CoA synthetase; Provisi 3e-17
PRK06334539 PRK06334, PRK06334, long chain fatty acid--[acyl-c 4e-17
PRK08043718 PRK08043, PRK08043, bifunctional acyl-[acyl carrie 1e-16
PRK05620576 PRK05620, PRK05620, long-chain-fatty-acid--CoA lig 2e-16
PRK08180 614 PRK08180, PRK08180, feruloyl-CoA synthase; Reviewe 5e-16
TIGR02275526 TIGR02275, DHB_AMP_lig, 2,3-dihydroxybenzoate-AMP 8e-16
PRK08276502 PRK08276, PRK08276, long-chain-fatty-acid--CoA lig 8e-16
PLN02614666 PLN02614, PLN02614, long-chain acyl-CoA synthetase 1e-15
COG1020642 COG1020, EntF, Non-ribosomal peptide synthetase mo 1e-15
cd05958487 cd05958, ABCL, 2-aminobenzoate-CoA ligase (ABCL) 2e-15
cd05930445 cd05930, A_NRPS, The adenylation domain of nonribo 2e-15
PRK07867529 PRK07867, PRK07867, acyl-CoA synthetase; Validated 6e-15
PRK13382537 PRK13382, PRK13382, acyl-CoA synthetase; Provision 3e-14
cd05973440 cd05973, MACS_like_2, Uncharacterized subfamily of 3e-14
PRK13391511 PRK13391, PRK13391, acyl-CoA synthetase; Provision 5e-14
cd05924365 cd05924, FACL_like_5, Uncharacterized subfamily of 1e-13
PLN03102579 PLN03102, PLN03102, acyl-activating enzyme; Provis 4e-13
PRK05857540 PRK05857, PRK05857, acyl-CoA synthetase; Validated 6e-13
PRK09274 552 PRK09274, PRK09274, peptide synthase; Provisional 8e-13
cd05974433 cd05974, MACS_like_1, Uncharacterized subfamily of 8e-13
cd05927 539 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty 1e-12
PRK12582624 PRK12582, PRK12582, acyl-CoA synthetase; Provision 1e-12
COG1021542 COG1021, EntE, Peptide arylation enzymes [Secondar 1e-12
cd05931 547 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) 2e-12
PLN02479567 PLN02479, PLN02479, acetate-CoA ligase 2e-12
PRK13388540 PRK13388, PRK13388, acyl-CoA synthetase; Provision 2e-12
PLN02736651 PLN02736, PLN02736, long-chain acyl-CoA synthetase 5e-12
PTZ00216700 PTZ00216, PTZ00216, acyl-CoA synthetase; Provision 1e-11
PLN02861660 PLN02861, PLN02861, long-chain-fatty-acid-CoA liga 2e-11
PRK05852534 PRK05852, PRK05852, acyl-CoA synthetase; Validated 2e-11
cd05910455 cd05910, FACL_like_1, Uncharacterized subfamily of 5e-11
PRK06164540 PRK06164, PRK06164, acyl-CoA synthetase; Validated 5e-11
cd12117474 cd12117, A_NRPS_Srf_like, The adenylation domain o 1e-10
PRK12467 3956 PRK12467, PRK12467, peptide synthase; Provisional 2e-10
cd05937468 cd05937, FATP_chFAT1_like, Uncharacterized subfami 2e-10
PRK09192579 PRK09192, PRK09192, acyl-CoA synthetase; Validated 5e-10
PTZ00237647 PTZ00237, PTZ00237, acetyl-CoA synthetase; Provisi 6e-10
cd05931547 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) 9e-10
PRK07798533 PRK07798, PRK07798, acyl-CoA synthetase; Validated 1e-09
cd05928530 cd05928, MACS_euk, Eukaryotic Medium-chain acyl-Co 2e-09
cd12114476 cd12114, A_NRPS_TlmIV_like, The adenylation domain 2e-09
PRK12316 5163 PRK12316, PRK12316, peptide synthase; Provisional 2e-09
cd05933 594 cd05933, ACSBG_like, Bubblegum-like very long-chai 6e-09
PLN02387696 PLN02387, PLN02387, long-chain-fatty-acid-CoA liga 7e-09
PRK05850 578 PRK05850, PRK05850, acyl-CoA synthetase; Validated 8e-09
PRK12316 5163 PRK12316, PRK12316, peptide synthase; Provisional 2e-08
cd05938535 cd05938, hsFATP2a_ACSVL_like, Fatty acid transport 2e-08
PRK12316 5163 PRK12316, PRK12316, peptide synthase; Provisional 3e-08
cd05969443 cd05969, MACS_like_4, Uncharacterized subfamily of 5e-08
PLN02430 660 PLN02430, PLN02430, long-chain-fatty-acid-CoA liga 1e-07
PLN02736 651 PLN02736, PLN02736, long-chain acyl-CoA synthetase 2e-07
PRK12467 3956 PRK12467, PRK12467, peptide synthase; Provisional 2e-07
PRK05691 4334 PRK05691, PRK05691, peptide synthase; Validated 3e-07
PRK07445452 PRK07445, PRK07445, O-succinylbenzoic acid--CoA li 3e-07
cd05915509 cd05915, ttLC_FACS_like, Fatty acyl-CoA synthetase 4e-07
cd05905 556 cd05905, Dip2, Disco-interacting protein 2 (Dip2) 7e-07
cd12116438 cd12116, A_NRPS_Ta1_like, The adenylation domain o 8e-07
PRK08279600 PRK08279, PRK08279, long-chain-acyl-CoA synthetase 9e-07
PTZ00216 700 PTZ00216, PTZ00216, acyl-CoA synthetase; Provision 1e-06
PRK07824358 PRK07824, PRK07824, O-succinylbenzoic acid--CoA li 1e-06
PRK09192 579 PRK09192, PRK09192, acyl-CoA synthetase; Validated 3e-06
PRK10252 1296 PRK10252, entF, enterobactin synthase subunit F; P 6e-06
PRK07769 631 PRK07769, PRK07769, long-chain-fatty-acid--CoA lig 8e-06
PRK07638487 PRK07638, PRK07638, acyl-CoA synthetase; Validated 9e-06
cd05967607 cd05967, PrpE, Propionyl-CoA synthetase (PrpE) 1e-05
PRK13383516 PRK13383, PRK13383, acyl-CoA synthetase; Provision 1e-05
PRK12467 3956 PRK12467, PRK12467, peptide synthase; Provisional 2e-05
cd05968474 cd05968, AACS_like, Uncharacterized acyl-CoA synth 2e-05
PLN02574560 PLN02574, PLN02574, 4-coumarate--CoA ligase-like 3e-05
cd12115449 cd12115, A_NRPS_Sfm_like, The adenylation domain o 4e-05
PLN02387 696 PLN02387, PLN02387, long-chain-fatty-acid-CoA liga 7e-05
PRK13390501 PRK13390, PRK13390, acyl-CoA synthetase; Provision 8e-05
PRK05691 4334 PRK05691, PRK05691, peptide synthase; Validated 1e-04
PRK12316 5163 PRK12316, PRK12316, peptide synthase; Provisional 2e-04
TIGR01734502 TIGR01734, D-ala-DACP-lig, D-alanine--poly(phospho 2e-04
PTZ00342 746 PTZ00342, PTZ00342, acyl-CoA synthetase; Provision 2e-04
PTZ00342 746 PTZ00342, PTZ00342, acyl-CoA synthetase; Provision 3e-04
PRK10946536 PRK10946, entE, enterobactin synthase subunit E; P 5e-04
PRK05851525 PRK05851, PRK05851, long-chain-fatty-acid--[acyl-c 5e-04
PRK05691 4334 PRK05691, PRK05691, peptide synthase; Validated 7e-04
cd05939474 cd05939, hsFATP4_like, Fatty acid transport protei 7e-04
PRK04813503 PRK04813, PRK04813, D-alanine--poly(phosphoribitol 9e-04
PRK12476 612 PRK12476, PRK12476, putative fatty-acid--CoA ligas 0.001
cd05966602 cd05966, ACS, Acetyl-CoA synthetase (also known as 0.001
PLN02246537 PLN02246, PLN02246, 4-coumarate--CoA ligase 0.002
PRK08308414 PRK08308, PRK08308, acyl-CoA synthetase; Validated 0.002
TIGR02188625 TIGR02188, Ac_CoA_lig_AcsA, acetate--CoA ligase 0.002
COG1541438 COG1541, PaaK, Coenzyme F390 synthetase [Coenzyme 0.002
PLN02430 660 PLN02430, PLN02430, long-chain-fatty-acid-CoA liga 0.003
PRK04813503 PRK04813, PRK04813, D-alanine--poly(phosphoribitol 0.003
cd05968474 cd05968, AACS_like, Uncharacterized acyl-CoA synth 0.004
>gnl|CDD|213279 cd05911, Firefly_Luc_like, Firefly luciferase of light emitting insects and 4-Coumarate-CoA Ligase (4CL) Back     alignment and domain information
 Score =  284 bits (728), Expect = 1e-92
 Identities = 128/327 (39%), Positives = 169/327 (51%), Gaps = 42/327 (12%)

Query: 5   PQLLEVGTKIGATLPNFRGTIVVGGEHDKSKNIFGFKQ-LVTSQPPDFQLPKI-SPNDLA 62
           P  L+   +    L      IV+    D    I    +  + ++      P I   +D A
Sbjct: 90  PDELDKVKEAAKELGPVVRIIVLDSAPDGVLRIEDLLEPRLGAEDEFRPTPLIDGKDDTA 149

Query: 63  MLPYSSGTTGVPKGVKLSHNNCAVNLEQCVHPDIVNHIPTSDTSQETVLSVLPFFHIYGF 122
            L YSSGTTG+PKGV LSH N   NL Q       N     D+S + VL+ LPF+H YG 
Sbjct: 150 ALLYSSGTTGLPKGVMLSHKNIIANLSQVQDTLKGNP----DSSNDVVLTFLPFYHAYGL 205

Query: 123 NGILNVVMMYGMHMITIPKFTPETYIECVVKYKPTILFVVPSLLLFLASHPAVTPEHLAS 182
              L   ++ G  +I +PKF  ET+++ + KYK T LF+VP + + LA  P V    L+S
Sbjct: 206 TTTLAS-LLCGATVIIMPKFDSETFLKLIEKYKVTSLFLVPPIAVALAKSPLVDKYDLSS 264

Query: 183 IREVTCGAAPATKSLIDKFKQKVQREDITIRQGYGMTETSPCTLYTRFAIPEAKLGSTGQ 242
           +R +  GAAP +K L ++ +++      TI+QGYGMTET P T  T     + K GS G+
Sbjct: 265 LRVIFSGAAPLSKELQEELRKRFPNT--TIKQGYGMTETGPATTLTPP--GDEKPGSVGR 320

Query: 243 L-------------------------------VMLGYLKNEEATKETVDSEGWLHTGDVA 271
           L                               +M GYL N EATKET+D +GWLHTGD+ 
Sbjct: 321 LVPNVEAKIVDEDGGKSLGPNERGELCVKGPQIMKGYLNNPEATKETIDEDGWLHTGDIG 380

Query: 272 YYDEDGYFYIVDRTKELIKVKGNQVAP 298
           Y+DEDG FYIVDR KELIK KG QV P
Sbjct: 381 YFDEDGNFYIVDRKKELIKYKGYQVPP 407


This family contains two functionally unique groups of proteins; one group is insect firefly luciferases and the other is plant 4-coumarate:coenzyme A ligases. However, they share significant sequence similarity in spite of their functional diversity. Luciferase catalyzes the production of light in the presence of MgATP, molecular oxygen, and luciferin. In the first step, luciferin is activated by acylation of its carboxylate group with ATP, resulting in an enzyme-bound luciferyl adenylate. In the second step, luciferyl adenylate reacts with molecular oxygen, producing an enzyme-bound excited state product (Luc=O*) and releasing AMP. This excited-state product then decays to the ground state (Luc=O), emitting a quantum of visible light. 4-coumarate:coenzyme A ligase is a key enzyme in the phenylpropanoid metabolic pathway for monolignol and flavonoid biosynthesis. It catalyzes the synthesis of hydroxycinnamate-CoA thioesters in a two-step reaction, involving the formation of hydroxycinnamate-AMP anhydride and then the nucleophilic substitution of AMP by CoA. The phenylpropanoid pathway is one of the most important secondary metabolism pathways in plants and hydroxycinnamate-CoA thioesters are the precursors of lignin and other important phenylpropanoids. Length = 487

>gnl|CDD|213272 cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) Back     alignment and domain information
>gnl|CDD|213302 cd05936, FC-FACS_FadD_like, Prokaryotic long-chain fatty acid CoA synthetases similar to Escherichia coli FadD Back     alignment and domain information
>gnl|CDD|223395 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215954 pfam00501, AMP-binding, AMP-binding enzyme Back     alignment and domain information
>gnl|CDD|235730 PRK06187, PRK06187, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|215137 PLN02246, PLN02246, 4-coumarate--CoA ligase Back     alignment and domain information
>gnl|CDD|213284 cd05917, FACL_like_2, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|213270 cd04433, AFD_class_I, Adenylate forming domain, Class I Back     alignment and domain information
>gnl|CDD|236072 PRK07656, PRK07656, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213295 cd05929, BACL_like, Bacterial Bile acid CoA ligases and similar proteins Back     alignment and domain information
>gnl|CDD|213275 cd05907, VL_LC_FACS_like, Long-chain fatty acid CoA synthetases and Bubblegum-like very long-chain fatty acid CoA synthetases Back     alignment and domain information
>gnl|CDD|213301 cd05935, LC_FACS_like, Putative long-chain fatty acid CoA ligase Back     alignment and domain information
>gnl|CDD|213327 cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles Back     alignment and domain information
>gnl|CDD|215312 PLN02574, PLN02574, 4-coumarate--CoA ligase-like Back     alignment and domain information
>gnl|CDD|223953 COG1022, FAA1, Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|215189 PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 Back     alignment and domain information
>gnl|CDD|180666 PRK06710, PRK06710, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213277 cd05909, AAS_C, C-terminal domain of the acyl-acyl carrier protein synthetase (also called 2-acylglycerophosphoethanolamine acyltransferase, Aas) Back     alignment and domain information
>gnl|CDD|236315 PRK08633, PRK08633, 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>gnl|CDD|213300 cd05934, FACL_DitJ_like, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|213289 cd05922, FACL_like_6, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|213292 cd05926, FACL_fum10p_like, Subfamily of fatty acid CoA ligase (FACL) similar to Fum10p of Gibberella moniliformis Back     alignment and domain information
>gnl|CDD|235531 PRK05605, PRK05605, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213271 cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA ligase (also called cyclohex-1-ene-1-carboxylate:CoA ligase) Back     alignment and domain information
>gnl|CDD|213298 cd05932, LC_FACS_bac, Bacterial long-chain fatty acid CoA synthetase (LC-FACS), including Marinobacter hydrocarbonoclasticus isoprenoid Coenzyme A synthetase Back     alignment and domain information
>gnl|CDD|236235 PRK08314, PRK08314, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213307 cd05941, MCS, Malonyl-CoA synthetase (MCS) Back     alignment and domain information
>gnl|CDD|235146 PRK03640, PRK03640, O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|171539 PRK12492, PRK12492, long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213280 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase (also known as O-succinylbenzoate-CoA synthase, OSB-CoA synthetase, or MenE) Back     alignment and domain information
>gnl|CDD|237145 PRK12583, PRK12583, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|181546 PRK08751, PRK08751, putative long-chain fatty acyl CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|236359 PRK08974, PRK08974, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|223442 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|168170 PRK05677, PRK05677, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213312 cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and 4-Hydroxybenzoate-Coenzyme A Ligase (4-HBA-CoA ligase) Back     alignment and domain information
>gnl|CDD|169098 PRK07786, PRK07786, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|236236 PRK08315, PRK08315, AMP-binding domain protein; Validated Back     alignment and domain information
>gnl|CDD|168698 PRK06839, PRK06839, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213326 cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles and Arabidopsis Back     alignment and domain information
>gnl|CDD|235731 PRK06188, PRK06188, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|181011 PRK07514, PRK07514, malonyl-CoA synthase; Validated Back     alignment and domain information
>gnl|CDD|213287 cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>gnl|CDD|213309 cd05944, FACL_like_4, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|181381 PRK08316, PRK08316, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|132249 TIGR03205, pimA, dicarboxylate--CoA ligase PimA Back     alignment and domain information
>gnl|CDD|236043 PRK07529, PRK07529, AMP-binding domain protein; Validated Back     alignment and domain information
>gnl|CDD|180393 PRK06087, PRK06087, short chain acyl-CoA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|181195 PRK08008, caiC, putative crotonobetaine/carnitine-CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213286 cd05919, BCL_like, Benzoate CoA ligase (BCL) and similar adenylate forming enzymes Back     alignment and domain information
>gnl|CDD|162605 TIGR01923, menE, O-succinylbenzoate-CoA ligase Back     alignment and domain information
>gnl|CDD|213317 cd05970, MACS_AAE_MA_like, Medium-chain acyl-CoA synthetase (MACS) of AAE_MA like Back     alignment and domain information
>gnl|CDD|213319 cd05972, MACS_like, Medium-chain acyl-CoA synthetase (MACS or ACSM) Back     alignment and domain information
>gnl|CDD|235923 PRK07059, PRK07059, Long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|235673 PRK06018, PRK06018, putative acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|235724 PRK06178, PRK06178, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213318 cd05971, MACS_like_3, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) Back     alignment and domain information
>gnl|CDD|181644 PRK09088, PRK09088, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|236096 PRK07787, PRK07787, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|171961 PRK13295, PRK13295, cyclohexanecarboxylate-CoA ligase; Reviewed Back     alignment and domain information
>gnl|CDD|213310 cd05945, DltA, D-alanine:D-alanyl carrier protein ligase (DltA) Back     alignment and domain information
>gnl|CDD|233550 TIGR01733, AA-adenyl-dom, amino acid adenylation domain Back     alignment and domain information
>gnl|CDD|213290 cd05923, CBAL, 4-Chlorobenzoate-CoA ligase (CBAL) Back     alignment and domain information
>gnl|CDD|236169 PRK08162, PRK08162, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|235719 PRK06155, PRK06155, crotonobetaine/carnitine-CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|102207 PRK06145, PRK06145, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|235908 PRK07008, PRK07008, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|215464 PLN02860, PLN02860, o-succinylbenzoate-CoA ligase Back     alignment and domain information
>gnl|CDD|213306 cd05940, FATP_FACS, Fatty acid transport proteins (FATP) play dual roles as fatty acid transporters and its activation enzymes Back     alignment and domain information
>gnl|CDD|213276 cd05908, A_NRPS_MycA_like, The adenylation domain of nonribosomal peptide synthetases (NRPS) similar to mycosubtilin synthase subunit A (MycA) Back     alignment and domain information
>gnl|CDD|235865 PRK06814, PRK06814, acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|211788 TIGR03098, ligase_PEP_1, acyl-CoA ligase (AMP-forming), exosortase A-associated Back     alignment and domain information
>gnl|CDD|213274 cd05906, A_NRPS_TubE_like, The adenylation domain (A domain) of a family of nonribosomal peptide synthetases (NRPSs) synthesizing toxins and antitumor agents Back     alignment and domain information
>gnl|CDD|132252 TIGR03208, cyc_hxne_CoA_lg, cyclohexanecarboxylate-CoA ligase Back     alignment and domain information
>gnl|CDD|213299 cd05933, ACSBG_like, Bubblegum-like very long-chain fatty acid CoA synthetase (VL-FACS) Back     alignment and domain information
>gnl|CDD|236091 PRK07768, PRK07768, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213282 cd05914, FACL_like_3, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|233803 TIGR02262, benz_CoA_lig, benzoate-CoA ligase family Back     alignment and domain information
>gnl|CDD|213288 cd05921, FCS, Feruloyl-CoA synthetase (FCS) Back     alignment and domain information
>gnl|CDD|213293 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty acid CoA synthetase (LC-FACS) Back     alignment and domain information
>gnl|CDD|183506 PRK12406, PRK12406, long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|180988 PRK07470, PRK07470, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213285 cd05918, A_NRPS_SidN3_like, The adenylation (A) domain of siderophore-synthesizing nonribosomal peptide synthetases (NRPS) Back     alignment and domain information
>gnl|CDD|236097 PRK07788, PRK07788, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|235279 PRK04319, PRK04319, acetyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|180533 PRK06334, PRK06334, long chain fatty acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>gnl|CDD|181207 PRK08043, PRK08043, bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated Back     alignment and domain information
>gnl|CDD|180167 PRK05620, PRK05620, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|236175 PRK08180, PRK08180, feruloyl-CoA synthase; Reviewed Back     alignment and domain information
>gnl|CDD|233807 TIGR02275, DHB_AMP_lig, 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>gnl|CDD|236215 PRK08276, PRK08276, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|166255 PLN02614, PLN02614, long-chain acyl-CoA synthetase Back     alignment and domain information
>gnl|CDD|223951 COG1020, EntF, Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213311 cd05958, ABCL, 2-aminobenzoate-CoA ligase (ABCL) Back     alignment and domain information
>gnl|CDD|213296 cd05930, A_NRPS, The adenylation domain of nonribosomal peptide synthetases (NRPS) Back     alignment and domain information
>gnl|CDD|236120 PRK07867, PRK07867, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|172019 PRK13382, PRK13382, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213320 cd05973, MACS_like_2, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) Back     alignment and domain information
>gnl|CDD|184022 PRK13391, PRK13391, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213291 cd05924, FACL_like_5, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|215576 PLN03102, PLN03102, acyl-activating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|180293 PRK05857, PRK05857, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|236443 PRK09274, PRK09274, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|213321 cd05974, MACS_like_1, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) Back     alignment and domain information
>gnl|CDD|213293 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty acid CoA synthetase (LC-FACS) Back     alignment and domain information
>gnl|CDD|237144 PRK12582, PRK12582, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|223952 COG1021, EntE, Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213297 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) Back     alignment and domain information
>gnl|CDD|178097 PLN02479, PLN02479, acetate-CoA ligase Back     alignment and domain information
>gnl|CDD|237374 PRK13388, PRK13388, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|178337 PLN02736, PLN02736, long-chain acyl-CoA synthetase Back     alignment and domain information
>gnl|CDD|240316 PTZ00216, PTZ00216, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|178452 PLN02861, PLN02861, long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>gnl|CDD|235625 PRK05852, PRK05852, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213278 cd05910, FACL_like_1, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|235722 PRK06164, PRK06164, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213325 cd12117, A_NRPS_Srf_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Bacillus subtilis termination module Surfactin (SrfA-C) Back     alignment and domain information
>gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|213303 cd05937, FATP_chFAT1_like, Uncharacterized subfamily of bifunctional fatty acid transporter/very-long-chain acyl-CoA synthetase in fungi Back     alignment and domain information
>gnl|CDD|236403 PRK09192, PRK09192, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|240325 PTZ00237, PTZ00237, acetyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213297 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) Back     alignment and domain information
>gnl|CDD|236100 PRK07798, PRK07798, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213294 cd05928, MACS_euk, Eukaryotic Medium-chain acyl-CoA synthetase (MACS or ACSM) Back     alignment and domain information
>gnl|CDD|213322 cd12114, A_NRPS_TlmIV_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Streptoalloteichus tallysomycin biosynthesis genes Back     alignment and domain information
>gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|213299 cd05933, ACSBG_like, Bubblegum-like very long-chain fatty acid CoA synthetase (VL-FACS) Back     alignment and domain information
>gnl|CDD|215217 PLN02387, PLN02387, long-chain-fatty-acid-CoA ligase family protein Back     alignment and domain information
>gnl|CDD|235624 PRK05850, PRK05850, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|213304 cd05938, hsFATP2a_ACSVL_like, Fatty acid transport proteins (FATP) including hsFATP2, hsFATP5, and hsFATP6, and similar proteins Back     alignment and domain information
>gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|213316 cd05969, MACS_like_4, Uncharacterized subfamily of Acetyl-CoA synthetase like family (ACS) Back     alignment and domain information
>gnl|CDD|178049 PLN02430, PLN02430, long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>gnl|CDD|178337 PLN02736, PLN02736, long-chain acyl-CoA synthetase Back     alignment and domain information
>gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated Back     alignment and domain information
>gnl|CDD|236019 PRK07445, PRK07445, O-succinylbenzoic acid--CoA ligase; Reviewed Back     alignment and domain information
>gnl|CDD|213283 cd05915, ttLC_FACS_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles Back     alignment and domain information
>gnl|CDD|213273 cd05905, Dip2, Disco-interacting protein 2 (Dip2) Back     alignment and domain information
>gnl|CDD|213324 cd12116, A_NRPS_Ta1_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including salinosporamide A polyketide synthase Back     alignment and domain information
>gnl|CDD|236217 PRK08279, PRK08279, long-chain-acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|240316 PTZ00216, PTZ00216, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|236108 PRK07824, PRK07824, O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|236403 PRK09192, PRK09192, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|236668 PRK10252, entF, enterobactin synthase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|181109 PRK07769, PRK07769, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|236071 PRK07638, PRK07638, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213314 cd05967, PrpE, Propionyl-CoA synthetase (PrpE) Back     alignment and domain information
>gnl|CDD|139531 PRK13383, PRK13383, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|213315 cd05968, AACS_like, Uncharacterized acyl-CoA synthetase subfamily similar to Acetoacetyl-CoA synthetase Back     alignment and domain information
>gnl|CDD|215312 PLN02574, PLN02574, 4-coumarate--CoA ligase-like Back     alignment and domain information
>gnl|CDD|213323 cd12115, A_NRPS_Sfm_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Saframycin A gene cluster from Streptomyces lavendulae Back     alignment and domain information
>gnl|CDD|215217 PLN02387, PLN02387, long-chain-fatty-acid-CoA ligase family protein Back     alignment and domain information
>gnl|CDD|139538 PRK13390, PRK13390, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated Back     alignment and domain information
>gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|233551 TIGR01734, D-ala-DACP-lig, D-alanine--poly(phosphoribitol) ligase, subunit 1 Back     alignment and domain information
>gnl|CDD|240370 PTZ00342, PTZ00342, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|240370 PTZ00342, PTZ00342, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|236803 PRK10946, entE, enterobactin synthase subunit E; Provisional Back     alignment and domain information
>gnl|CDD|180289 PRK05851, PRK05851, long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated Back     alignment and domain information
>gnl|CDD|213305 cd05939, hsFATP4_like, Fatty acid transport proteins (FATP), including FATP4 and FATP1, and similar proteins Back     alignment and domain information
>gnl|CDD|235313 PRK04813, PRK04813, D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|171527 PRK12476, PRK12476, putative fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213313 cd05966, ACS, Acetyl-CoA synthetase (also known as acetate-CoA ligase and acetyl-activating enzyme) Back     alignment and domain information
>gnl|CDD|215137 PLN02246, PLN02246, 4-coumarate--CoA ligase Back     alignment and domain information
>gnl|CDD|236231 PRK08308, PRK08308, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|233770 TIGR02188, Ac_CoA_lig_AcsA, acetate--CoA ligase Back     alignment and domain information
>gnl|CDD|224458 COG1541, PaaK, Coenzyme F390 synthetase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|178049 PLN02430, PLN02430, long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>gnl|CDD|235313 PRK04813, PRK04813, D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|213315 cd05968, AACS_like, Uncharacterized acyl-CoA synthetase subfamily similar to Acetoacetyl-CoA synthetase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 334
KOG1176|consensus537 100.0
KOG1177|consensus596 100.0
COG0365528 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l 100.0
COG0318534 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l 100.0
TIGR02188625 Ac_CoA_lig_AcsA acetate--CoA ligase. This model de 100.0
PLN02654666 acetate-CoA ligase 100.0
PLN02736651 long-chain acyl-CoA synthetase 100.0
PLN02574560 4-coumarate--CoA ligase-like 100.0
PRK00174637 acetyl-CoA synthetase; Provisional 100.0
PRK06334539 long chain fatty acid--[acyl-carrier-protein] liga 100.0
PRK07529632 AMP-binding domain protein; Validated 100.0
PRK04319570 acetyl-CoA synthetase; Provisional 100.0
COG1021542 EntE Peptide arylation enzymes [Secondary metaboli 100.0
PRK07788549 acyl-CoA synthetase; Validated 100.0
PLN02246537 4-coumarate--CoA ligase 100.0
PRK13295547 cyclohexanecarboxylate-CoA ligase; Reviewed 100.0
PTZ00342 746 acyl-CoA synthetase; Provisional 100.0
KOG1256|consensus691 100.0
PLN02860563 o-succinylbenzoate-CoA ligase 100.0
PTZ00237647 acetyl-CoA synthetase; Provisional 100.0
TIGR02316628 propion_prpE propionate--CoA ligase. This family c 100.0
COG1022613 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) 100.0
PRK07656513 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK07786542 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK08043718 bifunctional acyl-[acyl carrier protein] synthetas 100.0
PRK08314546 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK08316523 acyl-CoA synthetase; Validated 100.0
TIGR02275527 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase. Prot 100.0
PRK06087547 short chain acyl-CoA synthetase; Reviewed 100.0
PRK05677562 long-chain-fatty-acid--CoA ligase; Validated 100.0
TIGR03208538 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase. 100.0
PRK03584655 acetoacetyl-CoA synthetase; Provisional 100.0
PLN02861660 long-chain-fatty-acid-CoA ligase 100.0
PRK06839496 acyl-CoA synthetase; Validated 100.0
PRK05620576 long-chain-fatty-acid--CoA ligase; Validated 100.0
TIGR01217652 ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym 100.0
PRK10946536 entE enterobactin synthase subunit E; Provisional 100.0
PRK06145497 acyl-CoA synthetase; Validated 100.0
PRK06187521 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK10524629 prpE propionyl-CoA synthetase; Provisional 100.0
PRK13382537 acyl-CoA synthetase; Provisional 100.0
PLN02387696 long-chain-fatty-acid-CoA ligase family protein 100.0
PRK06060 705 acyl-CoA synthetase; Validated 100.0
KOG1180|consensus678 100.0
PRK08279600 long-chain-acyl-CoA synthetase; Validated 100.0
PRK09274552 peptide synthase; Provisional 100.0
PRK07638487 acyl-CoA synthetase; Validated 100.0
PRK07470528 acyl-CoA synthetase; Validated 100.0
PLN02330546 4-coumarate--CoA ligase-like 1 100.0
PLN03051499 acyl-activating enzyme; Provisional 100.0
PLN02614666 long-chain acyl-CoA synthetase 100.0
PRK07008539 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK09088488 acyl-CoA synthetase; Validated 100.0
PRK086331146 2-acyl-glycerophospho-ethanolamine acyltransferase 100.0
TIGR02262508 benz_CoA_lig benzoate-CoA ligase family. Character 100.0
PLN03102579 acyl-activating enzyme; Provisional 100.0
PRK068141140 acylglycerophosphoethanolamine acyltransferase; Pr 100.0
PRK05605573 long-chain-fatty-acid--CoA ligase; Validated 100.0
TIGR03098515 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor 100.0
PRK07787471 acyl-CoA synthetase; Validated 100.0
PRK06155542 crotonobetaine/carnitine-CoA ligase; Provisional 100.0
PRK07514504 malonyl-CoA synthase; Validated 100.0
PRK03640483 O-succinylbenzoic acid--CoA ligase; Provisional 100.0
PRK05857540 acyl-CoA synthetase; Validated 100.0
PRK08008517 caiC putative crotonobetaine/carnitine-CoA ligase; 100.0
PRK13388540 acyl-CoA synthetase; Provisional 100.0
PRK06188524 acyl-CoA synthetase; Validated 100.0
PRK05852534 acyl-CoA synthetase; Validated 100.0
PRK05851525 long-chain-fatty-acid--[acyl-carrier-protein] liga 100.0
PRK08315559 AMP-binding domain protein; Validated 100.0
KOG1175|consensus626 100.0
PRK06018542 putative acyl-CoA synthetase; Provisional 100.0
PRK12492562 long-chain-fatty-acid--CoA ligase; Provisional 100.0
PRK12583558 acyl-CoA synthetase; Provisional 100.0
PRK07445452 O-succinylbenzoic acid--CoA ligase; Reviewed 100.0
PRK06710563 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK12476612 putative fatty-acid--CoA ligase; Provisional 100.0
PRK07867529 acyl-CoA synthetase; Validated 100.0
PRK07769631 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK12467 3956 peptide synthase; Provisional 100.0
PRK07059557 Long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK08180614 feruloyl-CoA synthase; Reviewed 100.0
PRK08751560 putative long-chain fatty acyl CoA ligase; Provisi 100.0
PLN03052728 acetate--CoA ligase; Provisional 100.0
PLN02430660 long-chain-fatty-acid-CoA ligase 100.0
PRK07824358 O-succinylbenzoic acid--CoA ligase; Provisional 100.0
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 100.0
PTZ00216700 acyl-CoA synthetase; Provisional 100.0
PRK07798533 acyl-CoA synthetase; Validated 100.0
PRK06178567 acyl-CoA synthetase; Validated 100.0
TIGR03205541 pimA dicarboxylate--CoA ligase PimA. PimA, a membe 100.0
TIGR01734502 D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig 100.0
PRK08276502 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK12316 5163 peptide synthase; Provisional 100.0
PRK13391511 acyl-CoA synthetase; Provisional 100.0
PRK12316 5163 peptide synthase; Provisional 100.0
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 100.0
PRK06164540 acyl-CoA synthetase; Validated 100.0
PRK12467 3956 peptide synthase; Provisional 100.0
PLN02479567 acetate-CoA ligase 100.0
PRK04813503 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
PRK05691 4334 peptide synthase; Validated 100.0
PRK08308414 acyl-CoA synthetase; Validated 100.0
TIGR01923436 menE O-succinylbenzoate-CoA ligase. This model rep 100.0
PRK12406509 long-chain-fatty-acid--CoA ligase; Provisional 100.0
PRK05691 4334 peptide synthase; Validated 100.0
PRK09029458 O-succinylbenzoic acid--CoA ligase; Provisional 100.0
PRK12582624 acyl-CoA synthetase; Provisional 100.0
PRK08162545 acyl-CoA synthetase; Validated 100.0
PRK13390501 acyl-CoA synthetase; Provisional 100.0
PRK08974560 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK13383516 acyl-CoA synthetase; Provisional 100.0
PRK09192579 acyl-CoA synthetase; Validated 100.0
PRK05850578 acyl-CoA synthetase; Validated 100.0
PRK07868994 acyl-CoA synthetase; Validated 100.0
PRK07768545 long-chain-fatty-acid--CoA ligase; Validated 100.0
PF00501417 AMP-binding: AMP-binding enzyme; InterPro: IPR0008 100.0
TIGR02372386 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv 100.0
KOG1179|consensus649 100.0
TIGR01733408 AA-adenyl-dom amino acid adenylation domain. This 100.0
TIGR02155422 PA_CoA_ligase phenylacetate-CoA ligase. Phenylacet 100.0
TIGR03335445 F390_ftsA coenzyme F390 synthetase. This enzyme, c 99.94
COG1020642 EntF Non-ribosomal peptide synthetase modules and 99.93
PTZ00297 1452 pantothenate kinase; Provisional 99.92
COG1541438 PaaK Coenzyme F390 synthetase [Coenzyme metabolism 99.9
KOG1178|consensus 1032 99.82
TIGR02304430 aden_form_hyp probable adenylate-forming enzyme. M 99.75
PRK09188365 serine/threonine protein kinase; Provisional 99.4
TIGR03089227 conserved hypothetical protein TIGR03089. This pro 99.25
PF04443365 LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR 98.99
KOG3628|consensus1363 98.67
PF03321528 GH3: GH3 auxin-responsive promoter; InterPro: IPR0 98.0
KOG3628|consensus 1363 97.68
PLN02249 597 indole-3-acetic acid-amido synthetase 97.59
PLN02247 606 indole-3-acetic acid-amido synthetase 97.21
PLN02620 612 indole-3-acetic acid-amido synthetase 96.72
PF1319373 AMP-binding_C: AMP-binding enzyme C-terminal domai 89.54
cd02070201 corrinoid_protein_B12-BD B12 binding domain of cor 80.54
>KOG1176|consensus Back     alignment and domain information
Probab=100.00  E-value=1.8e-57  Score=414.57  Aligned_cols=317  Identities=40%  Similarity=0.653  Sum_probs=262.4

Q ss_pred             CCcchhhHHHHHHhhhCCCCceEEEEcCCCCC-----CCCccc-hhhhhcCCCCCCCCCCCCCCCEEEEecCCCCCCCch
Q psy12107          2 CNIPQLLEVGTKIGATLPNFRGTIVVGGEHDK-----SKNIFG-FKQLVTSQPPDFQLPKISPNDLAMLPYSSGTTGVPK   75 (334)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~ii~~~~~~~~-----~~~~~~-~~~ll~~~~~~~~~~~~~~~~~a~i~~TSGTTG~PK   75 (334)
                      +.|.+..+++.++...++  ..|+++......     ...... |.+++....+.. ...++.+|++.++|||||||.||
T Consensus       124 f~d~~~~~~i~~~~~~~~--~~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~dd~~~il~SSGTTg~PK  200 (537)
T KOG1176|consen  124 FVDEDFYDKISEATSKLA--LKIIVLTGDEGVISISDLVEDLDAFEDLMPEGLPDG-IRPVSEDDTAAILYSSGTTGLPK  200 (537)
T ss_pred             EEcCchHHHHHHHHhhcC--CceEEEecccCccccccccccccchhhccccCCCcc-cccCCCCCeEEEecCCCCCCCCc
Confidence            456778888888887776  445555433110     011122 555553222222 35677899999999999999999


Q ss_pred             hhhhcchHHHHHhhhhccCccccCCCCCCCCCceEEEecchhhhhHHHHHHHHHHHhCcEEEEcCCCCHHHHHHHHHHcC
Q psy12107         76 GVKLSHNNCAVNLEQCVHPDIVNHIPTSDTSQETVLSVLPFFHIYGFNGILNVVMMYGMHMITIPKFTPETYIECVVKYK  155 (334)
Q Consensus        76 ~v~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~p~~~~~~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~i~~~~  155 (334)
                      ||++||+++..+........       .....++.++.+|++|.+|+...+.+.+..|+++++...|+++.+++.|++|+
T Consensus       201 gV~lsHr~~~~~~~~~~~~~-------~~~~~~v~l~~lPl~H~~Gl~~~~~~~~~~~~~ii~~~~f~~~~~~~~i~kyk  273 (537)
T KOG1176|consen  201 GVVLSHRNLIANTLSIKIGW-------ELTSDDVYLCTLPLFHIYGLITLLLSLLAGGTTIICLRKFDAELFLDLIEKYK  273 (537)
T ss_pred             eEEEecHHHHHHHHHhhhcc-------cCCCCceEEEechHHHHhHHHHHHHHHHhCCceEEECCCCCHHHHHHHHHHhC
Confidence            99999999988866554443       14568999999999999999997777888888898888899999999999999


Q ss_pred             CeEEeechHHHHHHhcCCCCCccccccceeeeecCCCCCHHHHHHHHHHhccCCCceeeccCCCCCCCcccccccCCCCc
Q psy12107        156 PTILFVVPSLLLFLASHPAVTPEHLASIREVTCGAAPATKSLIDKFKQKVQREDITIRQGYGMTETSPCTLYTRFAIPEA  235 (334)
Q Consensus       156 ~t~l~~~p~~l~~l~~~~~~~~~~~~~lr~v~~~G~~l~~~~~~~~~~~~~~~~~~i~~~YG~tE~g~~~~~~~~~~~~~  235 (334)
                      +|+++++|.++..|++.+....++++++|.+.+||+++++++.+++++.+|  ...+.+.||+||+++..+.+..... .
T Consensus       274 vt~~~~vP~~~~~l~~~p~~~~~~l~sl~~v~~gga~~~~~~~~~~~~~l~--~~~v~q~YGmTE~~~~~~~~~~~~e-~  350 (537)
T KOG1176|consen  274 VTHLFLVPPVLNMLAKSPIVKKYDLSSLRSVLSGGAPLSPATLEKVKERLP--NVTVIQGYGMTEAGGLITSNDWGPE-R  350 (537)
T ss_pred             EEEEEcChHHHHHHhcCCccCcccCCccEEEEecCCCCCHHHHHHHHHhCC--CceEEEeeccccccCceeecCCCcc-C
Confidence            999999999999999998777899999999999999999999999999998  5689999999999976665554432 3


Q ss_pred             cccCcccc------------------------------ccccccCCccccccccCCCCceecCceEEEecCCcEEEEccC
Q psy12107        236 KLGSTGQL------------------------------VMLGYLKNEEATKETVDSEGWLHTGDVAYYDEDGYFYIVDRT  285 (334)
Q Consensus       236 ~~~~~G~~------------------------------~~~gy~~~~~~~~~~~~~~~~~~TGD~~~~~~dg~~~~~GR~  285 (334)
                      .++++|.+                              ++.||+++|++|++.|+.+|||+|||+|++|+||++++++|+
T Consensus       351 k~~svG~~~~g~~~~v~~e~g~~l~~~~~GEI~vrg~~imkGY~~NpeaT~~~~~~~GW~~TGDiGy~D~DG~l~IvdR~  430 (537)
T KOG1176|consen  351 KPGSVGRLLPGVRVKVLDETGVSLGPNQTGEICVRGPQVMKGYLKNPEATKEAFDDDGWFHTGDLGYFDEDGYLYIVDRS  430 (537)
T ss_pred             cccccCccccceEEEeeCCCCCCCCCCCceEEEEECcccchhhcCChHHHHhhcccCCccccCceEEEcCCCeEEEecch
Confidence            45555543                              789999999999999987799999999999999999999999


Q ss_pred             CceEEEcCEEee---------------------------------------------------------eeeeccCcEEE
Q psy12107        286 KELIKVKGNQVA---------------------------------------------------------PYKKLAGGVKF  308 (334)
Q Consensus       286 ~d~i~~~G~~i~---------------------------------------------------------~~~~~~~~i~~  308 (334)
                      +|+||.+|++|+                                                         +++.+.. |.|
T Consensus       431 KdlIk~~G~qv~P~EiE~vL~~hP~V~eaaVvgipDe~~Ge~p~A~VV~k~g~~lte~di~~~v~k~l~~y~~~~~-V~F  509 (537)
T KOG1176|consen  431 KDLIKYGGEQVSPAEIEAVLLTHPDVLEAAVVGIPDEVWGETPAAFVVLKKGSTLTEKDIIEYVRKKLPAYKLPGG-VVF  509 (537)
T ss_pred             hhheeeCCEEeCHHHHHHHHHhCCCccEEEEEcccccccCCcceEEEEecCCCcCCHHHHHHHHHhhCChhhccCe-EEE
Confidence            999999999999                                                         4444555 999


Q ss_pred             eecCCCCCCchhhHHHHhhhhcCC
Q psy12107        309 LETIPRNPAGKVLRNELKVFGTNP  332 (334)
Q Consensus       309 v~~lP~t~~GKi~r~~l~~~~~~~  332 (334)
                      +++||+|++|||+|+.||+.+.+.
T Consensus       510 vd~lPKs~~GKi~R~~lr~~~~~~  533 (537)
T KOG1176|consen  510 VDELPKTPNGKILRRKLRDIAKKL  533 (537)
T ss_pred             eccCCCCCcchHHHHHHHHHHHhc
Confidence            999999999999999999998664



>KOG1177|consensus Back     alignment and domain information
>COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] Back     alignment and domain information
>COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase Back     alignment and domain information
>PLN02654 acetate-CoA ligase Back     alignment and domain information
>PLN02736 long-chain acyl-CoA synthetase Back     alignment and domain information
>PLN02574 4-coumarate--CoA ligase-like Back     alignment and domain information
>PRK00174 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK06334 long chain fatty acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>PRK07529 AMP-binding domain protein; Validated Back     alignment and domain information
>PRK04319 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK07788 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02246 4-coumarate--CoA ligase Back     alignment and domain information
>PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed Back     alignment and domain information
>PTZ00342 acyl-CoA synthetase; Provisional Back     alignment and domain information
>KOG1256|consensus Back     alignment and domain information
>PLN02860 o-succinylbenzoate-CoA ligase Back     alignment and domain information
>PTZ00237 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>TIGR02316 propion_prpE propionate--CoA ligase Back     alignment and domain information
>COG1022 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
>PRK07656 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07786 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK08314 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08316 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR02275 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>PRK06087 short chain acyl-CoA synthetase; Reviewed Back     alignment and domain information
>PRK05677 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR03208 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase Back     alignment and domain information
>PRK03584 acetoacetyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN02861 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>PRK06839 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05620 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase Back     alignment and domain information
>PRK10946 entE enterobactin synthase subunit E; Provisional Back     alignment and domain information
>PRK06145 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06187 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK10524 prpE propionyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK13382 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN02387 long-chain-fatty-acid-CoA ligase family protein Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>KOG1180|consensus Back     alignment and domain information
>PRK08279 long-chain-acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK09274 peptide synthase; Provisional Back     alignment and domain information
>PRK07638 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07470 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02330 4-coumarate--CoA ligase-like 1 Back     alignment and domain information
>PLN03051 acyl-activating enzyme; Provisional Back     alignment and domain information
>PLN02614 long-chain acyl-CoA synthetase Back     alignment and domain information
>PRK07008 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK09088 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR02262 benz_CoA_lig benzoate-CoA ligase family Back     alignment and domain information
>PLN03102 acyl-activating enzyme; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK05605 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated Back     alignment and domain information
>PRK07787 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional Back     alignment and domain information
>PRK07514 malonyl-CoA synthase; Validated Back     alignment and domain information
>PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK05857 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08008 caiC putative crotonobetaine/carnitine-CoA ligase; Validated Back     alignment and domain information
>PRK13388 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK06188 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05852 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05851 long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>PRK08315 AMP-binding domain protein; Validated Back     alignment and domain information
>KOG1175|consensus Back     alignment and domain information
>PRK06018 putative acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK12492 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK12583 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed Back     alignment and domain information
>PRK06710 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK12476 putative fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK07867 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07769 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK07059 Long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08180 feruloyl-CoA synthase; Reviewed Back     alignment and domain information
>PRK08751 putative long-chain fatty acyl CoA ligase; Provisional Back     alignment and domain information
>PLN03052 acetate--CoA ligase; Provisional Back     alignment and domain information
>PLN02430 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PTZ00216 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK07798 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06178 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR03205 pimA dicarboxylate--CoA ligase PimA Back     alignment and domain information
>TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1 Back     alignment and domain information
>PRK08276 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK13391 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PRK06164 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PLN02479 acetate-CoA ligase Back     alignment and domain information
>PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK08308 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR01923 menE O-succinylbenzoate-CoA ligase Back     alignment and domain information
>PRK12406 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK09029 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK12582 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08162 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK13390 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08974 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK13383 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK09192 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05850 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07768 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PF00501 AMP-binding: AMP-binding enzyme; InterPro: IPR000873 A number of prokaryotic and eukaryotic enzymes, which appear to act via an ATP-dependent covalent binding of AMP to their substrate, share a region of sequence similarity [, , ] Back     alignment and domain information
>TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family Back     alignment and domain information
>KOG1179|consensus Back     alignment and domain information
>TIGR01733 AA-adenyl-dom amino acid adenylation domain Back     alignment and domain information
>TIGR02155 PA_CoA_ligase phenylacetate-CoA ligase Back     alignment and domain information
>TIGR03335 F390_ftsA coenzyme F390 synthetase Back     alignment and domain information
>COG1020 EntF Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PTZ00297 pantothenate kinase; Provisional Back     alignment and domain information
>COG1541 PaaK Coenzyme F390 synthetase [Coenzyme metabolism] Back     alignment and domain information
>KOG1178|consensus Back     alignment and domain information
>TIGR02304 aden_form_hyp probable adenylate-forming enzyme Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>TIGR03089 conserved hypothetical protein TIGR03089 Back     alignment and domain information
>PF04443 LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR007534 LuxE is an acyl-protein synthetase found in bioluminescent bacteria Back     alignment and domain information
>KOG3628|consensus Back     alignment and domain information
>PF03321 GH3: GH3 auxin-responsive promoter; InterPro: IPR004993 Transcription of the gene family, GH3, has been shown to be specifically induced by the plant hormone auxin Back     alignment and domain information
>KOG3628|consensus Back     alignment and domain information
>PLN02249 indole-3-acetic acid-amido synthetase Back     alignment and domain information
>PLN02247 indole-3-acetic acid-amido synthetase Back     alignment and domain information
>PLN02620 indole-3-acetic acid-amido synthetase Back     alignment and domain information
>PF13193 AMP-binding_C: AMP-binding enzyme C-terminal domain; PDB: 3L8C_B 2VSQ_A 3R44_A 3RG2_B 3A9U_A 3A9V_A 3NI2_A 1V26_B 1ULT_B 1V25_B Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query334
3a9u_A536 Crystal Structures And Enzymatic Mechanisms Of A Po 4e-39
3qya_A582 Crystal Structure Of A Red-Emitter Mutant Of Lampyr 5e-38
4g37_A555 Structure Of Cross-Linked Firefly Luciferase In Sec 7e-38
3tsy_A 979 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Pr 2e-37
2d1q_A548 Crystal Structure Of The Thermostable Japanese Fire 3e-37
2d1s_A548 Crystal Structure Of The Thermostable Japanese Fire 3e-37
3iep_A551 Firefly Luciferase Apo Structure (P41 Form) Length 1e-36
1ba3_A550 Firefly Luciferase In Complex With Bromoform Length 1e-36
2d1t_A548 Crystal Structure Of The Thermostable Japanese Fire 1e-36
4g36_A555 Photinus Pyralis Luciferase In The Adenylate-Formin 1e-36
1ult_A541 Crystal Structure Of Tt0168 From Thermus Thermophil 4e-25
3g7s_A549 Crystal Structure Of A Long-Chain-Fatty-Acid-Coa Li 2e-21
3r44_A517 Mycobacterium Tuberculosis Fatty Acyl Coa Synthetas 7e-20
4fuq_A503 Crystal Structure Of Apo Matb From Rhodopseudomonas 1e-19
4gxr_A503 Structure Of Atp Bound Rpmatb-Bxbclm Chimera B3 Len 2e-18
4gxq_A506 Crystal Structure Of Atp Bound Rpmatb-Bxbclm Chimer 2e-18
4fut_A503 Crystal Structure Of Atp Bound Matb From Rhodopseud 2e-18
3t5b_A396 Crystal Structure Of N-Terminal Domain Of Facl13 Fr 1e-16
3ivr_A509 Crystal Structure Of Putative Long-Chain-Fatty-Acid 1e-16
1mdb_A539 Crystal Structure Of Dhbe In Complex With Dhb-adeny 3e-15
1md9_A539 Crystal Structure Of Dhbe In Complex With Dhb And A 5e-14
3ipl_A501 Crystal Structure Of O-Succinylbenzoic Acid-Coa Lig 1e-13
3cw8_X504 4-chlorobenzoyl-coa Ligase/synthetase, Bound To 4cb 1e-12
2qvx_X504 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, I303G MUTATIO 2e-12
1t5d_X504 4-Chlorobenzoyl-Coa LigaseSYNTHETASE BOUND TO 4-Chl 4e-12
3dlp_X504 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, MUTANT D402P, 6e-12
3pbk_A583 Structural And Functional Studies Of Fatty Acyl-Ade 1e-11
2qvz_X504 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, I303A MUTATIO 1e-11
1t5h_X504 4-Chlorobenzoyl-Coa LigaseSYNTHETASE UNLIGANDED, SE 1e-11
2v7b_A529 Crystal Structures Of A Benzoate Coa Ligase From Bu 5e-11
3etc_A580 2.1 A Structure Of Acyl-Adenylate Synthetase From M 5e-11
3nyq_A505 Malonyl-Coa Ligase Ternary Product Complex With Met 2e-10
1amu_A563 Phenylalanine Activating Domain Of Gramicidin Synth 4e-07
3vnq_A544 Co-crystal Structure Of Nrps Adenylation Protein Cy 6e-07
3kxw_A 590 The Crystal Structure Of Fatty Acid Amp Ligase From 6e-07
3o82_A544 Structure Of Base N-Terminal Domain From Acinetobac 8e-07
1ry2_A663 Crystal Structure Of Yeast Acetyl-Coenzyme A Synthe 4e-06
2p2b_A652 Acetyl-coa Synthetase, V386a Mutation Length = 652 8e-06
1pg3_A652 Acetyl Coa Synthetase, Acetylated On Lys609 Length 2e-05
2p2q_A652 Acetyl-Coa Synthetase, R584e Mutation Length = 652 2e-05
2p2f_A652 Acetyl-coa Synthetase, Wild-type With Acetate, Amp, 2e-05
2p2j_A652 Acetyl-Coa Synthetase, K609a Mutation Length = 652 2e-05
2p2m_A652 Acetyl-Coa Synthetase, R194a Mutation Length = 652 2e-05
2p20_A652 Acetyl-Coa Synthetase, R584a Mutation Length = 652 2e-05
3rg2_A 617 Structure Of A Two-Domain Nrps Fusion Protein Conta 5e-05
2wd9_A569 Crystal Structure Of Human Acyl-coa Synthetase Medi 1e-04
3b7w_A570 Crystal Structure Of Human Acyl-Coa Synthetase Medi 1e-04
4gr5_A570 Crystal Structure Of Slgn1deltaasub In Complex With 2e-04
3e53_A480 Crystal Structure Of N-Terminal Domain Of A Fatty A 5e-04
3t5a_A480 Crystal Structure Of N-Terminal Domain Of Faal28 G3 7e-04
>pdb|3A9U|A Chain A, Crystal Structures And Enzymatic Mechanisms Of A Populus Tomentosa 4- Coumarate--Coa Ligase Length = 536 Back     alignment and structure

Iteration: 1

Score = 158 bits (399), Expect = 4e-39, Method: Compositional matrix adjust. Identities = 107/296 (36%), Positives = 151/296 (51%), Gaps = 45/296 (15%) Query: 40 FKQLVTSQPPDFQLPKISPNDLAMLPYSSGTTGVPKGVKLSHNNCAVNLEQCV---HPDI 96 F +L + + ISP+D+ LPYSSGTTG+PKGV L+H ++ Q V +P++ Sbjct: 159 FSELTQADENEAPQVDISPDDVVALPYSSGTTGLPKGVMLTHKGLITSVAQQVDGDNPNL 218 Query: 97 VNHIPTSDTSQETVLSVLPFFHIYGFNGILNVVMMYGMHMITIPKFTPETYIECVVKYKP 156 H S++ +L VLP FHIY N I+ + G ++ +PKF + + + KYK Sbjct: 219 YFH------SEDVILCVLPMFHIYALNSIMLCGLRVGAPILIMPKFEIGSLLGLIEKYKV 272 Query: 157 TILFVVPSLLLFLASHPAVTPEHLASIREVTCGAAPATKSLIDKFKQKVQREDITIRQGY 216 +I VVP +++ +A P + L+S+R + G AP K L D + K + + QGY Sbjct: 273 SIAPVVPPVMMSIAKSPDLDKHDLSSLRMIKSGGAPLGKELEDTVRAKFPQA--RLGQGY 330 Query: 217 GMTETSP----CTLYTR--FAIPEAKLGST----------------------------GQ 242 GMTE P C + + F I G+ G Sbjct: 331 GMTEAGPVLAMCLAFAKEPFDIKPGACGTVVRNAEMKIVDPETGASLPRNQPGEICIRGD 390 Query: 243 LVMLGYLKNEEATKETVDSEGWLHTGDVAYYDEDGYFYIVDRTKELIKVKGNQVAP 298 +M GYL + EAT T+D EGWLHTGD+ Y D+D +IVDR KELIK KG QVAP Sbjct: 391 QIMKGYLNDPEATSRTIDKEGWLHTGDIGYIDDDDELFIVDRLKELIKYKGFQVAP 446
>pdb|3QYA|A Chain A, Crystal Structure Of A Red-Emitter Mutant Of Lampyris Turkestanicus Luciferase Length = 582 Back     alignment and structure
>pdb|4G37|A Chain A, Structure Of Cross-Linked Firefly Luciferase In Second Catalytic Conformation Length = 555 Back     alignment and structure
>pdb|3TSY|A Chain A, 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Protein Length = 979 Back     alignment and structure
>pdb|2D1Q|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Complexed With Mgatp Length = 548 Back     alignment and structure
>pdb|2D1S|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Complexed With High-Energy Intermediate Analogue Length = 548 Back     alignment and structure
>pdb|3IEP|A Chain A, Firefly Luciferase Apo Structure (P41 Form) Length = 551 Back     alignment and structure
>pdb|1BA3|A Chain A, Firefly Luciferase In Complex With Bromoform Length = 550 Back     alignment and structure
>pdb|2D1T|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Red-Color Emission S286n Mutant Complexed With High-Energy Intermediate Analogue Length = 548 Back     alignment and structure
>pdb|4G36|A Chain A, Photinus Pyralis Luciferase In The Adenylate-Forming Conformation Bound To Dlsa Length = 555 Back     alignment and structure
>pdb|1ULT|A Chain A, Crystal Structure Of Tt0168 From Thermus Thermophilus Hb8 Length = 541 Back     alignment and structure
>pdb|3G7S|A Chain A, Crystal Structure Of A Long-Chain-Fatty-Acid-Coa Ligase (Fadd1) From Archaeoglobus Fulgidus Length = 549 Back     alignment and structure
>pdb|3R44|A Chain A, Mycobacterium Tuberculosis Fatty Acyl Coa Synthetase Length = 517 Back     alignment and structure
>pdb|4FUQ|A Chain A, Crystal Structure Of Apo Matb From Rhodopseudomonas Palustris Length = 503 Back     alignment and structure
>pdb|4GXR|A Chain A, Structure Of Atp Bound Rpmatb-Bxbclm Chimera B3 Length = 503 Back     alignment and structure
>pdb|4GXQ|A Chain A, Crystal Structure Of Atp Bound Rpmatb-Bxbclm Chimera B1 Length = 506 Back     alignment and structure
>pdb|4FUT|A Chain A, Crystal Structure Of Atp Bound Matb From Rhodopseudomonas Palustris Length = 503 Back     alignment and structure
>pdb|3T5B|A Chain A, Crystal Structure Of N-Terminal Domain Of Facl13 From Mycobacterium Tuberculosis Length = 396 Back     alignment and structure
>pdb|3IVR|A Chain A, Crystal Structure Of Putative Long-Chain-Fatty-Acid Coa Ligase From Rhodopseudomonas Palustris Cga009 Length = 509 Back     alignment and structure
>pdb|1MDB|A Chain A, Crystal Structure Of Dhbe In Complex With Dhb-adenylate Length = 539 Back     alignment and structure
>pdb|1MD9|A Chain A, Crystal Structure Of Dhbe In Complex With Dhb And Amp Length = 539 Back     alignment and structure
>pdb|3IPL|A Chain A, Crystal Structure Of O-Succinylbenzoic Acid-Coa Ligase From Staphylococcus Aureus Subsp. Aureus Mu50 Length = 501 Back     alignment and structure
>pdb|3CW8|X Chain X, 4-chlorobenzoyl-coa Ligase/synthetase, Bound To 4cba-adenylate Length = 504 Back     alignment and structure
>pdb|2QVX|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, I303G MUTATION, BOUND TO 3- Chlorobenzoate Length = 504 Back     alignment and structure
>pdb|1T5D|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE BOUND TO 4-Chlorobenzoate Length = 504 Back     alignment and structure
>pdb|3DLP|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, MUTANT D402P, BOUND To 4cb Length = 504 Back     alignment and structure
>pdb|3PBK|A Chain A, Structural And Functional Studies Of Fatty Acyl-Adenylate Ligases From E. Coli And L. Pneumophila Length = 583 Back     alignment and structure
>pdb|2QVZ|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE, I303A MUTATION, BOUND TO 3- Chlorobenzoate Length = 504 Back     alignment and structure
>pdb|1T5H|X Chain X, 4-Chlorobenzoyl-Coa LigaseSYNTHETASE UNLIGANDED, SELENOMETHIONINE Length = 504 Back     alignment and structure
>pdb|2V7B|A Chain A, Crystal Structures Of A Benzoate Coa Ligase From Burkholderia Xenovorans Lb400 Length = 529 Back     alignment and structure
>pdb|3ETC|A Chain A, 2.1 A Structure Of Acyl-Adenylate Synthetase From Methanosarcina Acetivorans Containing A Link Between Lys256 And Cys298 Length = 580 Back     alignment and structure
>pdb|3NYQ|A Chain A, Malonyl-Coa Ligase Ternary Product Complex With Methylmalonyl-Coa And Amp Bound Length = 505 Back     alignment and structure
>pdb|1AMU|A Chain A, Phenylalanine Activating Domain Of Gramicidin Synthetase 1 In A Complex With Amp And Phenylalanine Length = 563 Back     alignment and structure
>pdb|3VNQ|A Chain A, Co-crystal Structure Of Nrps Adenylation Protein Cytc1 With Atp From Streptomyces Length = 544 Back     alignment and structure
>pdb|3KXW|A Chain A, The Crystal Structure Of Fatty Acid Amp Ligase From Legionella Pneumophila Length = 590 Back     alignment and structure
>pdb|3O82|A Chain A, Structure Of Base N-Terminal Domain From Acinetobacter Baumannii Bound To 5'-O-[n-(2,3-Dihydroxybenzoyl)sulfamoyl] Adenosine Length = 544 Back     alignment and structure
>pdb|1RY2|A Chain A, Crystal Structure Of Yeast Acetyl-Coenzyme A Synthetase In Complex With Amp Length = 663 Back     alignment and structure
>pdb|2P2B|A Chain A, Acetyl-coa Synthetase, V386a Mutation Length = 652 Back     alignment and structure
>pdb|1PG3|A Chain A, Acetyl Coa Synthetase, Acetylated On Lys609 Length = 652 Back     alignment and structure
>pdb|2P2Q|A Chain A, Acetyl-Coa Synthetase, R584e Mutation Length = 652 Back     alignment and structure
>pdb|2P2F|A Chain A, Acetyl-coa Synthetase, Wild-type With Acetate, Amp, And Coa Bound Length = 652 Back     alignment and structure
>pdb|2P2J|A Chain A, Acetyl-Coa Synthetase, K609a Mutation Length = 652 Back     alignment and structure
>pdb|2P2M|A Chain A, Acetyl-Coa Synthetase, R194a Mutation Length = 652 Back     alignment and structure
>pdb|2P20|A Chain A, Acetyl-Coa Synthetase, R584a Mutation Length = 652 Back     alignment and structure
>pdb|3RG2|A Chain A, Structure Of A Two-Domain Nrps Fusion Protein Containing The Ente Adenylation Domain And Entb Aryl-Carrier Protein From Enterobactin Biosynthesis Length = 617 Back     alignment and structure
>pdb|2WD9|A Chain A, Crystal Structure Of Human Acyl-coa Synthetase Medium-chain Family Member 2a (l64p Mutation) In Complex With Ibuprofen Length = 569 Back     alignment and structure
>pdb|3B7W|A Chain A, Crystal Structure Of Human Acyl-Coa Synthetase Medium-Chain Family Member 2a, With L64p Mutation Length = 570 Back     alignment and structure
>pdb|4GR5|A Chain A, Crystal Structure Of Slgn1deltaasub In Complex With Ampcpp Length = 570 Back     alignment and structure
>pdb|3E53|A Chain A, Crystal Structure Of N-Terminal Domain Of A Fatty Acyl Amp Ligase Faal28 From Mycobacterium Tuberculosis Length = 480 Back     alignment and structure
>pdb|3T5A|A Chain A, Crystal Structure Of N-Terminal Domain Of Faal28 G330w Mutant From Mycobacterium Tuberculosis Length = 480 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query334
3ni2_A536 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy 1e-119
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 1e-115
2d1s_A548 Luciferase, luciferin 4-monooxygenase; alpha/beta, 1e-112
3rix_A550 Luciferase, luciferin 4-monooxygenase; oxidoreduct 1e-112
3g7s_A549 Long-chain-fatty-acid--COA ligase (FADD-1); protei 2e-99
3g7s_A549 Long-chain-fatty-acid--COA ligase (FADD-1); protei 6e-06
3ipl_A501 2-succinylbenzoate--COA ligase; structural genomic 6e-84
4fuq_A503 Malonyl COA synthetase; ANL superfamily, methylma 7e-82
3r44_A517 Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s 8e-82
2v7b_A529 Benzoate-coenzyme A ligase; benzoate oxidation, be 5e-76
3ivr_A509 Putative long-chain-fatty-acid COA ligase; structu 3e-75
3nyq_A505 Malonyl-COA ligase; A/B topology ababa sandwich be 2e-72
1t5h_X504 4-chlorobenzoyl COA ligase; adenylate-forming coen 6e-72
1mdb_A539 2,3-dihydroxybenzoate-AMP ligase; adenylation doma 6e-68
3rg2_A 617 Enterobactin synthase component E (ENTE), 2,3-DIH 8e-67
3o83_A544 Peptide arylation enzyme; ligase, adenylation of 2 8e-67
1v25_A541 Long-chain-fatty-acid-COA synthetase; ligase, stru 2e-51
3c5e_A570 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; 5e-38
3kxw_A590 Saframycin MX1 synthetase B; fatty acid AMP ligase 5e-32
3t5a_A480 Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C 2e-31
3etc_A580 AMP-binding protein; adenylate-forming acyl-COA sy 2e-30
3gqw_A576 Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen 5e-30
3hgu_A369 EHPF; phenazine, antibiotic, biosynthetic protein; 2e-18
3l8c_A521 D-alanine--poly(phosphoribitol) ligase subunit 1; 4e-17
3ite_A562 SIDN siderophore synthetase; ligase, non-ribosomal 3e-15
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 9e-15
4dg8_A 620 PA1221; ANL superfamily, adenylation domain, pepti 2e-14
3fce_A512 D-alanine--poly(phosphoribitol) ligase subunit 1; 4e-14
3e7w_A511 D-alanine--poly(phosphoribitol) ligase subunit 1; 5e-14
1amu_A 563 GRSA, gramicidin synthetase 1; peptide synthetase, 3e-13
3qov_A436 Phenylacetate-coenzyme A ligase; acetyl-COA synthe 2e-05
2y27_A437 Phenylacetate-coenzyme A ligase; phenylacetic acid 7e-05
2y4o_A443 Phenylacetate-coenzyme A ligase; phenylacetic acid 1e-04
>3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Length = 536 Back     alignment and structure
 Score =  352 bits (905), Expect = e-119
 Identities = 110/329 (33%), Positives = 153/329 (46%), Gaps = 44/329 (13%)

Query: 4   IPQLLEVGTKIGATLPNFRGTIVVGGEHDKSKNIFGFKQLVTSQPPDFQLPKISPNDLAM 63
                E      A   + +  + V    D   +   F +L  +   +     ISP+D+  
Sbjct: 128 QACYYEKVKDF-ARESDVK-VMCVDSAPDGCLH---FSELTQADENEAPQVDISPDDVVA 182

Query: 64  LPYSSGTTGVPKGVKLSHNNCAVNLEQCVHPDIVNHIPTSDTSQETVLSVLPFFHIYGFN 123
           LPYSSGTTG+PKGV L+H     ++ Q V  D  N    S+   + +L VLP FHIY  N
Sbjct: 183 LPYSSGTTGLPKGVMLTHKGLITSVAQQVDGDNPNLYFHSE---DVILCVLPMFHIYALN 239

Query: 124 GILNVVMMYGMHMITIPKFTPETYIECVVKYKPTILFVVPSLLLFLASHPAVTPEHLASI 183
            I+   +  G  ++ +PKF   + +  + KYK +I  VVP +++ +A  P +    L+S+
Sbjct: 240 SIMLCGLRVGAPILIMPKFEIGSLLGLIEKYKVSIAPVVPPVMMSIAKSPDLDKHDLSSL 299

Query: 184 REVTCGAAPATKSLIDKFKQKVQREDITIRQGYGMTETSPCTLYTRFAIPE---AKLGST 240
           R +  G AP  K L D  + K       + QGYGMTE  P          E    K G+ 
Sbjct: 300 RMIKSGGAPLGKELEDTVRAKFP--QARLGQGYGMTEAGPVLAMCLAFAKEPFDIKPGAC 357

Query: 241 GQL-------------------------------VMLGYLKNEEATKETVDSEGWLHTGD 269
           G +                               +M GYL + EAT  T+D EGWLHTGD
Sbjct: 358 GTVVRNAEMKIVDPETGASLPRNQPGEICIRGDQIMKGYLNDPEATSRTIDKEGWLHTGD 417

Query: 270 VAYYDEDGYFYIVDRTKELIKVKGNQVAP 298
           + Y D+D   +IVDR KELIK KG QVAP
Sbjct: 418 IGYIDDDDELFIVDRLKELIKYKGFQVAP 446


>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Length = 979 Back     alignment and structure
>2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Length = 548 Back     alignment and structure
>3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} PDB: 1ba3_A 1lci_A* 3ies_A* 3iep_A* 3ier_A* 3qya_A Length = 550 Back     alignment and structure
>3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Length = 549 Back     alignment and structure
>3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Length = 549 Back     alignment and structure
>3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Length = 501 Back     alignment and structure
>4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* Length = 503 Back     alignment and structure
>3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Length = 517 Back     alignment and structure
>2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Length = 529 Back     alignment and structure
>3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} Length = 509 Back     alignment and structure
>3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Length = 505 Back     alignment and structure
>1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Length = 504 Back     alignment and structure
>1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Length = 539 Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Length = 617 Back     alignment and structure
>3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} PDB: 3o82_A* 3o84_A* Length = 544 Back     alignment and structure
>1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Length = 541 Back     alignment and structure
>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Length = 570 Back     alignment and structure
>3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Length = 590 Back     alignment and structure
>3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A Length = 480 Back     alignment and structure
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Length = 580 Back     alignment and structure
>3hgu_A EHPF; phenazine, antibiotic, biosynthetic protein; 1.95A {Pantoea agglomerans} PDB: 3hgv_A 3l2k_A* Length = 369 Back     alignment and structure
>3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Length = 521 Back     alignment and structure
>3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Length = 562 Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Length = 1304 Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Length = 620 Back     alignment and structure
>3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Length = 512 Back     alignment and structure
>3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Length = 511 Back     alignment and structure
>1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Length = 563 Back     alignment and structure
>3qov_A Phenylacetate-coenzyme A ligase; acetyl-COA synthetase-like, structural genomics, joint cente structural genomics, JCSG; HET: MSE ADP COA; 2.20A {Bacteroides thetaiotaomicron} PDB: 3s89_A* Length = 436 Back     alignment and structure
>2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* Length = 437 Back     alignment and structure
>2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} Length = 443 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query334
3ni2_A536 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy 100.0
3rix_A550 Luciferase, luciferin 4-monooxygenase; oxidoreduct 100.0
2d1s_A548 Luciferase, luciferin 4-monooxygenase; alpha/beta, 100.0
4fuq_A503 Malonyl COA synthetase; ANL superfamily, methylma 100.0
3r44_A517 Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s 100.0
3etc_A580 AMP-binding protein; adenylate-forming acyl-COA sy 100.0
1mdb_A539 2,3-dihydroxybenzoate-AMP ligase; adenylation doma 100.0
1pg4_A652 Acetyl-COA synthetase; AMP-forming, adenylate-form 100.0
3o83_A544 Peptide arylation enzyme; ligase, adenylation of 2 100.0
1v25_A541 Long-chain-fatty-acid-COA synthetase; ligase, stru 100.0
3g7s_A549 Long-chain-fatty-acid--COA ligase (FADD-1); protei 100.0
3c5e_A570 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; 100.0
1ry2_A663 Acetyl-coenzyme A synthetase 1, acyl-activating en 100.0
2v7b_A529 Benzoate-coenzyme A ligase; benzoate oxidation, be 100.0
3rg2_A617 Enterobactin synthase component E (ENTE), 2,3-DIH 100.0
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 100.0
1t5h_X504 4-chlorobenzoyl COA ligase; adenylate-forming coen 100.0
3fce_A512 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
3ivr_A509 Putative long-chain-fatty-acid COA ligase; structu 100.0
3nyq_A505 Malonyl-COA ligase; A/B topology ababa sandwich be 100.0
3ipl_A501 2-succinylbenzoate--COA ligase; structural genomic 100.0
4gs5_A358 Acyl-COA synthetase (AMP-forming)/AMP-acid ligase 100.0
3e7w_A511 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
4dg8_A 620 PA1221; ANL superfamily, adenylation domain, pepti 100.0
3l8c_A521 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
4gr5_A570 Non-ribosomal peptide synthetase; MBTH-like domain 100.0
1amu_A563 GRSA, gramicidin synthetase 1; peptide synthetase, 100.0
3kxw_A590 Saframycin MX1 synthetase B; fatty acid AMP ligase 100.0
3gqw_A576 Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen 100.0
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 100.0
3ite_A562 SIDN siderophore synthetase; ligase, non-ribosomal 100.0
3qov_A436 Phenylacetate-coenzyme A ligase; acetyl-COA synthe 100.0
2y27_A437 Phenylacetate-coenzyme A ligase; phenylacetic acid 100.0
2y4o_A443 Phenylacetate-coenzyme A ligase; phenylacetic acid 100.0
3t5a_A480 Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C 100.0
3hgu_A369 EHPF; phenazine, antibiotic, biosynthetic protein; 99.96
4eql_A 581 4-substituted benzoates-glutamate ligase GH3.12; f 98.51
4b2g_A 609 GH3-1 auxin conjugating enzyme; signaling protein, 98.31
4epl_A 581 Jasmonic acid-amido synthetase JAR1; ANL adenylati 98.23
3lax_A109 Phenylacetate-coenzyme A ligase; structural genomi 97.97
3gxs_A109 Phenylacetate-coenzyme A ligase; APC62324.1, struc 97.76
3ezx_A215 MMCP 1, monomethylamine corrinoid protein 1; N ter 83.14
>3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Back     alignment and structure
Probab=100.00  E-value=2.8e-54  Score=405.05  Aligned_cols=317  Identities=37%  Similarity=0.602  Sum_probs=252.9

Q ss_pred             cchhhHHHHHHhhhCCCCceEEEEcCCCCCCCCccchhhhhcCCCCCCCCCCCCCCCEEEEecCCCCCCCchhhhhcchH
Q psy12107          4 IPQLLEVGTKIGATLPNFRGTIVVGGEHDKSKNIFGFKQLVTSQPPDFQLPKISPNDLAMLPYSSGTTGVPKGVKLSHNN   83 (334)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~ii~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~a~i~~TSGTTG~PK~v~~t~~~   83 (334)
                      +..+.+.+.++.... .+ .++.++...   .+...++++........+....+++|+++|+|||||||.||||+++|++
T Consensus       128 ~~~~~~~~~~~~~~~-~~-~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~d~a~i~~TSGTTG~PKgv~~th~~  202 (536)
T 3ni2_A          128 QACYYEKVKDFARES-DV-KVMCVDSAP---DGCLHFSELTQADENEAPQVDISPDDVVALPYSSGTTGLPKGVMLTHKG  202 (536)
T ss_dssp             CGGGTHHHHHHHHHH-TC-EEEESSCCC---TTCEETHHHHTSCGGGCCCCCCCTTSEEECCEECTTSSSCEEEEEEHHH
T ss_pred             ChHHHHHHHHHHhhc-Cc-eEEEecCCC---CCccCHHHHhhccccccccCCCCccCEEEEEcCCCccccchHHHhhHHH
Confidence            344555555554433 22 344444322   2456777777432222233456789999999999999999999999999


Q ss_pred             HHHHhhhhccCccccCCCCCCCCCceEEEecchhhhhHHHHHHHHHHHhCcEEEEcCCCCHHHHHHHHHHcCCeEEeech
Q psy12107         84 CAVNLEQCVHPDIVNHIPTSDTSQETVLSVLPFFHIYGFNGILNVVMMYGMHMITIPKFTPETYIECVVKYKPTILFVVP  163 (334)
Q Consensus        84 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~p~~~~~~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~i~~~~~t~l~~~p  163 (334)
                      +.+............   ......+++++.+|++|.+++...++.++..|+++++.+.+++..+++.|+++++|++.++|
T Consensus       203 l~~~~~~~~~~~~~~---~~~~~~d~~l~~~p~~h~~~~~~~~~~~l~~G~~~v~~~~~~~~~~~~~i~~~~~t~~~~~P  279 (536)
T 3ni2_A          203 LITSVAQQVDGDNPN---LYFHSEDVILCVLPMFHIYALNSIMLCGLRVGAPILIMPKFEIGSLLGLIEKYKVSIAPVVP  279 (536)
T ss_dssp             HHHHHHHHHCSSSCS---SCCCTTCCEEECSCTTSHHHHHHTHHHHHHHTCCEEECSSCCHHHHHHHHHHHTCCEEEECH
T ss_pred             HHHHHHHHHhhcccc---ccCCCCCEEEEecChHHHHHHHHHHHHHHhcCCEEEEcCCCCHHHHHHHHHHhCCeEEEccH
Confidence            988766543322111   12568899999999999999977788899999999999999999999999999999999999


Q ss_pred             HHHHHHhcCCCCCccccccceeeeecCCCCCHHHHHHHHHHhccCCCceeeccCCCCCCCccccccc---C---------
Q psy12107        164 SLLLFLASHPAVTPEHLASIREVTCGAAPATKSLIDKFKQKVQREDITIRQGYGMTETSPCTLYTRF---A---------  231 (334)
Q Consensus       164 ~~l~~l~~~~~~~~~~~~~lr~v~~~G~~l~~~~~~~~~~~~~~~~~~i~~~YG~tE~g~~~~~~~~---~---------  231 (334)
                      +++..|++.......++++||.+++||+++++++.+++++.|+  +++++|.||+||++.+++.+..   .         
T Consensus       280 ~~~~~l~~~~~~~~~~l~~lr~i~~gGe~l~~~~~~~~~~~~~--~~~l~~~YG~TE~~~~~~~~~~~~~~~~~~~~~~~  357 (536)
T 3ni2_A          280 PVMMSIAKSPDLDKHDLSSLRMIKSGGAPLGKELEDTVRAKFP--QARLGQGYGMTEAGPVLAMCLAFAKEPFDIKPGAC  357 (536)
T ss_dssp             HHHHHHHTCSCGGGSCCTTCCEEEEESSCCCHHHHHHHHHHCT--TSEEEEEEECGGGSSEEEECGGGSSSCCCCCTTCC
T ss_pred             HHHHHHHhCcccccCCCccceEEEECCCCCCHHHHHHHHHHCC--CCCccccccccccchhhhcccccCCccccCCCCCe
Confidence            9999999987767778999999999999999999999999996  5689999999999865443210   0         


Q ss_pred             ----------------CCCccccCcccc------ccccccCCccccccccCCCCceecCceEEEecCCcEEEEccCCceE
Q psy12107        232 ----------------IPEAKLGSTGQL------VMLGYLKNEEATKETVDSEGWLHTGDVAYYDEDGYFYIVDRTKELI  289 (334)
Q Consensus       232 ----------------~~~~~~~~~G~~------~~~gy~~~~~~~~~~~~~~~~~~TGD~~~~~~dg~~~~~GR~~d~i  289 (334)
                                      ......+..|++      ++.||+++|+.|.+.|+.+|||+|||+|++++||+++++||.||+|
T Consensus       358 G~~~~~~~~~i~d~~~~~~~~~g~~GEl~v~g~~v~~GY~~~p~~t~~~~~~~g~~~TGDl~~~~~dG~l~~~GR~dd~i  437 (536)
T 3ni2_A          358 GTVVRNAEMKIVDPETGASLPRNQPGEICIRGDQIMKGYLNDPEATSRTIDKEGWLHTGDIGYIDDDDELFIVDRLKELI  437 (536)
T ss_dssp             CEECSSCEEEEECTTTCCBCCTTCCEEEEEESTTSCSEETTCHHHHHHHBCTTSCEEEEEEEEECTTSCEEEEEECSCCE
T ss_pred             eEeCCCcEEEEEeCCCCcCCCCCCccEEEEeCcccchhhcCChhHHHhhccCCCceEcccEEEEcCCceEEEEecccceE
Confidence                            001122334444      7889999999999999889999999999999999999999999999


Q ss_pred             EEcCEEee---------------------------------------------------------eeeeccCcEEEeecC
Q psy12107        290 KVKGNQVA---------------------------------------------------------PYKKLAGGVKFLETI  312 (334)
Q Consensus       290 ~~~G~~i~---------------------------------------------------------~~~~~~~~i~~v~~l  312 (334)
                      |++|++|+                                                         .+++|+. |+++++|
T Consensus       438 k~~G~~v~p~eIE~~l~~~p~V~~a~Vv~~~~~~~g~~~~a~vv~~~~~~~~~~~l~~~l~~~l~~~~~p~~-i~~v~~l  516 (536)
T 3ni2_A          438 KYKGFQVAPAELEALLIAHPEISDAAVVGLKDEDAGEVPVAFVVKSEKSQATEDEIKQYISKQVIFYKRIKR-VFFIEAI  516 (536)
T ss_dssp             EETTEEECHHHHHHHHHTSTTEEEEEEEEEEETTTEEEEEEEEEECTTCCCCHHHHHHHHHTTSCGGGCCSE-EEECSCC
T ss_pred             EECCEEECHHHHHHHHHhCCCcceEEEEeeecCCCCceeEEEEEecCCCCCCHHHHHHHHHHhccCCccccE-EEEEecC
Confidence            99999999                                                         5667777 9999999


Q ss_pred             CCCCCchhhHHHHhhhhcC
Q psy12107        313 PRNPAGKVLRNELKVFGTN  331 (334)
Q Consensus       313 P~t~~GKi~r~~l~~~~~~  331 (334)
                      |+|++|||+|++|++++.+
T Consensus       517 P~t~~GKi~R~~L~~~~~~  535 (536)
T 3ni2_A          517 PKAPSGKILRKNLKEKLAG  535 (536)
T ss_dssp             CBCTTSCBCHHHHHTC---
T ss_pred             CCCCCCCeeHHHHHHHhcc
Confidence            9999999999999998764



>3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} SCOP: e.23.1.1 PDB: 1ba3_A 1lci_A* 4e5d_A* 3ies_A* 3iep_A* 3ier_A* 4g36_A* 4g37_A* 3qya_A Back     alignment and structure
>2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Back     alignment and structure
>4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* 4gxr_A* 4gxq_A* Back     alignment and structure
>3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Back     alignment and structure
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Back     alignment and structure
>1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Back     alignment and structure
>1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* Back     alignment and structure
>3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} SCOP: e.23.1.0 PDB: 3o82_A* 3o84_A* 3u16_A* 3u17_A* Back     alignment and structure
>1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Back     alignment and structure
>3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Back     alignment and structure
>1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 Back     alignment and structure
>2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Back     alignment and structure
>3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Back     alignment and structure
>3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} SCOP: e.23.1.0 Back     alignment and structure
>3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Back     alignment and structure
>3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>4gs5_A Acyl-COA synthetase (AMP-forming)/AMP-acid ligase protein; structural genomics, PSI-biology; 2.02A {Dyadobacter fermentans} Back     alignment and structure
>3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Back     alignment and structure
>3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Back     alignment and structure
>4gr5_A Non-ribosomal peptide synthetase; MBTH-like domain, adenylation domain, ligase, rossmann fold, binding; HET: APC TLA; 1.92A {Streptomyces lydicus} PDB: 4gr4_A Back     alignment and structure
>1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Back     alignment and structure
>3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Back     alignment and structure
>3qov_A Phenylacetate-coenzyme A ligase; acetyl-COA synthetase-like, structural genomics, joint cente structural genomics, JCSG; HET: MSE ADP COA; 2.20A {Bacteroides thetaiotaomicron} PDB: 3s89_A* Back     alignment and structure
>2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* Back     alignment and structure
>2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} Back     alignment and structure
>3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A Back     alignment and structure
>3hgu_A EHPF; phenazine, antibiotic, biosynthetic protein; 1.95A {Pantoea agglomerans} PDB: 3hgv_A 3l2k_A* Back     alignment and structure
>4eql_A 4-substituted benzoates-glutamate ligase GH3.12; firefly luciferase family, acyl adenylase, amino acid conjug ligase; HET: AMP SAL; 1.80A {Arabidopsis thaliana} PDB: 4epm_A* 4eq4_A* 4ewv_A* Back     alignment and structure
>4b2g_A GH3-1 auxin conjugating enzyme; signaling protein, ignaling protein, adenylate, amino acid conjugation, plant growth; HET: V1N; 2.40A {Vitis vinifera} Back     alignment and structure
>4epl_A Jasmonic acid-amido synthetase JAR1; ANL adenylating enzyme, acyl acid-amido synthetase, adenylat ligase; HET: JAI; 2.01A {Arabidopsis thaliana} Back     alignment and structure
>3lax_A Phenylacetate-coenzyme A ligase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.43A {Bacteroides vulgatus} Back     alignment and structure
>3ezx_A MMCP 1, monomethylamine corrinoid protein 1; N terminal all helical bundle C terminal rossmann fold, cobalt, metal-binding; HET: HCB; 2.56A {Methanosarcina barkeri} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 334
d1pg4a_643 e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella en 1e-58
d1ry2a_640 e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast 2e-46
d1v25a_534 e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0 8e-41
d1lcia_541 e.23.1.1 (A:) Luciferase {Firefly (Photinus pyrali 5e-35
d3cw9a1503 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alc 3e-24
d1amua_514 e.23.1.1 (A:) Phenylalanine activating domain of g 2e-20
d1mdba_536 e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {B 3e-19
>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Length = 643 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Acetyl-CoA synthetase
species: Salmonella enterica [TaxId: 28901]
 Score =  197 bits (502), Expect = 1e-58
 Identities = 53/299 (17%), Positives = 102/299 (34%), Gaps = 46/299 (15%)

Query: 40  FKQLVTSQPPDFQLPKISPNDLAMLPYSSGTTGVPKGVKLSHNNCAVNLEQCVHPDIVNH 99
           ++ L+    P+ Q   ++  D   + Y+SG+TG PKGV  +     V             
Sbjct: 233 WRDLIEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVF--- 289

Query: 100 IPTSDTSQETVLSVLPFFHIYGFNGILNVVMMYGMHMITIPK----FTPETYIECVVKYK 155
                   +          + G + +L   +  G   +         TP    + V K++
Sbjct: 290 ---DYHPGDIYWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHQ 346

Query: 156 PTILFVVPSLLLFLASHP--AVTPEHLASIREVTCGAAPATKSLIDKFKQKVQREDITIR 213
             IL+  P+ +  L +    A+     +S+R +     P      + + +K+ +E   + 
Sbjct: 347 VNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKCPVV 406

Query: 214 QGYGMTETSPCTLYTRFAIPEAKLGSTGQL------------------------------ 243
             +  TET    +       E K GS  +                               
Sbjct: 407 DTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSW 466

Query: 244 --VMLGYLKNEEATKETVDS--EGWLHTGDVAYYDEDGYFYIVDRTKELIKVKGNQVAP 298
                    + E  ++T  S  +    +GD A  DEDGY++I  R  +++ V G+++  
Sbjct: 467 PGQARTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGT 525


>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 640 Back     information, alignment and structure
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Length = 534 Back     information, alignment and structure
>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Length = 541 Back     information, alignment and structure
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Length = 503 Back     information, alignment and structure
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Length = 514 Back     information, alignment and structure
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Length = 536 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query334
d1pg4a_643 Acetyl-CoA synthetase {Salmonella enterica [TaxId: 100.0
d1ry2a_640 Acetyl-CoA synthetase {Baker's yeast (Saccharomyce 100.0
d1lcia_541 Luciferase {Firefly (Photinus pyralis) [TaxId: 705 100.0
d1v25a_534 Long chain fatty acid-CoA ligase TT0168 {Thermus t 100.0
d1mdba_536 Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtil 100.0
d3cw9a1503 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId 100.0
d1amua_514 Phenylalanine activating domain of gramicidin synt 100.0
d1lcia_ 541 Luciferase {Firefly (Photinus pyralis) [TaxId: 705 82.81
d3cw9a1 503 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId 81.08
>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Acetyl-CoA synthetase
species: Salmonella enterica [TaxId: 28901]
Probab=100.00  E-value=2.4e-51  Score=389.80  Aligned_cols=309  Identities=20%  Similarity=0.305  Sum_probs=244.4

Q ss_pred             hCCCCceEEEEcCCCCC----CCCccchhhhhcCCCCCCCCCCCCCCCEEEEecCCCCCCCchhhhhcchHHHHHhhhhc
Q psy12107         17 TLPNFRGTIVVGGEHDK----SKNIFGFKQLVTSQPPDFQLPKISPNDLAMLPYSSGTTGVPKGVKLSHNNCAVNLEQCV   92 (334)
Q Consensus        17 ~~~~~~~ii~~~~~~~~----~~~~~~~~~ll~~~~~~~~~~~~~~~~~a~i~~TSGTTG~PK~v~~t~~~~~~~~~~~~   92 (334)
                      .++.+++++++......    ......+.+..........+..++++|+++|+|||||||.||||+++|++++.+.....
T Consensus       206 ~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dd~a~IlyTSGTTG~PKgV~~sh~~~l~~~~~~~  285 (643)
T d1pg4a_         206 NVTSVEHVIVLKRTGSDIDWQEGRDLWWRDLIEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTF  285 (643)
T ss_dssp             TCCSCCEEEEECSSCCCCCCCBTTEEEHHHHHTTSCSCCCCCCEETTSEEEEEEECCSSSSCEEEEEESHHHHHHHHHHH
T ss_pred             ccccceEEEEeccCCcccccccccchhhhhhhcccCcccCCCCCCCCCeEEEEeCCCcccCCCEEEEccHHHHHHHHHHH
Confidence            45777888887754221    11233445555433333444567889999999999999999999999999765543322


Q ss_pred             cCccccCCCCCCCCCceEEEecchhhhhHHHHHHHHHHHhCcEEEEcCC----CCHHHHHHHHHHcCCeEEeechHHHHH
Q psy12107         93 HPDIVNHIPTSDTSQETVLSVLPFFHIYGFNGILNVVMMYGMHMITIPK----FTPETYIECVVKYKPTILFVVPSLLLF  168 (334)
Q Consensus        93 ~~~~~~~~~~~~~~~~~~l~~~p~~~~~~~~~~~~~~~~~G~~~~~~~~----~~~~~~~~~i~~~~~t~l~~~p~~l~~  168 (334)
                      ....      +..++|++++..|++|++++...++.++..|+++++.+.    +++..+++.|+++++|+++++|++++.
T Consensus       286 ~~~~------~~~~~d~~~~~~p~~~~~g~~~~l~~~L~~G~t~vl~~~~~~~~~~~~~~~~i~~~~vt~~~~~P~~l~~  359 (643)
T d1pg4a_         286 KYVF------DYHPGDIYWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRA  359 (643)
T ss_dssp             HHHT------TCCTTCEEEECSCTTSHHHHHHTTHHHHHTTCEEEEECSCTTSSSTTHHHHHHHHHTCSEEEECHHHHHH
T ss_pred             HHhh------CCCCCCEEEEeCChHHHHHHHHHHHHHHHhCCEEEEecCCCCCCCHHHHHHHHHHHCCcEEEehHHHHHH
Confidence            2211      267899999999999999988777889999999998753    488999999999999999999999999


Q ss_pred             HhcCCC--CCccccccceeeeecCCCCCHHHHHHHHHHhccCCCceeeccCCCCCCCcccccccCCCCccccCc------
Q psy12107        169 LASHPA--VTPEHLASIREVTCGAAPATKSLIDKFKQKVQREDITIRQGYGMTETSPCTLYTRFAIPEAKLGST------  240 (334)
Q Consensus       169 l~~~~~--~~~~~~~~lr~v~~~G~~l~~~~~~~~~~~~~~~~~~i~~~YG~tE~g~~~~~~~~~~~~~~~~~~------  240 (334)
                      |++...  ....++++||.++++|+++++++.+++.+.++..++++++.||+||+|++++.......+.+.+++      
T Consensus       360 l~~~~~~~~~~~dl~sLr~i~~~G~pl~~~~~~~~~~~~g~~~~~i~~~yG~TE~g~~~~~~~~~~~~~~~gs~G~p~~g  439 (643)
T d1pg4a_         360 LMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFG  439 (643)
T ss_dssp             HHTTGGGGTTTCCCTTCCEEEEESSCCCHHHHHHHHHHTTTTCSCEEEEBCCGGGSSCSBCCCTTTCCBCTTCCBSBCTT
T ss_pred             HHhCcchhccccCCCceEEEEEEeCCCCHHHHHHHHHHhCCCCceEEEeechhhccceEEecCCCccCCCCCccccccCC
Confidence            987654  245678999999999999999999999999976567899999999998765543222111122333      


Q ss_pred             ------------------ccc--------ccccccCCcccccccc--CCCCceecCceEEEecCCcEEEEccCCceEEEc
Q psy12107        241 ------------------GQL--------VMLGYLKNEEATKETV--DSEGWLHTGDVAYYDEDGYFYIVDRTKELIKVK  292 (334)
Q Consensus       241 ------------------G~~--------~~~gy~~~~~~~~~~~--~~~~~~~TGD~~~~~~dg~~~~~GR~~d~i~~~  292 (334)
                                        |++        ++.||+++++.+.+.+  ..+|||+|||+|++|+||+++++||+||+||++
T Consensus       440 ~~v~ivd~~g~~~~~g~~Gel~v~~~~p~~~~~~~~~~~~~~~~~~~~~~g~~~TGDl~~~d~dG~l~i~GR~dd~ik~~  519 (643)
T d1pg4a_         440 VQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVS  519 (643)
T ss_dssp             CCEEEECTTCCBCCSSEEEEEEECSCCTTCCCEETTCHHHHHHHHHSSSTTSEEEEEEEEECTTSCEEEEEESSSEEEET
T ss_pred             CEEEEECCCCCCCCCCceEEEEEecCCCcccccccCChhhchhhhcccCCCeEEcCCEEEECCCceEEEecccccEEEEC
Confidence                              333        4568999988777654  347899999999999999999999999999999


Q ss_pred             CEEee------------------------------------------------------------eeeeccCcEEEeecC
Q psy12107        293 GNQVA------------------------------------------------------------PYKKLAGGVKFLETI  312 (334)
Q Consensus       293 G~~i~------------------------------------------------------------~~~~~~~~i~~v~~l  312 (334)
                      |++|+                                                            ++++|.. |+++++|
T Consensus       520 G~ri~p~eIE~~l~~~p~V~eaaVvg~~d~~~ge~~~a~Vv~~~~~~~~~~~~~~i~~~~~~~L~~~~vP~~-i~~v~~l  598 (643)
T d1pg4a_         520 GHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDV-LHWTDSL  598 (643)
T ss_dssp             TEEEEHHHHHHHHHHSTTEEEEEEEEEEETTTEEEEEEEEEECTTCCCCHHHHHHHHHHHHHHTCGGGCCSE-EEECSCC
T ss_pred             CEEECHHHHHHHHHhCCCcceEEEEEEECCCCCeEEEEEEEECCCCCCCHHHHHHHHHHHHhhCCcccCccE-EEEECCC
Confidence            99999                                                            6677777 9999999


Q ss_pred             CCCCCchhhHHHHhhhhcCC
Q psy12107        313 PRNPAGKVLRNELKVFGTNP  332 (334)
Q Consensus       313 P~t~~GKi~r~~l~~~~~~~  332 (334)
                      |+|++|||+|++||+++.+.
T Consensus       599 P~T~sGKi~R~~Lr~~~~~~  618 (643)
T d1pg4a_         599 PKTRSGKIMRRILRKIAAGD  618 (643)
T ss_dssp             CBCTTSCBCHHHHHHHHHTC
T ss_pred             CCCCCcCccHHHHHHHhcCC
Confidence            99999999999999987653



>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Back     information, alignment and structure
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Back     information, alignment and structure
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure