Psyllid ID: psy1215

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260
MLYKTVRDFTEGELKPIAAKLDREHLYPKEQIKKMGELGLMGVEVPEDLGAASTVAKQDSNGWTLNGTKAWITNGYESEATVVFATTDKSKKHKGISAFIVDKPTKGLSLGKKEDKLGINASSTCSLIFEDCSIPAENLLGEPGMGFKIAMMTLDAGRIGIASQALGIAQASLDCAVEYASKRTAFGQPIIKLQSIQQKIADMSLKLESARLLTWRAAYLKDNKQPFTKEAAMAKLAASETATYNAHQAIQIPIITKYLL
cHHHHHHHHHHHcccccHHHHHHHHccccccccEEEEEEcccccccccccccEEEEEEccccEEEcccEEEEEccccccEEEEEEEcccccccccEEEEEEccccccccccccccccccccccccEEEEcccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
HHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHccccccccHcHHHcccEEEEcccEEEEEEEEEEEEccccccEEEEEEEccHHHHHHcEEEEEEEcccccEEEcccccEcccccccEEEEEEEEEEEEHHHEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEccEEHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
mlyktvrdftegeLKPIAAkldrehlypkeQIKKMGelglmgvevpedlgaASTVakqdsngwtlngtkAWITNGYESEATVVFATtdkskkhkgisafivdkptkglslgkkedklginasstcslifedcsipaenllgepgmgFKIAMMTLDAGRIGIASQALGIAQASLDCAVEYASKRTAFGQPIIKLQSIQQKIADMSLKLESARLLTWRAAYLKDNKQPFTKEAAMAKLAASETATYNAHQAIQIPIITKYLL
mlyktvrdftegelkpiaakldrehlypKEQIKKMGELGLMGVEVPEDLGAAStvakqdsngwtlNGTKAWITNGYESEATVVFATtdkskkhkgisafivdkptkglslgkkedklgINASSTCSLIFEDCSIPAENLLGEPGMGFKIAMMTLDAGRIGIASQALGIAQASLDCAVEYASKRTAFGQPIIKLQSIQQKIADMSLKLESARLLTWRAAYLKDNKQPFTKEAAMAKLAASETatynahqaiqiPIITKYLL
MLYKTVRDFTEGELKPIAAKLDREHLYPKEQIKKMGELGLMGVEVPEDLGAASTVAKQDSNGWTLNGTKAWITNGYESEATVVFATTDKSKKHKGISAFIVDKPTKGLSLGKKEDKLGINASSTCSLIFEDCSIPAENLLGEPGMGFKIAMMTLDAGRIGIASQALGIAQASLDCAVEYASKRTAFGQPIIKLQSIQQKIADMSLKLESARLLTWRAAYLKDNKQPFTKEAAMAKLAASETATYNAHQAIQIPIITKYLL
*************************LY****IKKMGELGLMGVEVPEDLGAASTVAKQDSNGWTLNGTKAWITNGYESEATVVFATTDKSKKHKGISAFIVDKPTKGLSL****DKLGINASSTCSLIFEDCSIPAENLLGEPGMGFKIAMMTLDAGRIGIASQALGIAQASLDCAVEYASKRTAFGQPIIKLQSIQQKIADMSLKLESARLLTWRAAYLKDNKQPFTKEAAMAKLAASETATYNAHQAIQIPIITKYL*
MLYKTVRDFTEGELKPIAAKLDREHLYPKEQIKKMGELGLMGVEVPEDLGAASTVAKQDSNGWTLNGTKAWITNGYESEATVVFATTDKSKKHKGISAFIVDKPTKGLSLGKKEDKLGINASSTCSLIFEDCSIPAENLLGEPGMGFKIAMMTLDAGRIGIASQALGIAQASLDCAVEYASKRTAFGQPIIKLQSIQQKIADMSLKLESARLLTWRAAYLKDNKQPFTKEAAMAKLAASETATYNAHQAIQIPIITKYLL
MLYKTVRDFTEGELKPIAAKLDREHLYPKEQIKKMGELGLMGVEVPEDLGAASTVAKQDSNGWTLNGTKAWITNGYESEATVVFATTDKSKKHKGISAFIVDKPTKGLSLGKKEDKLGINASSTCSLIFEDCSIPAENLLGEPGMGFKIAMMTLDAGRIGIASQALGIAQASLDCAVEYASKRTAFGQPIIKLQSIQQKIADMSLKLESARLLTWRAAYLKDNKQPFTKEAAMAKLAASETATYNAHQAIQIPIITKYLL
MLYKTVRDFTEGELKPIAAKLDREHLYPKEQIKKMGELGLMGVEVPEDLGAASTVAKQDSNGWTLNGTKAWITNGYESEATVVFATTDKSKKHKGISAFIVDKPTKGLSLGKKEDKLGINASSTCSLIFEDCSIPAENLLGEPGMGFKIAMMTLDAGRIGIASQALGIAQASLDCAVEYASKRTAFGQPIIKLQSIQQKIADMSLKLESARLLTWRAAYLKDNKQPFTKEAAMAKLAASETATYNAHQAIQIPIITKYLL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLYKTVRDFTEGELKPIAAKLDREHLYPKEQIKKMGELGLMGVEVPEDLGAASTVAKQDSNGWTLNGTKAWITNGYESEATVVFATTDKSKKHKGISAFIVDKPTKGLSLGKKEDKLGINASSTCSLIFEDCSIPAENLLGEPGMGFKIAMMTLDAGRIGIASQALGIAQASLDCAVEYASKRTAFGQPIIKxxxxxxxxxxxxxxxxxxxxxTWRAAYLKDNKQPFTKEAAMAKLAASETATYNAHQAIQIPIITKYLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query260 2.2.26 [Sep-21-2011]
Q07417412 Short-chain specific acyl yes N/A 0.919 0.580 0.682 2e-87
P15651412 Short-chain specific acyl yes N/A 0.788 0.497 0.760 4e-87
Q5RAS0412 Short-chain specific acyl yes N/A 0.788 0.497 0.721 4e-82
P16219412 Short-chain specific acyl yes N/A 0.788 0.497 0.721 5e-82
P79273413 Short-chain specific acyl yes N/A 0.746 0.469 0.738 1e-77
Q3ZBF6412 Short-chain specific acyl yes N/A 0.703 0.444 0.739 1e-77
Q06319383 Acyl-CoA dehydrogenase, s yes N/A 0.873 0.592 0.5 7e-58
P52042379 Acyl-CoA dehydrogenase, s yes N/A 0.884 0.606 0.465 5e-52
P45867379 Acyl-CoA dehydrogenase OS yes N/A 0.846 0.580 0.477 5e-52
O34421380 Probable acyl-CoA dehydro no N/A 0.903 0.618 0.453 3e-50
>sp|Q07417|ACADS_MOUSE Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus GN=Acads PE=2 SV=2 Back     alignment and function desciption
 Score =  322 bits (825), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 163/239 (68%), Positives = 191/239 (79%)

Query: 14  LKPIAAKLDREHLYPKEQIKKMGELGLMGVEVPEDLGAASTVAKQDSNGWTLNGTKAWIT 73
           LK  +A+  ++ + P     K+G   L       D GAAST A+++ + W LNGTKAWIT
Sbjct: 128 LKFGSAQQKQQWITPFTNGDKIGCFALSEPGNGSDAGAASTTAREEGDSWVLNGTKAWIT 187

Query: 74  NGYESEATVVFATTDKSKKHKGISAFIVDKPTKGLSLGKKEDKLGINASSTCSLIFEDCS 133
           N +E+ ATVVFA+TD+S+++KGISAF+V  PT GL+LGKKEDKLGI ASST +LIFEDC 
Sbjct: 188 NSWEASATVVFASTDRSRQNKGISAFLVPMPTPGLTLGKKEDKLGIRASSTANLIFEDCR 247

Query: 134 IPAENLLGEPGMGFKIAMMTLDAGRIGIASQALGIAQASLDCAVEYASKRTAFGQPIIKL 193
           IP ENLLGEPGMGFKIAM TLD GRIGIASQALGIAQASLDCAV+YA  R AFG P+ KL
Sbjct: 248 IPKENLLGEPGMGFKIAMQTLDMGRIGIASQALGIAQASLDCAVKYAENRNAFGAPLTKL 307

Query: 194 QSIQQKIADMSLKLESARLLTWRAAYLKDNKQPFTKEAAMAKLAASETATYNAHQAIQI 252
           Q+IQ K+ADM+L LESARLLTWRAA LKDNK+PFTKE+AMAKLAASE AT  +HQAIQI
Sbjct: 308 QNIQFKLADMALALESARLLTWRAAMLKDNKKPFTKESAMAKLAASEAATAISHQAIQI 366

Mus musculus (taxid: 10090)
EC: 1EC: .EC: 3EC: .EC: 8EC: .EC: 1
>sp|P15651|ACADS_RAT Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Acads PE=1 SV=2 Back     alignment and function description
>sp|Q5RAS0|ACADS_PONAB Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Pongo abelii GN=ACADS PE=2 SV=1 Back     alignment and function description
>sp|P16219|ACADS_HUMAN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens GN=ACADS PE=1 SV=1 Back     alignment and function description
>sp|P79273|ACADS_PIG Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Sus scrofa GN=ACADS PE=2 SV=1 Back     alignment and function description
>sp|Q3ZBF6|ACADS_BOVIN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus GN=ACADS PE=2 SV=1 Back     alignment and function description
>sp|Q06319|ACDS_MEGEL Acyl-CoA dehydrogenase, short-chain specific OS=Megasphaera elsdenii PE=1 SV=1 Back     alignment and function description
>sp|P52042|ACDS_CLOAB Acyl-CoA dehydrogenase, short-chain specific OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=bcd PE=3 SV=1 Back     alignment and function description
>sp|P45867|ACDA_BACSU Acyl-CoA dehydrogenase OS=Bacillus subtilis (strain 168) GN=acdA PE=2 SV=1 Back     alignment and function description
>sp|O34421|ACDC_BACSU Probable acyl-CoA dehydrogenase YngJ OS=Bacillus subtilis (strain 168) GN=yngJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query260
218749864 402 short-chain acyl-CoA dehydrogenase [Naso 0.788 0.509 0.805 5e-92
124487759297 putative acyl-coenzyme A dehydrogenase, 0.896 0.784 0.729 3e-91
340728745 408 PREDICTED: short-chain specific acyl-CoA 0.926 0.590 0.685 4e-91
350415751 408 PREDICTED: short-chain specific acyl-CoA 0.926 0.590 0.690 2e-90
357618133 407 Arc42 [Danaus plexippus] 0.788 0.503 0.795 5e-90
332016277 411 Short-chain specific acyl-CoA dehydrogen 0.919 0.581 0.691 7e-90
322796936 401 hypothetical protein SINV_12082 [Solenop 0.919 0.596 0.695 2e-89
193713629 411 PREDICTED: short-chain specific acyl-CoA 0.880 0.557 0.720 2e-88
347966858 404 AGAP001951-PA [Anopheles gambiae str. PE 0.788 0.507 0.790 2e-88
383852115 409 PREDICTED: short-chain specific acyl-CoA 0.926 0.589 0.681 2e-88
>gi|218749864|ref|NP_001136342.1| short-chain acyl-CoA dehydrogenase [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  343 bits (880), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 166/206 (80%), Positives = 184/206 (89%), Gaps = 1/206 (0%)

Query: 48  DLGAASTVAKQD-SNGWTLNGTKAWITNGYESEATVVFATTDKSKKHKGISAFIVDKPTK 106
           D GAAST AK   S G+ LNGTK WITNGYE+E  VVFATTDK+KKHKGISAFIVDKPT 
Sbjct: 151 DAGAASTTAKTSGSGGYLLNGTKCWITNGYEAEGIVVFATTDKAKKHKGISAFIVDKPTP 210

Query: 107 GLSLGKKEDKLGINASSTCSLIFEDCSIPAENLLGEPGMGFKIAMMTLDAGRIGIASQAL 166
           GLSLGKKEDKLGI  SSTCSLIFEDC +P ENLLGEPGMGFKIAMMTLDAGRIGIASQAL
Sbjct: 211 GLSLGKKEDKLGIRGSSTCSLIFEDCKVPEENLLGEPGMGFKIAMMTLDAGRIGIASQAL 270

Query: 167 GIAQASLDCAVEYASKRTAFGQPIIKLQSIQQKIADMSLKLESARLLTWRAAYLKDNKQP 226
           GIAQASLDCAVEYA+KRTAFG  I KLQ+IQ K+ADM++++E++RLLTWRAAYLKDN +P
Sbjct: 271 GIAQASLDCAVEYATKRTAFGNAIAKLQAIQMKLADMAMRVEASRLLTWRAAYLKDNGKP 330

Query: 227 FTKEAAMAKLAASETATYNAHQAIQI 252
           +TKEAAMAKL+ASE AT+ +HQAIQI
Sbjct: 331 YTKEAAMAKLSASEAATFCSHQAIQI 356

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|124487759|gb|ABN11966.1| putative acyl-coenzyme A dehydrogenase, short chain [Maconellicoccus hirsutus] Back     alignment and taxonomy information
>gi|340728745|ref|XP_003402677.1| PREDICTED: short-chain specific acyl-CoA dehydrogenase, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350415751|ref|XP_003490739.1| PREDICTED: short-chain specific acyl-CoA dehydrogenase, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|357618133|gb|EHJ71227.1| Arc42 [Danaus plexippus] Back     alignment and taxonomy information
>gi|332016277|gb|EGI57190.1| Short-chain specific acyl-CoA dehydrogenase, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322796936|gb|EFZ19288.1| hypothetical protein SINV_12082 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|193713629|ref|XP_001947919.1| PREDICTED: short-chain specific acyl-CoA dehydrogenase, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|347966858|ref|XP_321112.5| AGAP001951-PA [Anopheles gambiae str. PEST] gi|333469867|gb|EAA01272.5| AGAP001951-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|383852115|ref|XP_003701574.1| PREDICTED: short-chain specific acyl-CoA dehydrogenase, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query260
RGD|620514412 Acads "acyl-CoA dehydrogenase, 0.830 0.524 0.721 1.1e-95
UNIPROTKB|P16219412 ACADS "Short-chain specific ac 0.830 0.524 0.684 1e-90
ZFIN|ZDB-GENE-040808-64424 acads "acyl-Coenzyme A dehydro 0.834 0.511 0.696 2.7e-90
MGI|MGI:87868412 Acads "acyl-Coenzyme A dehydro 0.919 0.580 0.682 1.6e-79
UNIPROTKB|Q5ZL56416 ACADS "Uncharacterized protein 0.830 0.519 0.739 3.3e-79
FB|FBgn0038742405 Arc42 "Arc42" [Drosophila mela 0.884 0.567 0.686 3e-78
UNIPROTKB|F1PLG8414 ACADS "Uncharacterized protein 0.830 0.521 0.712 4.3e-77
UNIPROTKB|F1PZX6373 ACADS "Uncharacterized protein 0.830 0.579 0.712 4.3e-77
UNIPROTKB|F1RJH2412 ACADS "Short-chain-specific ac 0.788 0.497 0.741 8.1e-76
UNIPROTKB|F1MVL2412 ACADS "Short-chain-specific ac 0.830 0.524 0.694 8.1e-76
RGD|620514 Acads "acyl-CoA dehydrogenase, C-2 to C-3 short chain" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 795 (284.9 bits), Expect = 1.1e-95, Sum P(2) = 1.1e-95
 Identities = 158/219 (72%), Positives = 183/219 (83%)

Query:    37 ELGLMGVEVP---EDLGAASTVAKQDSNGWTLNGTKAWITNGYESEATVVFATTDKSKKH 93
             ++G   +  P    D GAAST A+++ + W LNGTKAWITN +E+ ATVVFA+TD+S+++
Sbjct:   148 KIGCFALSEPGNGSDAGAASTTAREEGDSWVLNGTKAWITNSWEASATVVFASTDRSRQN 207

Query:    94 KGISAFIVDKPTKGLSLGKKEDKLGINASSTCSLIFEDCSIPAENLLGEPGMGFKIAMMT 153
             KGISAF+V  PT GL+LGKKEDKLGI ASST +LIFEDC IP ENLLGEPGMGFKIAM T
Sbjct:   208 KGISAFLVPMPTPGLTLGKKEDKLGIRASSTANLIFEDCRIPKENLLGEPGMGFKIAMQT 267

Query:   154 LDAGRIGIASQALGIAQASLDCAVEYASKRTAFGQPIIKLQSIQQKIADMSLKLESARLL 213
             LD GRIGIASQALGIAQASLDCAV+YA  R AFG P+ KLQ+IQ K+ADM+L LESARLL
Sbjct:   268 LDMGRIGIASQALGIAQASLDCAVKYAENRHAFGAPLTKLQNIQFKLADMALALESARLL 327

Query:   214 TWRAAYLKDNKQPFTKEAAMAKLAASETATYNAHQAIQI 252
             TWRAA LKDNK+PFTKE+AMAKLAASE AT  +HQAIQI
Sbjct:   328 TWRAAMLKDNKKPFTKESAMAKLAASEAATAISHQAIQI 366
GO:0000062 "fatty-acyl-CoA binding" evidence=IDA
GO:0003995 "acyl-CoA dehydrogenase activity" evidence=IEA;NAS;IDA
GO:0004085 "butyryl-CoA dehydrogenase activity" evidence=IDA;TAS
GO:0005739 "mitochondrion" evidence=IEA;ISO;IDA
GO:0005759 "mitochondrial matrix" evidence=IDA;TAS
GO:0006635 "fatty acid beta-oxidation" evidence=TAS
GO:0031966 "mitochondrial membrane" evidence=IDA
GO:0033539 "fatty acid beta-oxidation using acyl-CoA dehydrogenase" evidence=IDA
GO:0042594 "response to starvation" evidence=IEP
GO:0046359 "butyrate catabolic process" evidence=IDA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA;IDA
GO:0051289 "protein homotetramerization" evidence=IDA
GO:0051384 "response to glucocorticoid stimulus" evidence=IEP
UNIPROTKB|P16219 ACADS "Short-chain specific acyl-CoA dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040808-64 acads "acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:87868 Acads "acyl-Coenzyme A dehydrogenase, short chain" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZL56 ACADS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0038742 Arc42 "Arc42" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1PLG8 ACADS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PZX6 ACADS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RJH2 ACADS "Short-chain-specific acyl-CoA dehydrogenase, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MVL2 ACADS "Short-chain-specific acyl-CoA dehydrogenase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5RAS0ACADS_PONAB1, ., 3, ., 8, ., 10.72190.78840.4975yesN/A
P52042ACDS_CLOAB1, ., 3, ., 8, ., 10.46520.88460.6068yesN/A
P16219ACADS_HUMAN1, ., 3, ., 8, ., 10.72190.78840.4975yesN/A
P79273ACADS_PIG1, ., 3, ., 8, ., 10.73840.74610.4697yesN/A
Q3ZBF6ACADS_BOVIN1, ., 3, ., 8, ., 10.73950.70380.4441yesN/A
Q07417ACADS_MOUSE1, ., 3, ., 8, ., 10.68200.91920.5800yesN/A
P15651ACADS_RAT1, ., 3, ., 8, ., 10.76090.78840.4975yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.3.990.921
3rd Layer1.3.99.20.914

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query260
cd01158373 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrog 1e-119
cd00567327 cd00567, ACAD, Acyl-CoA dehydrogenase 2e-84
COG1960393 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid meta 4e-74
cd01156376 cd01156, IVD, Isovaleryl-CoA dehydrogenase 3e-61
cd01162375 cd01162, IBD, Isobutyryl-CoA dehydrogenase 2e-60
cd01161409 cd01161, VLCAD, Very long chain acyl-CoA dehydroge 2e-52
cd01160372 cd01160, LCAD, Long chain acyl-CoA dehydrogenase 2e-52
PLN02519404 PLN02519, PLN02519, isovaleryl-CoA dehydrogenase 4e-52
cd01157378 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase 3e-48
cd01151386 cd01151, GCD, Glutaryl-CoA dehydrogenase 6e-42
PTZ00461410 PTZ00461, PTZ00461, isovaleryl-CoA dehydrogenase; 2e-40
PRK12341381 PRK12341, PRK12341, putative acyl-CoA dehydrogenas 1e-39
pfam00441150 pfam00441, Acyl-CoA_dh_1, Acyl-CoA dehydrogenase, 3e-38
TIGR03207372 TIGR03207, cyc_hxne_CoA_dh, cyclohexanecarboxyl-Co 1e-32
cd01153407 cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogena 5e-27
cd01154418 cd01154, AidB, Proteins involved in DNA damage res 8e-27
PRK03354380 PRK03354, PRK03354, crotonobetainyl-CoA dehydrogen 1e-25
cd01152380 cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehyd 4e-25
cd01155394 cd01155, ACAD_FadE2, Acyl-CoA dehydrogenases simil 1e-23
PLN02526412 PLN02526, PLN02526, acyl-coenzyme A oxidase 2e-22
TIGR03203378 TIGR03203, pimD_small, pimeloyl-CoA dehydrogenase, 1e-21
cd01158 373 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrog 4e-17
PLN02876822 PLN02876, PLN02876, acyl-CoA dehydrogenase 3e-16
TIGR03204395 TIGR03204, pimC_large, pimeloyl-CoA dehydrogenase, 3e-16
pfam02771113 pfam02771, Acyl-CoA_dh_N, Acyl-CoA dehydrogenase, 9e-16
PTZ00456 622 PTZ00456, PTZ00456, acyl-CoA dehydrogenase; Provis 9e-11
pfam08028134 pfam08028, Acyl-CoA_dh_2, Acyl-CoA dehydrogenase, 2e-10
cd01156 376 cd01156, IVD, Isovaleryl-CoA dehydrogenase 4e-10
cd01163377 cd01163, DszC, Dibenzothiophene (DBT) desulfurizat 2e-08
PRK11561 538 PRK11561, PRK11561, isovaleryl CoA dehydrogenase; 2e-08
PRK13026 774 PRK13026, PRK13026, acyl-CoA dehydrogenase; Review 6e-08
pfam0277052 pfam02770, Acyl-CoA_dh_M, Acyl-CoA dehydrogenase, 7e-08
PRK09463 777 PRK09463, fadE, acyl-CoA dehydrogenase; Reviewed 9e-08
PLN02636 686 PLN02636, PLN02636, acyl-coenzyme A oxidase 2e-06
COG1960 393 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid meta 3e-06
cd01157 378 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase 6e-06
PLN02312 680 PLN02312, PLN02312, acyl-CoA oxidase 1e-05
cd01160 372 cd01160, LCAD, Long chain acyl-CoA dehydrogenase 2e-05
cd01162 375 cd01162, IBD, Isobutyryl-CoA dehydrogenase 3e-05
cd01150 610 cd01150, AXO, Peroxisomal acyl-CoA oxidase 3e-05
cd01161 409 cd01161, VLCAD, Very long chain acyl-CoA dehydroge 7e-05
PTZ00460 646 PTZ00460, PTZ00460, acyl-CoA dehydrogenase; Provis 7e-04
PLN02519 404 PLN02519, PLN02519, isovaleryl-CoA dehydrogenase 0.003
>gnl|CDD|173847 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases Back     alignment and domain information 
 Score =  345 bits (886), Expect = e-119
 Identities = 132/230 (57%), Positives = 166/230 (72%)

Query: 23  REHLYPKEQIKKMGELGLMGVEVPEDLGAASTVAKQDSNGWTLNGTKAWITNGYESEATV 82
           +++L P    +K+G   L       D  A  T AK+D + + LNG+K WITNG E++  +
Sbjct: 102 KKYLPPLATGEKIGAFALSEPGAGSDAAALKTTAKKDGDDYVLNGSKMWITNGGEADFYI 161

Query: 83  VFATTDKSKKHKGISAFIVDKPTKGLSLGKKEDKLGINASSTCSLIFEDCSIPAENLLGE 142
           VFA TD SK ++GI+AFIV++ T GLS+GKKEDKLGI  SST  LIFED  +P EN+LGE
Sbjct: 162 VFAVTDPSKGYRGITAFIVERDTPGLSVGKKEDKLGIRGSSTTELIFEDVRVPKENILGE 221

Query: 143 PGMGFKIAMMTLDAGRIGIASQALGIAQASLDCAVEYASKRTAFGQPIIKLQSIQQKIAD 202
            G GFKIAM TLD GRIGIA+QALGIAQA+LD AV+YA +R  FG+PI   Q IQ K+AD
Sbjct: 222 EGEGFKIAMQTLDGGRIGIAAQALGIAQAALDAAVDYAKERKQFGKPIADFQGIQFKLAD 281

Query: 203 MSLKLESARLLTWRAAYLKDNKQPFTKEAAMAKLAASETATYNAHQAIQI 252
           M+ ++E+ARLLT++AA LKDN +PF KEAAMAKL ASE A      A+QI
Sbjct: 282 MATEIEAARLLTYKAARLKDNGEPFIKEAAMAKLFASEVAMRVTTDAVQI 331

Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers. Length = 373
>gnl|CDD|173838 cd00567, ACAD, Acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|224871 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|173845 cd01156, IVD, Isovaleryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173851 cd01162, IBD, Isobutyryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173850 cd01161, VLCAD, Very long chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173849 cd01160, LCAD, Long chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|215284 PLN02519, PLN02519, isovaleryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173846 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173840 cd01151, GCD, Glutaryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|185640 PTZ00461, PTZ00461, isovaleryl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183454 PRK12341, PRK12341, putative acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|201229 pfam00441, Acyl-CoA_dh_1, Acyl-CoA dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|132251 TIGR03207, cyc_hxne_CoA_dh, cyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173842 cd01153, ACAD_fadE5, Putative acyl-CoA dehydrogenases similar to fadE5 Back     alignment and domain information
>gnl|CDD|173843 cd01154, AidB, Proteins involved in DNA damage response, similar to the AidB gene product Back     alignment and domain information
>gnl|CDD|179566 PRK03354, PRK03354, crotonobetainyl-CoA dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|173841 cd01152, ACAD_fadE6_17_26, Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26 Back     alignment and domain information
>gnl|CDD|173844 cd01155, ACAD_FadE2, Acyl-CoA dehydrogenases similar to fadE2 Back     alignment and domain information
>gnl|CDD|178141 PLN02526, PLN02526, acyl-coenzyme A oxidase Back     alignment and domain information
>gnl|CDD|132247 TIGR03203, pimD_small, pimeloyl-CoA dehydrogenase, small subunit Back     alignment and domain information
>gnl|CDD|173847 cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases Back     alignment and domain information
>gnl|CDD|215473 PLN02876, PLN02876, acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|132248 TIGR03204, pimC_large, pimeloyl-CoA dehydrogenase, large subunit Back     alignment and domain information
>gnl|CDD|217220 pfam02771, Acyl-CoA_dh_N, Acyl-CoA dehydrogenase, N-terminal domain Back     alignment and domain information
>gnl|CDD|185635 PTZ00456, PTZ00456, acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|219705 pfam08028, Acyl-CoA_dh_2, Acyl-CoA dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|173845 cd01156, IVD, Isovaleryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173852 cd01163, DszC, Dibenzothiophene (DBT) desulfurization enzyme C Back     alignment and domain information
>gnl|CDD|183199 PRK11561, PRK11561, isovaleryl CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237277 PRK13026, PRK13026, acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|145755 pfam02770, Acyl-CoA_dh_M, Acyl-CoA dehydrogenase, middle domain Back     alignment and domain information
>gnl|CDD|236528 PRK09463, fadE, acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|215342 PLN02636, PLN02636, acyl-coenzyme A oxidase Back     alignment and domain information
>gnl|CDD|224871 COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|173846 cd01157, MCAD, Medium chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|215178 PLN02312, PLN02312, acyl-CoA oxidase Back     alignment and domain information
>gnl|CDD|173849 cd01160, LCAD, Long chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173851 cd01162, IBD, Isobutyryl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|173839 cd01150, AXO, Peroxisomal acyl-CoA oxidase Back     alignment and domain information
>gnl|CDD|173850 cd01161, VLCAD, Very long chain acyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|185639 PTZ00460, PTZ00460, acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215284 PLN02519, PLN02519, isovaleryl-CoA dehydrogenase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 260
KOG0139|consensus398 100.0
KOG0140|consensus408 100.0
KOG0141|consensus421 100.0
cd01160372 LCAD Long chain acyl-CoA dehydrogenase. LCAD is an 100.0
cd01157378 MCAD Medium chain acyl-CoA dehydrogenase. MCADs ar 100.0
TIGR03207372 cyc_hxne_CoA_dh cyclohexanecarboxyl-CoA dehydrogen 100.0
cd01156376 IVD Isovaleryl-CoA dehydrogenase. Isovaleryl-CoA d 100.0
cd01162375 IBD Isobutyryl-CoA dehydrogenase. Isobutyryl-CoA d 100.0
PRK03354380 crotonobetainyl-CoA dehydrogenase; Validated 100.0
PRK12341381 putative acyl-CoA dehydrogenase; Provisional 100.0
TIGR03203378 pimD_small pimeloyl-CoA dehydrogenase, small subun 100.0
PLN02519404 isovaleryl-CoA dehydrogenase 100.0
cd01151386 GCD Glutaryl-CoA dehydrogenase. Glutaryl-CoA dehyd 100.0
cd01158373 SCAD_SBCAD Short chain acyl-CoA dehydrogenases and 100.0
PTZ00461410 isovaleryl-CoA dehydrogenase; Provisional 100.0
cd01155394 ACAD_FadE2 Acyl-CoA dehydrogenases similar to fadE 100.0
cd01161409 VLCAD Very long chain acyl-CoA dehydrogenase. VLCA 100.0
PLN02526412 acyl-coenzyme A oxidase 100.0
COG1960393 CaiA Acyl-CoA dehydrogenases [Lipid metabolism] 100.0
cd01153407 ACAD_fadE5 Putative acyl-CoA dehydrogenases simila 100.0
PRK09463 777 fadE acyl-CoA dehydrogenase; Reviewed 100.0
cd01163377 DszC Dibenzothiophene (DBT) desulfurization enzyme 100.0
PRK13026 774 acyl-CoA dehydrogenase; Reviewed 100.0
cd01159370 NcnH Naphthocyclinone hydroxylase. Naphthocyclinon 100.0
TIGR03204395 pimC_large pimeloyl-CoA dehydrogenase, large subun 100.0
cd01152380 ACAD_fadE6_17_26 Putative acyl-CoA dehydrogenases 100.0
PLN02876822 acyl-CoA dehydrogenase 100.0
cd00567327 ACAD Acyl-CoA dehydrogenase. Both mitochondrial ac 100.0
PTZ00456 622 acyl-CoA dehydrogenase; Provisional 100.0
PLN02636 686 acyl-coenzyme A oxidase 100.0
cd01154418 AidB Proteins involved in DNA damage response, sim 100.0
KOG0137|consensus 634 100.0
KOG0138|consensus432 100.0
PLN02312 680 acyl-CoA oxidase 100.0
PRK11561 538 isovaleryl CoA dehydrogenase; Provisional 100.0
KOG1469|consensus392 100.0
PTZ00460 646 acyl-CoA dehydrogenase; Provisional 100.0
cd01150 610 AXO Peroxisomal acyl-CoA oxidase. Peroxisomal acyl 100.0
PLN02443 664 acyl-coenzyme A oxidase 100.0
TIGR02309477 HpaB-1 4-hydroxyphenylacetate 3-monooxygenase, oxy 99.97
PTZ00457 520 acyl-CoA dehydrogenase; Provisional 99.97
KOG0135|consensus 661 99.9
PF00441150 Acyl-CoA_dh_1: Acyl-CoA dehydrogenase, C-terminal 99.76
COG2368493 Aromatic ring hydroxylase [Secondary metabolites b 99.71
TIGR02310 519 HpaB-2 4-hydroxyphenylacetate 3-monooxygenase, oxy 99.71
KOG0136|consensus 670 99.58
PF08028134 Acyl-CoA_dh_2: Acyl-CoA dehydrogenase, C-terminal 99.34
PF11794264 HpaB_N: 4-hydroxyphenylacetate 3-hydroxylase N ter 99.19
PF0277052 Acyl-CoA_dh_M: Acyl-CoA dehydrogenase, middle doma 99.13
PF02771113 Acyl-CoA_dh_N: Acyl-CoA dehydrogenase, N-terminal 98.1
PF03241205 HpaB: 4-hydroxyphenylacetate 3-hydroxylase C termi 97.43
PTZ00457520 acyl-CoA dehydrogenase; Provisional 92.9
KOG0137|consensus634 92.78
>KOG0139|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.3e-59  Score=379.46  Aligned_cols=259  Identities=53%  Similarity=0.788  Sum_probs=252.9

Q ss_pred             CHHHHHHHHHhcccCchhhhhhhcCCCCHHHHHHHHHcCCccccCcccc-------------------------------
Q psy1215           1 MLYKTVRDFTEGELKPIAAKLDREHLYPKEQIKKMGELGLMGVEVPEDL-------------------------------   49 (260)
Q Consensus         1 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~G~~~~~vp~~~-------------------------------   49 (260)
                      ++++++++|+++.+.|...++|+++++|..+++.+.++|++++.+|++|                               
T Consensus        43 ~l~~tvrkfa~~~i~Plv~~mD~~~~~~~~v~k~~fe~Glmgv~vpeeyGGsG~df~~~~~v~EEisk~d~sv~~~v~v~  122 (398)
T KOG0139|consen   43 MLQKTVRKFAQEEIKPLVREMDRESRYPASVIKGLFELGLMGVEVPEEYGGSGLDFFAAAIVIEEISKVDASVGVIVDVQ  122 (398)
T ss_pred             HHHHHHHHHHHHhcchHHHhhhhhccCCHHHHHHHhhcCcceeecChhhCCCchhHHHHHHHHHHHhccCccceeEEEec
Confidence            3678999999999999999999999999999999999999999999999                               


Q ss_pred             -------------------------------------------cccccEEEEeCCeEEEeeeeeeeeCCCCCcEEEEEEE
Q psy1215          50 -------------------------------------------GAASTVAKQDSNGWTLNGTKAWITNGYESEATVVFAT   86 (260)
Q Consensus        50 -------------------------------------------~~~~~~a~~~~~g~~l~G~k~~~s~~~~a~~~~v~a~   86 (260)
                                                                 .++.|+|++++|.|+|||.|+|+||+..|++++|++.
T Consensus       123 ntL~~~~i~~fGteeqK~~~~P~~~~d~vgsfAlSEpgaGSDa~A~~T~Ak~~Gd~~viNGsKmWItN~~~A~~~lVfan  202 (398)
T KOG0139|consen  123 NTLYLPLIIQFGTEEQKEKYLPKLTGDLVGSFALSEPGAGSDAFALKTTAKKDGDDYVINGSKMWITNAGEADWFLVFAN  202 (398)
T ss_pred             ccccchHHHHhCcHHHHhhhcchhhccccceeeecCCCCCcchHHhhhhHhhcCCeEEEecceeeecCCcccceEEEEEe
Confidence                                                       4578999999999999999999999999999999999


Q ss_pred             eCCCCCCCceEEEEEeCCCCCeeecccCCcccCCCCCeeeEEEeceeeCCCCccCCCCccHHHHHHHHhhHhHHHHHHHH
Q psy1215          87 TDKSKKHKGISAFIVDKPTKGLSLGKKEDKLGINASSTCSLIFEDCSIPAENLLGEPGMGFKIAMMTLDAGRIGIASQAL  166 (260)
Q Consensus        87 ~~~~~~~~~~~~~~v~~~~~gv~~~~~~~~~G~~~~~~~~~~f~~v~Vp~~~vl~~~~~g~~~~~~~~~~~r~~~~a~~~  166 (260)
                      +++..+.+++++|+||+++||+++..+.+++|||+++++.++|+||+||++++||..|.|+++....++-+|+.++++++
T Consensus       203 ~d~~~~~Kgit~fiV~rd~~Gl~~~k~eDKLGmRaSsTcql~fedVrVpks~IlGe~G~GykyAm~~Ln~gRIgi~Aqml  282 (398)
T KOG0139|consen  203 ADPSKGYKGITCFIVPRDTPGLSLGKKEDKLGMRASSTCQLHFEDVRVPKSSILGEYGKGYKYAIEVLNAGRIGIGAQML  282 (398)
T ss_pred             cChhhccCceeEEEeeCCCCCcccCCccccccccccceeeEEeccccccchhhcccCCcchHHHHHhcCccceeehhhhh
Confidence            98878899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHhhccccCcccccchhHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCchhHHHHHHHHHHHHHHHHH
Q psy1215         167 GIAQASLDCAVEYASKRTAFGQPIIKLQSIQQKIADMSLKLESARLLTWRAAYLKDNKQPFTKEAAMAKLAASETATYNA  246 (260)
Q Consensus       167 G~~~~~l~~~~~~~~~r~~~g~~l~~~~~v~~~la~~~~~l~~~~a~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~  246 (260)
                      |.+++|+|.+++|+++|.+||+++.++|.+|++||++.+++|++|.++|++++.-|.+.|...+++|+|+++++.+..++
T Consensus       283 glaQ~c~d~tI~Y~q~R~~FGk~l~d~Q~iQhqiA~~~teiEaaRlL~ynaAr~k~~G~pf~keAAMAKl~ase~A~~~t  362 (398)
T KOG0139|consen  283 GLAQGCFDETIPYAQERLQFGKRLLDFQGLQHQIADMATEIEAARLLVYNAARMKDQGLPFVKEAAMAKLYASEVATKTT  362 (398)
T ss_pred             hhhHhHHHhhhHHHHHHHHhcchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCchHHHHHHHHHhhhhhhhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHccCCCCcC
Q psy1215         247 HQAIQIPIITKYL  259 (260)
Q Consensus       247 ~~~~~~~Gg~g~~  259 (260)
                      +.|+|.+||.||.
T Consensus       363 ~qCiq~lGG~Gyt  375 (398)
T KOG0139|consen  363 HQCIQWLGGVGYT  375 (398)
T ss_pred             HHHHHHHhccccc
Confidence            9999999999996

>KOG0140|consensus Back     alignment and domain information
>KOG0141|consensus Back     alignment and domain information
>cd01160 LCAD Long chain acyl-CoA dehydrogenase Back     alignment and domain information
>cd01157 MCAD Medium chain acyl-CoA dehydrogenase Back     alignment and domain information
>TIGR03207 cyc_hxne_CoA_dh cyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>cd01156 IVD Isovaleryl-CoA dehydrogenase Back     alignment and domain information
>cd01162 IBD Isobutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK03354 crotonobetainyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12341 putative acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>TIGR03203 pimD_small pimeloyl-CoA dehydrogenase, small subunit Back     alignment and domain information
>PLN02519 isovaleryl-CoA dehydrogenase Back     alignment and domain information
>cd01151 GCD Glutaryl-CoA dehydrogenase Back     alignment and domain information
>cd01158 SCAD_SBCAD Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases Back     alignment and domain information
>PTZ00461 isovaleryl-CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01155 ACAD_FadE2 Acyl-CoA dehydrogenases similar to fadE2 Back     alignment and domain information
>cd01161 VLCAD Very long chain acyl-CoA dehydrogenase Back     alignment and domain information
>PLN02526 acyl-coenzyme A oxidase Back     alignment and domain information
>COG1960 CaiA Acyl-CoA dehydrogenases [Lipid metabolism] Back     alignment and domain information
>cd01153 ACAD_fadE5 Putative acyl-CoA dehydrogenases similar to fadE5 Back     alignment and domain information
>PRK09463 fadE acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>cd01163 DszC Dibenzothiophene (DBT) desulfurization enzyme C Back     alignment and domain information
>PRK13026 acyl-CoA dehydrogenase; Reviewed Back     alignment and domain information
>cd01159 NcnH Naphthocyclinone hydroxylase Back     alignment and domain information
>TIGR03204 pimC_large pimeloyl-CoA dehydrogenase, large subunit Back     alignment and domain information
>cd01152 ACAD_fadE6_17_26 Putative acyl-CoA dehydrogenases similar to fadE6, fadE17, and fadE26 Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>cd00567 ACAD Acyl-CoA dehydrogenase Back     alignment and domain information
>PTZ00456 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>PLN02636 acyl-coenzyme A oxidase Back     alignment and domain information
>cd01154 AidB Proteins involved in DNA damage response, similar to the AidB gene product Back     alignment and domain information
>KOG0137|consensus Back     alignment and domain information
>KOG0138|consensus Back     alignment and domain information
>PLN02312 acyl-CoA oxidase Back     alignment and domain information
>PRK11561 isovaleryl CoA dehydrogenase; Provisional Back     alignment and domain information
>KOG1469|consensus Back     alignment and domain information
>PTZ00460 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>cd01150 AXO Peroxisomal acyl-CoA oxidase Back     alignment and domain information
>PLN02443 acyl-coenzyme A oxidase Back     alignment and domain information
>TIGR02309 HpaB-1 4-hydroxyphenylacetate 3-monooxygenase, oxygenase component Back     alignment and domain information
>PTZ00457 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>KOG0135|consensus Back     alignment and domain information
>PF00441 Acyl-CoA_dh_1: Acyl-CoA dehydrogenase, C-terminal domain; InterPro: IPR006090 Mammalian Co-A dehydrogenases (1 Back     alignment and domain information
>COG2368 Aromatic ring hydroxylase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02310 HpaB-2 4-hydroxyphenylacetate 3-monooxygenase, oxygenase component Back     alignment and domain information
>KOG0136|consensus Back     alignment and domain information
>PF08028 Acyl-CoA_dh_2: Acyl-CoA dehydrogenase, C-terminal domain; InterPro: IPR013107 Acyl Co-A dehydrogenases (1 Back     alignment and domain information
>PF11794 HpaB_N: 4-hydroxyphenylacetate 3-hydroxylase N terminal; InterPro: IPR024674 This domain is found in the N terminus of HpaB, which encodes part of the 4-hydroxyphenylacetate 3-hydroxylase from Escherichia coli [] Back     alignment and domain information
>PF02770 Acyl-CoA_dh_M: Acyl-CoA dehydrogenase, middle domain; InterPro: IPR006091 Acyl-CoA dehydrogenases (1 Back     alignment and domain information
>PF02771 Acyl-CoA_dh_N: Acyl-CoA dehydrogenase, N-terminal domain; InterPro: IPR006092 Mammalian Co-A dehydrogenases (1 Back     alignment and domain information
>PF03241 HpaB: 4-hydroxyphenylacetate 3-hydroxylase C terminal; InterPro: IPR024719 This C-terminal domain is found in HpaB, which encodes part of the 4-hydroxyphenylacetate 3-hydroxylase from Escherichia coli [] Back     alignment and domain information
>PTZ00457 acyl-CoA dehydrogenase; Provisional Back     alignment and domain information
>KOG0137|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query260
1jqi_A388 Crystal Structure Of Rat Short Chain Acyl-Coa Dehyd 3e-88
2vig_A391 Crystal Structure Of Human Short-Chain Acyl Coa Deh 2e-82
1buc_A383 Three-Dimensional Structure Of Butyryl-Coa Dehydrog 5e-59
1ukw_A379 Crystal Structure Of Medium-Chain Acyl-Coa Dehydrog 1e-47
2jif_A404 Structure Of Human Short-Branched Chain Acyl-Coa De 6e-46
3pfd_A393 Crystal Structure Of An Acyl-Coa Dehydrogenase From 1e-42
1ws9_A387 Crystal Structure Of Project Id Tt0172 From Thermus 4e-42
2dvl_A372 Crystal Structure Of Project Tt0160 From Thermus Th 5e-38
1ivh_A394 Structure Of Human Isovaleryl-coa Dehydrogenase At 4e-36
1rx0_A393 Crystal Structure Of Isobutyryl-Coa Dehydrogenase C 7e-34
3nf4_A387 Crystal Structure Of Acyl-Coa Dehydrogenase From My 7e-34
1udy_A396 Medium-Chain Acyl-Coa Dehydrogenase With 3-Thiaocta 5e-33
3mdd_A385 Crystal Structures Of Medium Chain Acyl-Coa Dehydro 5e-33
2a1t_A421 Structure Of The Human Mcad:etf E165betaa Complex L 3e-32
1ege_A396 Structure Of T255e, E376g Mutant Of Human Medium Ch 3e-32
1egd_A396 Structure Of T255e, E376g Mutant Of Human Medium Ch 3e-32
2z1q_A 577 Crystal Structure Of Acyl Coa Dehydrogenase Length 5e-32
3mpi_A397 Structure Of The Glutaryl-Coenzyme A Dehydrogenase 2e-30
2pg0_A385 Crystal Structure Of Acyl-Coa Dehydrogenase From Ge 2e-29
2uxw_A 607 Crystal Structure Of Human Very Long Chain Acyl-coa 8e-29
3b96_A 587 Structural Basis For Substrate Fatty-Acyl Chain Spe 9e-29
3oib_A403 Crystal Structure Of A Putative Acyl-Coa Dehydrogen 2e-27
3owa_A 597 Crystal Structure Of Acyl-Coa Dehydrogenase Complex 1e-26
3r7k_A403 Crystal Structure Of A Probable Acyl Coa Dehydrogen 4e-25
3swo_A399 Crystal Structure Of A Glutaryl-Coa Dehydrogenase F 2e-22
3sf6_A403 Crystal Structure Of Glutaryl-Coa Dehydrogenase Fro 6e-22
3d6b_A395 2.2 A Crystal Structure Of Glutaryl-Coa Dehydrogena 6e-21
3eom_A396 2.4 A Crystal Structure Of Native Glutaryl-Coa Dehy 6e-21
3gqt_A399 Crystal Structure Of Glutaryl-Coa Dehydrogenase Fro 6e-21
2eba_A385 Crystal Structure Of The Putative Glutaryl-coa Dehy 9e-20
1sir_A394 The Crystal Structure And Mechanism Of Human Glutar 5e-18
1siq_A392 The Crystal Structure And Mechanism Of Human Glutar 5e-18
2r0m_A394 The Effect Of A Glu370asp Mutation In Glutaryl-Coa 6e-18
2ix5_A436 Short Chain Specific Acyl-Coa Oxidase From Arabidop 4e-17
2ix6_A449 Short Chain Specific Acyl-Coa Oxidase From Arabidop 4e-17
4hr3_A415 Structure Of A Putative Acyl-Coa Dehydrogenase From 1e-16
2wbi_A428 Crystal Structure Of Human Acyl-Coa Dehydrogenase 1 3e-13
3djl_A 541 Crystal Structure Of Alkylation Response Protein E. 7e-11
3m9v_A439 X-Ray Structure Of A Kijd3 In Complex With Dtdp Len 1e-10
2reh_A439 Mechanistic And Structural Analyses Of The Roles Of 2e-10
3d9g_A438 Nitroalkane Oxidase: Wild Type Crystallized In A Tr 3e-10
2c12_A439 Crystal Structure Of Nitroalkane Oxidase In Complex 3e-10
2zaf_A439 Mechanistic And Structural Analyses Of The Roles Of 3e-10
3d9d_A438 Nitroalkane Oxidase: Mutant D402n Crystallized With 3e-10
3d9f_A438 Nitroalkane Oxidase: Active Site Mutant S276a Cryst 4e-10
3mkh_A438 Podospora Anserina Nitroalkane Oxidase Length = 438 1e-09
2c0u_A439 Crystal Structure Of A Covalent Complex Of Nitroalk 2e-09
1r2j_A366 Fkbi For Biosynthesis Of Methoxymalonyl Extender Un 3e-08
3mxl_A395 Crystal Structure Of Nitrososynthase From Micromono 2e-05
4doy_A437 Crystal Structure Of Dibenzothiophene Desulfurizati 3e-04
>pdb|1JQI|A Chain A, Crystal Structure Of Rat Short Chain Acyl-Coa Dehydrogenase Complexed With Acetoacetyl-Coa Length = 388 Back     alignment and structure 
Iteration: 1

 Score =  321 bits (822), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 178/205 (86%)
Query: 48  DLGAASTVAKQDSNGWTLNGTKAWITNGYESEATVVFATTDKSKKHKGISAFIVDKPTKG 107
           D GAAST A+++ + W LNGTKAWITN +E+ ATVVFA+TD+S+++KGISAF+V  PT G
Sbjct: 138 DAGAASTTAREEGDSWVLNGTKAWITNSWEASATVVFASTDRSRQNKGISAFLVPMPTPG 197
Query: 108 LSLGKKEDKLGINASSTCSLIFEDCSIPAENLLGEPGMGFKIAMMTLDAGRIGIASQALG 167
           L+LGKKEDKLGI ASST +LIFEDC IP ENLLGEPGMGFKIAM TLD GRIGIASQALG
Sbjct: 198 LTLGKKEDKLGIRASSTANLIFEDCRIPKENLLGEPGMGFKIAMQTLDMGRIGIASQALG 257
Query: 168 IAQASLDCAVEYASKRTAFGQPIIKLQSIQQKIADMSLKLESARLLTWRAAYLKDNKQPF 227
           IAQASLDCAV+YA  R AFG P+ KLQ+IQ K+ADM+L LESARLLTWRAA LKDNK+PF
Sbjct: 258 IAQASLDCAVKYAENRHAFGAPLTKLQNIQFKLADMALALESARLLTWRAAMLKDNKKPF 317
Query: 228 TKEAAMAKLAASETATYNAHQAIQI 252
           TKE+AMAKLAASE AT  +HQAIQI
Sbjct: 318 TKESAMAKLAASEAATAISHQAIQI 342
>pdb|2VIG|A Chain A, Crystal Structure Of Human Short-Chain Acyl Coa Dehydrogenase Length = 391 Back     alignment and structure
>pdb|1BUC|A Chain A, Three-Dimensional Structure Of Butyryl-Coa Dehydrogenase From Megasphaera Elsdenii Length = 383 Back     alignment and structure
>pdb|1UKW|A Chain A, Crystal Structure Of Medium-Chain Acyl-Coa Dehydrogenase From Thermus Thermophilus Hb8 Length = 379 Back     alignment and structure
>pdb|2JIF|A Chain A, Structure Of Human Short-Branched Chain Acyl-Coa Dehydrogenase (Acadsb) Length = 404 Back     alignment and structure
>pdb|3PFD|A Chain A, Crystal Structure Of An Acyl-Coa Dehydrogenase From Mycobacterium Thermoresistibile Bound To Reduced Flavin Adenine Dinucleotide Solved By Combined Iodide Ion Sad Mr Length = 393 Back     alignment and structure
>pdb|1WS9|A Chain A, Crystal Structure Of Project Id Tt0172 From Thermus Thermophilus Hb8 Length = 387 Back     alignment and structure
>pdb|2DVL|A Chain A, Crystal Structure Of Project Tt0160 From Thermus Thermophilus Hb8 Length = 372 Back     alignment and structure
>pdb|1IVH|A Chain A, Structure Of Human Isovaleryl-coa Dehydrogenase At 2.6 Angstroms Resolution: Structural Basis For Substrate Specificity Length = 394 Back     alignment and structure
>pdb|1RX0|A Chain A, Crystal Structure Of Isobutyryl-Coa Dehydrogenase Complexed With SubstrateLIGAND. Length = 393 Back     alignment and structure
>pdb|3NF4|A Chain A, Crystal Structure Of Acyl-Coa Dehydrogenase From Mycobacterium Thermoresistibile Bound To Flavin Adenine Dinucleotide Length = 387 Back     alignment and structure
>pdb|1UDY|A Chain A, Medium-Chain Acyl-Coa Dehydrogenase With 3-Thiaoctanoyl-Coa Length = 396 Back     alignment and structure
>pdb|3MDD|A Chain A, Crystal Structures Of Medium Chain Acyl-Coa Dehydrogenase From Pig Liver Mitochondria With And Without Substrate Length = 385 Back     alignment and structure
>pdb|2A1T|A Chain A, Structure Of The Human Mcad:etf E165betaa Complex Length = 421 Back     alignment and structure
>pdb|1EGE|A Chain A, Structure Of T255e, E376g Mutant Of Human Medium Chain Acyl- Coa Dehydrogenase Length = 396 Back     alignment and structure
>pdb|1EGD|A Chain A, Structure Of T255e, E376g Mutant Of Human Medium Chain Acyl- Coa Dehydrogenase Length = 396 Back     alignment and structure
>pdb|2Z1Q|A Chain A, Crystal Structure Of Acyl Coa Dehydrogenase Length = 577 Back     alignment and structure
>pdb|3MPI|A Chain A, Structure Of The Glutaryl-Coenzyme A Dehydrogenase Glutaryl-Coa Complex Length = 397 Back     alignment and structure
>pdb|2PG0|A Chain A, Crystal Structure Of Acyl-Coa Dehydrogenase From Geobacillus Kaustophilus Length = 385 Back     alignment and structure
>pdb|2UXW|A Chain A, Crystal Structure Of Human Very Long Chain Acyl-coa Dehydrogenase (acadvl) Length = 607 Back     alignment and structure
>pdb|3B96|A Chain A, Structural Basis For Substrate Fatty-Acyl Chain Specificity: Crystal Structure Of Human Very-Long-Chain Acyl-Coa Dehydrogenase Length = 587 Back     alignment and structure
>pdb|3OIB|A Chain A, Crystal Structure Of A Putative Acyl-Coa Dehydrogenase From Mycobacterium Smegmatis, Iodide Soak Length = 403 Back     alignment and structure
>pdb|3OWA|A Chain A, Crystal Structure Of Acyl-Coa Dehydrogenase Complexed With Fad From Bacillus Anthracis Length = 597 Back     alignment and structure
>pdb|3R7K|A Chain A, Crystal Structure Of A Probable Acyl Coa Dehydrogenase From Mycobacterium Abscessus Atcc 19977 DSM 44196 Length = 403 Back     alignment and structure
>pdb|3SWO|A Chain A, Crystal Structure Of A Glutaryl-Coa Dehydrogenase From Mycobacterium Smegmatis In Complex With Fadh2 Length = 399 Back     alignment and structure
>pdb|3SF6|A Chain A, Crystal Structure Of Glutaryl-Coa Dehydrogenase From Mycobacterium Smegmatis Length = 403 Back     alignment and structure
>pdb|3D6B|A Chain A, 2.2 A Crystal Structure Of Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei Length = 395 Back     alignment and structure
>pdb|3EOM|A Chain A, 2.4 A Crystal Structure Of Native Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei Length = 396 Back     alignment and structure
>pdb|3GQT|A Chain A, Crystal Structure Of Glutaryl-Coa Dehydrogenase From Burkholderia Pseudomallei With Fragment (1,4-Dimethyl-1,2,3,4- Tetrahydroquinoxalin-6-Yl)methylamine Length = 399 Back     alignment and structure
>pdb|2EBA|A Chain A, Crystal Structure Of The Putative Glutaryl-coa Dehydrogenase From Thermus Thermophilus Length = 385 Back     alignment and structure
>pdb|1SIR|A Chain A, The Crystal Structure And Mechanism Of Human Glutaryl-Coa Dehydrogenase Length = 394 Back     alignment and structure
>pdb|1SIQ|A Chain A, The Crystal Structure And Mechanism Of Human Glutaryl-Coa Dehydrogenase Length = 392 Back     alignment and structure
>pdb|2R0M|A Chain A, The Effect Of A Glu370asp Mutation In Glutaryl-Coa Dehydrogenase On Proton Transfer To The Dienolate Intermediate Length = 394 Back     alignment and structure
>pdb|2IX5|A Chain A, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 In Complex With Acetoacetyl-Coa Length = 436 Back     alignment and structure
>pdb|2IX6|A Chain A, Short Chain Specific Acyl-Coa Oxidase From Arabidopsis Thaliana, Acx4 Length = 449 Back     alignment and structure
>pdb|4HR3|A Chain A, Structure Of A Putative Acyl-Coa Dehydrogenase From Mycobacterium Abscessus Length = 415 Back     alignment and structure
>pdb|2WBI|A Chain A, Crystal Structure Of Human Acyl-Coa Dehydrogenase 11 Length = 428 Back     alignment and structure
>pdb|3DJL|A Chain A, Crystal Structure Of Alkylation Response Protein E. Coli Aidb Length = 541 Back     alignment and structure
>pdb|3M9V|A Chain A, X-Ray Structure Of A Kijd3 In Complex With Dtdp Length = 439 Back     alignment and structure
>pdb|2REH|A Chain A, Mechanistic And Structural Analyses Of The Roles Of Arg409 And Asp402 In The Reaction Of The Flavoprotein Nitroalkane Oxidase Length = 439 Back     alignment and structure
>pdb|3D9G|A Chain A, Nitroalkane Oxidase: Wild Type Crystallized In A Trapped State Forming A Cyanoadduct With Fad Length = 438 Back     alignment and structure
>pdb|2C12|A Chain A, Crystal Structure Of Nitroalkane Oxidase In Complex With Spermine, A Competitive Inhibitor Length = 439 Back     alignment and structure
>pdb|2ZAF|A Chain A, Mechanistic And Structural Analyses Of The Roles Of Arg409 And Asp402 In The Reaction Of The Flavoprotein Nitroalkane Oxidase Length = 439 Back     alignment and structure
>pdb|3D9D|A Chain A, Nitroalkane Oxidase: Mutant D402n Crystallized With 1-Nitrohexane Length = 438 Back     alignment and structure
>pdb|3D9F|A Chain A, Nitroalkane Oxidase: Active Site Mutant S276a Crystallized With 1- Nitrohexane Length = 438 Back     alignment and structure
>pdb|3MKH|A Chain A, Podospora Anserina Nitroalkane Oxidase Length = 438 Back     alignment and structure
>pdb|2C0U|A Chain A, Crystal Structure Of A Covalent Complex Of Nitroalkane Oxidase Trapped During Substrate Turnover Length = 439 Back     alignment and structure
>pdb|1R2J|A Chain A, Fkbi For Biosynthesis Of Methoxymalonyl Extender Unit Of Fk520 Polyketide Immunosuppresant Length = 366 Back     alignment and structure
>pdb|3MXL|A Chain A, Crystal Structure Of Nitrososynthase From Micromonospora Carbonacea Var. Africana Length = 395 Back     alignment and structure
>pdb|4DOY|A Chain A, Crystal Structure Of Dibenzothiophene Desulfurization Enzyme C Length = 437 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query260
2vig_A391 Short-chain specific acyl-COA dehydrogenase,; fatt 1e-127
2vig_A 391 Short-chain specific acyl-COA dehydrogenase,; fatt 7e-18
2jif_A404 Short/branched chain specific acyl-COA dehydrogen; 1e-126
2jif_A 404 Short/branched chain specific acyl-COA dehydrogen; 8e-18
1buc_A383 Butyryl-COA dehydrogenase; acyl-COA dehydrogenase 1e-124
1buc_A 383 Butyryl-COA dehydrogenase; acyl-COA dehydrogenase 9e-18
1ukw_A379 Acyl-COA dehydrogenase; oxidoreductase, riken stru 1e-124
1ukw_A 379 Acyl-COA dehydrogenase; oxidoreductase, riken stru 1e-17
2d29_A387 Acyl-COA dehydrogenase; structural genomics, NPPSF 1e-123
2d29_A 387 Acyl-COA dehydrogenase; structural genomics, NPPSF 1e-17
3pfd_A393 Acyl-COA dehydrogenase; structural genomics, seatt 1e-121
3pfd_A 393 Acyl-COA dehydrogenase; structural genomics, seatt 2e-17
3nf4_A387 Acyl-COA dehydrogenase; seattle structural genomic 1e-120
3nf4_A 387 Acyl-COA dehydrogenase; seattle structural genomic 6e-17
2dvl_A372 Acyl-COA dehydrogenase; structural genomics, NPPSF 1e-120
2dvl_A 372 Acyl-COA dehydrogenase; structural genomics, NPPSF 2e-17
1egd_A396 Medium chain acyl-COA dehydrogenase; flavoprotein, 1e-119
1egd_A 396 Medium chain acyl-COA dehydrogenase; flavoprotein, 2e-17
1ivh_A394 Isovaleryl-COA dehydrogenase; oxidoreductase, acyl 1e-119
1ivh_A 394 Isovaleryl-COA dehydrogenase; oxidoreductase, acyl 6e-16
1rx0_A393 Acyl-COA dehydrogenase family member 8, mitochondr 1e-117
1rx0_A 393 Acyl-COA dehydrogenase family member 8, mitochondr 2e-17
3mpi_A397 Glutaryl-COA dehydrogenase; alpha-beta fold, oxido 1e-116
3mpi_A 397 Glutaryl-COA dehydrogenase; alpha-beta fold, oxido 6e-16
3m9v_A439 FAD-dependent oxidoreductase; KIJD3, fatty acyl-CO 1e-109
3m9v_A 439 FAD-dependent oxidoreductase; KIJD3, fatty acyl-CO 5e-14
1r2j_A366 Protein FKBI; polyketide synthase, polyketide, acy 1e-109
1r2j_A 366 Protein FKBI; polyketide synthase, polyketide, acy 2e-13
3mxl_A395 Nitrososynthase; flavin monooxygenase, acyl-COA de 1e-105
3mxl_A 395 Nitrososynthase; flavin monooxygenase, acyl-COA de 3e-15
2z1q_A 577 Acyl-COA dehydrogenase; FAD, structural genomics, 1e-105
2z1q_A 577 Acyl-COA dehydrogenase; FAD, structural genomics, 3e-15
3mkh_A438 Nitroalkane oxidase; oxidoreductase flavoenzyme, a 1e-103
3mkh_A 438 Nitroalkane oxidase; oxidoreductase flavoenzyme, a 2e-14
3owa_A 597 Acyl-COA dehydrogenase; structural genomics, cente 1e-103
3owa_A 597 Acyl-COA dehydrogenase; structural genomics, cente 1e-14
2uxw_A 607 VERY-long-chain specific acyl-COA dehydrogenase; f 1e-102
2uxw_A 607 VERY-long-chain specific acyl-COA dehydrogenase; f 3e-12
2c12_A439 Nitroalkane oxidase; oxidoreductase, flavoenzyme, 3e-97
2c12_A 439 Nitroalkane oxidase; oxidoreductase, flavoenzyme, 6e-13
3r7k_A403 Probable acyl COA dehydrogenase; ssgcid, structura 2e-96
3r7k_A 403 Probable acyl COA dehydrogenase; ssgcid, structura 6e-14
3p4t_A403 Putative acyl-COA dehydrogenase; ssgcid, structura 3e-96
3p4t_A 403 Putative acyl-COA dehydrogenase; ssgcid, structura 5e-14
2pg0_A385 Acyl-COA dehydrogenase; GK1316, geobacillus kausto 1e-94
2pg0_A 385 Acyl-COA dehydrogenase; GK1316, geobacillus kausto 4e-13
3ii9_A396 Glutaryl-COA dehydrogenase; slipchip, microfluidic 8e-85
3ii9_A 396 Glutaryl-COA dehydrogenase; slipchip, microfluidic 7e-13
3swo_A399 Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA d 3e-83
3swo_A 399 Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA d 1e-11
3sf6_A403 Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SB 3e-80
3sf6_A 403 Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SB 1e-09
2ix5_A436 Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, 3e-80
2ix5_A 436 Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, 2e-11
2eba_A385 Putative glutaryl-COA dehydrogenase; thermus therm 2e-79
2eba_A 385 Putative glutaryl-COA dehydrogenase; thermus therm 2e-12
1siq_A392 GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrog 2e-72
1siq_A 392 GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrog 2e-10
2wbi_A428 Acyl-COA dehydrogenase family member 11; human, ph 6e-47
2ddh_A 661 Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundl 6e-45
3hwc_A 515 Chlorophenol-4-monooxygenase component 2; beta bar 6e-41
1w07_A 659 Acyl-COA oxidase; oxidoreductase, peroxisomal beta 7e-41
2jbr_A422 P-hydroxyphenylacetate hydroxylase C2 oxygenase C; 4e-36
3djl_A 541 Protein AIDB; alpha helix, beta-barrel, FAD, flavo 3e-33
2yyk_A481 4-hydroxyphenylacetate-3-hydroxylase; structurome, 1e-32
1u8v_A490 Gamma-aminobutyrate metabolism dehydratase/isomera 7e-28
2rfq_A394 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1 6e-27
2or0_A414 Hydroxylase; APC7385, rhodococcus SP. RHA1, struct 4e-18
>2vig_A Short-chain specific acyl-COA dehydrogenase,; fatty acid metabolism, FAD, polymorphism, flavoprotein, mitochondrion, disease mutation; HET: FAD COS; 1.9A {Homo sapiens} PDB: 1jqi_A* Length = 391 Back     alignment and structure
 Score =  364 bits (936), Expect = e-127
 Identities = 147/205 (71%), Positives = 169/205 (82%)

Query: 48  DLGAASTVAKQDSNGWTLNGTKAWITNGYESEATVVFATTDKSKKHKGISAFIVDKPTKG 107
           D GAAST A+ + + W LNGTKAWITN +E+ A VVFA+TD++ ++K ISAF+V  PT G
Sbjct: 134 DAGAASTTARAEGDSWVLNGTKAWITNAWEASAAVVFASTDRALQNKSISAFLVPMPTPG 193

Query: 108 LSLGKKEDKLGINASSTCSLIFEDCSIPAENLLGEPGMGFKIAMMTLDAGRIGIASQALG 167
           L+LGKKEDKLGI  SST +LIFEDC IP +++LGEPGMGFKIAM TLD GRIGIASQALG
Sbjct: 194 LTLGKKEDKLGIRGSSTANLIFEDCRIPKDSILGEPGMGFKIAMQTLDMGRIGIASQALG 253

Query: 168 IAQASLDCAVEYASKRTAFGQPIIKLQSIQQKIADMSLKLESARLLTWRAAYLKDNKQPF 227
           IAQ +LDCAV YA  R AFG P+ KLQ IQ K+ADM+L LESARLLTWRAA LKDNK+PF
Sbjct: 254 IAQTALDCAVNYAENRMAFGAPLTKLQVIQFKLADMALALESARLLTWRAAMLKDNKKPF 313

Query: 228 TKEAAMAKLAASETATYNAHQAIQI 252
            KEAAMAKLAASE AT  +HQAIQI
Sbjct: 314 IKEAAMAKLAASEAATAISHQAIQI 338
>2vig_A Short-chain specific acyl-COA dehydrogenase,; fatty acid metabolism, FAD, polymorphism, flavoprotein, mitochondrion, disease mutation; HET: FAD COS; 1.9A {Homo sapiens} PDB: 1jqi_A* Length = 391 Back     alignment and structure
>2jif_A Short/branched chain specific acyl-COA dehydrogen; mitochondrion, oxidoreductase, transit peptide, fatty acid metabolism, FAD, flavoprotein; HET: FAD COS; 2.0A {Homo sapiens} Length = 404 Back     alignment and structure
>2jif_A Short/branched chain specific acyl-COA dehydrogen; mitochondrion, oxidoreductase, transit peptide, fatty acid metabolism, FAD, flavoprotein; HET: FAD COS; 2.0A {Homo sapiens} Length = 404 Back     alignment and structure
>1buc_A Butyryl-COA dehydrogenase; acyl-COA dehydrogenase short-chain acyl-COA dehydrogenase, flavoprotein, oxidoreductase; HET: CAA FAD; 2.50A {Megasphaera elsdenii} SCOP: a.29.3.1 e.6.1.1 Length = 383 Back     alignment and structure
>1buc_A Butyryl-COA dehydrogenase; acyl-COA dehydrogenase short-chain acyl-COA dehydrogenase, flavoprotein, oxidoreductase; HET: CAA FAD; 2.50A {Megasphaera elsdenii} SCOP: a.29.3.1 e.6.1.1 Length = 383 Back     alignment and structure
>1ukw_A Acyl-COA dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: FAD; 2.40A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 Length = 379 Back     alignment and structure
>1ukw_A Acyl-COA dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: FAD; 2.40A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 Length = 379 Back     alignment and structure
>2d29_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: FAD; 1.65A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 PDB: 1ws9_A 2cx9_A* Length = 387 Back     alignment and structure
>2d29_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: FAD; 1.65A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 PDB: 1ws9_A 2cx9_A* Length = 387 Back     alignment and structure
>3pfd_A Acyl-COA dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: FDA; 2.10A {Mycobacterium thermoresistibile} Length = 393 Back     alignment and structure
>3pfd_A Acyl-COA dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: FDA; 2.10A {Mycobacterium thermoresistibile} Length = 393 Back     alignment and structure
>3nf4_A Acyl-COA dehydrogenase; seattle structural genomics center for infectious disease, S FAD, FADH, tuberculosis, oxidoredu; HET: FAD; 2.35A {Mycobacterium thermoresistibile} Length = 387 Back     alignment and structure
>3nf4_A Acyl-COA dehydrogenase; seattle structural genomics center for infectious disease, S FAD, FADH, tuberculosis, oxidoredu; HET: FAD; 2.35A {Mycobacterium thermoresistibile} Length = 387 Back     alignment and structure
>2dvl_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project on protein STR and functional analyses; HET: FAD; 2.50A {Thermus thermophilus} Length = 372 Back     alignment and structure
>2dvl_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project on protein STR and functional analyses; HET: FAD; 2.50A {Thermus thermophilus} Length = 372 Back     alignment and structure
>1egd_A Medium chain acyl-COA dehydrogenase; flavoprotein, electron transfer; HET: FAD; 2.40A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 1egc_A* 1ege_A* 1t9g_A* 2a1t_A* 1udy_A* 3mdd_A* 3mde_A* Length = 396 Back     alignment and structure
>1egd_A Medium chain acyl-COA dehydrogenase; flavoprotein, electron transfer; HET: FAD; 2.40A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 1egc_A* 1ege_A* 1t9g_A* 2a1t_A* 1udy_A* 3mdd_A* 3mde_A* Length = 396 Back     alignment and structure
>1ivh_A Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA dehydrogenase, flavoprotein, isovaleric acidemia; HET: FAD COS; 2.60A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 394 Back     alignment and structure
>1ivh_A Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA dehydrogenase, flavoprotein, isovaleric acidemia; HET: FAD COS; 2.60A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 394 Back     alignment and structure
>1rx0_A Acyl-COA dehydrogenase family member 8, mitochondrial; flavoprotein, coenzyme A, oxidoreductase; HET: FAD 2MC; 1.77A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 393 Back     alignment and structure
>1rx0_A Acyl-COA dehydrogenase family member 8, mitochondrial; flavoprotein, coenzyme A, oxidoreductase; HET: FAD 2MC; 1.77A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Length = 393 Back     alignment and structure
>3mpi_A Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreductase; HET: FAD GRA; 2.05A {Desulfococcus multivorans} PDB: 3mpj_A* Length = 397 Back     alignment and structure
>3mpi_A Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreductase; HET: FAD GRA; 2.05A {Desulfococcus multivorans} PDB: 3mpj_A* Length = 397 Back     alignment and structure
>3m9v_A FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA dehydrogenase family, kijanose, kijani FAD, flavoprotein; HET: TYD; 2.05A {Actinomadura kijaniata} Length = 439 Back     alignment and structure
>3m9v_A FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA dehydrogenase family, kijanose, kijani FAD, flavoprotein; HET: TYD; 2.05A {Actinomadura kijaniata} Length = 439 Back     alignment and structure
>1r2j_A Protein FKBI; polyketide synthase, polyketide, acyl-COA dehydrogenase, , aldehyde dehydrogenase, oxidoreductase; HET: FAD; 2.10A {Streptomyces hygroscopicus} SCOP: a.29.3.1 e.6.1.1 Length = 366 Back     alignment and structure
>1r2j_A Protein FKBI; polyketide synthase, polyketide, acyl-COA dehydrogenase, , aldehyde dehydrogenase, oxidoreductase; HET: FAD; 2.10A {Streptomyces hygroscopicus} SCOP: a.29.3.1 e.6.1.1 Length = 366 Back     alignment and structure
>3mxl_A Nitrososynthase; flavin monooxygenase, acyl-COA dehydrogenas oxidoreductase; 3.15A {Micromonospora carbonacea} Length = 395 Back     alignment and structure
>3mxl_A Nitrososynthase; flavin monooxygenase, acyl-COA dehydrogenas oxidoreductase; 3.15A {Micromonospora carbonacea} Length = 395 Back     alignment and structure
>2z1q_A Acyl-COA dehydrogenase; FAD, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: FAD; 2.30A {Thermus thermophilus} Length = 577 Back     alignment and structure
>2z1q_A Acyl-COA dehydrogenase; FAD, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: FAD; 2.30A {Thermus thermophilus} Length = 577 Back     alignment and structure
>3mkh_A Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-COA dehydrogen flavoprotein, oxidoreductase; HET: FAD; 2.00A {Podospora anserina} Length = 438 Back     alignment and structure
>3mkh_A Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-COA dehydrogen flavoprotein, oxidoreductase; HET: FAD; 2.00A {Podospora anserina} Length = 438 Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Length = 597 Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Length = 597 Back     alignment and structure
>2uxw_A VERY-long-chain specific acyl-COA dehydrogenase; fatty acid metabolism, transit peptide, disease mutation, LI metabolism, coenzyme A dehydrogenase; HET: FAD TH3; 1.45A {Homo sapiens} PDB: 3b96_A* Length = 607 Back     alignment and structure
>2uxw_A VERY-long-chain specific acyl-COA dehydrogenase; fatty acid metabolism, transit peptide, disease mutation, LI metabolism, coenzyme A dehydrogenase; HET: FAD TH3; 1.45A {Homo sapiens} PDB: 3b96_A* Length = 607 Back     alignment and structure
>2c12_A Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl-COA dehydrogenase, long cell EDGE, FAD, inhibitor, flavoprotein; HET: SPM FAD PE4; 2.07A {Fusarium oxysporum} SCOP: a.29.3.1 e.6.1.1 PDB: 2c0u_A* 2zaf_A* 2reh_A* 3d9g_A* 3d9f_A* 3d9d_A* 3d9e_A* 3fcj_A* Length = 439 Back     alignment and structure
>2c12_A Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl-COA dehydrogenase, long cell EDGE, FAD, inhibitor, flavoprotein; HET: SPM FAD PE4; 2.07A {Fusarium oxysporum} SCOP: a.29.3.1 e.6.1.1 PDB: 2c0u_A* 2zaf_A* 2reh_A* 3d9g_A* 3d9f_A* 3d9d_A* 3d9e_A* 3fcj_A* Length = 439 Back     alignment and structure
>3r7k_A Probable acyl COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FDA; 2.50A {Mycobacterium abscessus} Length = 403 Back     alignment and structure
>3r7k_A Probable acyl COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FDA; 2.50A {Mycobacterium abscessus} Length = 403 Back     alignment and structure
>3p4t_A Putative acyl-COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FAO; 1.70A {Mycobacterium smegmatis} PDB: 3oib_A* Length = 403 Back     alignment and structure
>3p4t_A Putative acyl-COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FAO; 1.70A {Mycobacterium smegmatis} PDB: 3oib_A* Length = 403 Back     alignment and structure
>2pg0_A Acyl-COA dehydrogenase; GK1316, geobacillus kaustophilus HTA structural genomics, PSI, protein structure initiative; HET: FAD; 1.80A {Geobacillus kaustophilus} Length = 385 Back     alignment and structure
>2pg0_A Acyl-COA dehydrogenase; GK1316, geobacillus kaustophilus HTA structural genomics, PSI, protein structure initiative; HET: FAD; 1.80A {Geobacillus kaustophilus} Length = 385 Back     alignment and structure
>3ii9_A Glutaryl-COA dehydrogenase; slipchip, microfluidics, screening, optimization, protein crystallization, structural genomics; HET: PGE PG4; 1.74A {Burkholderia pseudomallei 1710B} PDB: 3eon_A* 3eom_A* 3gqt_A* 3gnc_A* 3d6b_A Length = 396 Back     alignment and structure
>3ii9_A Glutaryl-COA dehydrogenase; slipchip, microfluidics, screening, optimization, protein crystallization, structural genomics; HET: PGE PG4; 1.74A {Burkholderia pseudomallei 1710B} PDB: 3eon_A* 3eom_A* 3gqt_A* 3gnc_A* 3d6b_A Length = 396 Back     alignment and structure
>3swo_A Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA dehdrogenase, mycobacerium smegmatis, S genomics; HET: FDA; 1.45A {Mycobacterium smegmatis} Length = 399 Back     alignment and structure
>3swo_A Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA dehdrogenase, mycobacerium smegmatis, S genomics; HET: FDA; 1.45A {Mycobacterium smegmatis} Length = 399 Back     alignment and structure
>3sf6_A Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; HET: FDA; 1.70A {Mycobacterium smegmatis} Length = 403 Back     alignment and structure
>3sf6_A Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; HET: FDA; 1.70A {Mycobacterium smegmatis} Length = 403 Back     alignment and structure
>2ix5_A Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flavin, peroxisome, glyoxysome, fatty acid metabo lipid metabolism, acyl-COA oxidase; HET: CAA FAD; 2.7A {Arabidopsis thaliana} PDB: 2ix6_A* Length = 436 Back     alignment and structure
>2ix5_A Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flavin, peroxisome, glyoxysome, fatty acid metabo lipid metabolism, acyl-COA oxidase; HET: CAA FAD; 2.7A {Arabidopsis thaliana} PDB: 2ix6_A* Length = 436 Back     alignment and structure
>2eba_A Putative glutaryl-COA dehydrogenase; thermus thermophilius, FAD, STRU genomics, NPPSFA; HET: FAD; 2.21A {Thermus thermophilus} Length = 385 Back     alignment and structure
>2eba_A Putative glutaryl-COA dehydrogenase; thermus thermophilius, FAD, STRU genomics, NPPSFA; HET: FAD; 2.21A {Thermus thermophilus} Length = 385 Back     alignment and structure
>1siq_A GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase, decarboxylation, flavin protein, oxidoreductase; HET: FAD; 2.10A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 2r0n_A* 1sir_A* 2r0m_A* Length = 392 Back     alignment and structure
>1siq_A GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase, decarboxylation, flavin protein, oxidoreductase; HET: FAD; 2.10A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 2r0n_A* 1sir_A* 2r0m_A* Length = 392 Back     alignment and structure
>2wbi_A Acyl-COA dehydrogenase family member 11; human, phosphoprotein, oxidoreducta; HET: FAD; 2.80A {Homo sapiens} Length = 428 Back     alignment and structure
>2ddh_A Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, oxidoreductase; HET: FAD HXD; 2.07A {Rattus norvegicus} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 1is2_A* Length = 661 Back     alignment and structure
>3hwc_A Chlorophenol-4-monooxygenase component 2; beta barrel, helix bundle, oxidoreductase; 2.50A {Burkholderia cepacia} Length = 515 Back     alignment and structure
>1w07_A Acyl-COA oxidase; oxidoreductase, peroxisomal beta-oxidation, FAD cofactor; HET: FAD; 2.0A {Arabidopsis thaliana} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 2fon_A* Length = 659 Back     alignment and structure
>2jbr_A P-hydroxyphenylacetate hydroxylase C2 oxygenase C; flavoenzyme hydroxylase, oxidoreductase; 2.3A {Acinetobacter baumannii} PDB: 2jbs_A* 2jbt_A* Length = 422 Back     alignment and structure
>3djl_A Protein AIDB; alpha helix, beta-barrel, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.70A {Escherichia coli} PDB: 3u33_A* Length = 541 Back     alignment and structure
>2yyk_A 4-hydroxyphenylacetate-3-hydroxylase; structurome, riken spring-8 center, oxygnase component, 4- hydroxyphenylacetate 3-monooxygenase; 1.60A {Thermus thermophilus} PDB: 2yyl_A* 2yym_A* 2yyi_A* 2yyg_A* 2yyj_A* Length = 481 Back     alignment and structure
>1u8v_A Gamma-aminobutyrate metabolism dehydratase/isomerase; ALFA-helixes, beta-strands, lyase; HET: FAD; 1.60A {Clostridium aminobutyricum} SCOP: a.29.3.1 e.6.1.1 Length = 490 Back     alignment and structure
>2rfq_A 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1, structural genomics protein structure initiative, midwest center for structural genomics, MCSG; HET: 1PS; 1.65A {Rhodococcus SP} PDB: 3aff_A 3afe_A Length = 394 Back     alignment and structure
>2or0_A Hydroxylase; APC7385, rhodococcus SP. RHA1, structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 2.10A {Rhodococcus SP} Length = 414 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query260
3pfd_A393 Acyl-COA dehydrogenase; structural genomics, seatt 100.0
3r7k_A403 Probable acyl COA dehydrogenase; ssgcid, structura 100.0
2d29_A387 Acyl-COA dehydrogenase; structural genomics, NPPSF 100.0
2vig_A391 Short-chain specific acyl-COA dehydrogenase,; fatt 100.0
2jif_A404 Short/branched chain specific acyl-COA dehydrogen; 100.0
1ukw_A379 Acyl-COA dehydrogenase; oxidoreductase, riken stru 100.0
3p4t_A403 Putative acyl-COA dehydrogenase; ssgcid, structura 100.0
2pg0_A385 Acyl-COA dehydrogenase; GK1316, geobacillus kausto 100.0
1egd_A396 Medium chain acyl-COA dehydrogenase; flavoprotein, 100.0
3nf4_A387 Acyl-COA dehydrogenase; seattle structural genomic 100.0
1buc_A383 Butyryl-COA dehydrogenase; acyl-COA dehydrogenase 100.0
2dvl_A372 Acyl-COA dehydrogenase; structural genomics, NPPSF 100.0
1ivh_A394 Isovaleryl-COA dehydrogenase; oxidoreductase, acyl 100.0
3ii9_A396 Glutaryl-COA dehydrogenase; slipchip, microfluidic 100.0
1rx0_A393 Acyl-COA dehydrogenase family member 8, mitochondr 100.0
3mpi_A397 Glutaryl-COA dehydrogenase; alpha-beta fold, oxido 100.0
3sf6_A403 Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SB 100.0
3swo_A399 Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA d 100.0
4hr3_A415 Putative acyl-COA dehydrogenase; ssgcid, seattle s 100.0
1r2j_A366 Protein FKBI; polyketide synthase, polyketide, acy 100.0
2eba_A385 Putative glutaryl-COA dehydrogenase; thermus therm 100.0
2ix5_A436 Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, 100.0
3owa_A 597 Acyl-COA dehydrogenase; structural genomics, cente 100.0
1siq_A392 GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrog 100.0
2z1q_A 577 Acyl-COA dehydrogenase; FAD, structural genomics, 100.0
2uxw_A 607 VERY-long-chain specific acyl-COA dehydrogenase; f 100.0
3mkh_A438 Nitroalkane oxidase; oxidoreductase flavoenzyme, a 100.0
2jbr_A422 P-hydroxyphenylacetate hydroxylase C2 oxygenase C; 100.0
2or0_A414 Hydroxylase; APC7385, rhodococcus SP. RHA1, struct 100.0
2rfq_A394 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1 100.0
2wbi_A428 Acyl-COA dehydrogenase family member 11; human, ph 100.0
2c12_A439 Nitroalkane oxidase; oxidoreductase, flavoenzyme, 100.0
3m9v_A439 FAD-dependent oxidoreductase; KIJD3, fatty acyl-CO 100.0
3mxl_A395 Nitrososynthase; flavin monooxygenase, acyl-COA de 100.0
3djl_A 541 Protein AIDB; alpha helix, beta-barrel, FAD, flavo 100.0
1w07_A 659 Acyl-COA oxidase; oxidoreductase, peroxisomal beta 100.0
2ddh_A 661 Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundl 100.0
2yyk_A481 4-hydroxyphenylacetate-3-hydroxylase; structurome, 100.0
1u8v_A490 Gamma-aminobutyrate metabolism dehydratase/isomera 100.0
3hwc_A 515 Chlorophenol-4-monooxygenase component 2; beta bar 99.97
4g5e_A 517 2,4,6-trichlorophenol 4-monooxygenase; oxidoreduct 99.97
3owa_A597 Acyl-COA dehydrogenase; structural genomics, cente 93.61
2uxw_A607 VERY-long-chain specific acyl-COA dehydrogenase; f 85.1
>3pfd_A Acyl-COA dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: FDA; 2.10A {Mycobacterium thermoresistibile} Back     alignment and structure
Probab=100.00  E-value=5.8e-51  Score=354.83  Aligned_cols=259  Identities=40%  Similarity=0.638  Sum_probs=243.2

Q ss_pred             CHHHHHHHHHhcccCchhhhhhhcCCCCHHHHHHHHHcCCccccCcccc-------------------------------
Q psy1215           1 MLYKTVRDFTEGELKPIAAKLDREHLYPKEQIKKMGELGLMGVEVPEDL-------------------------------   49 (260)
Q Consensus         1 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~G~~~~~vp~~~-------------------------------   49 (260)
                      ++++.+++|+++.+.|.+.+.|+++.+|.++|++|++.||+++.+|++|                               
T Consensus        25 ~l~~~~r~~~~~~~~~~~~~~d~~~~~~~~~~~~l~~~G~~~~~~P~~~GG~g~~~~~~~~v~eela~~~~~~~~~~~~~  104 (393)
T 3pfd_A           25 ALREAIRALAEKEIAPYAAEVDEKARFPEEALAALNSSGFSAIHVPEEYGGQGADSVATCIVIEEVARVDCSASLIPAVN  104 (393)
T ss_dssp             HHHHHHHHHHHHHTGGGHHHHHHTTCCCHHHHHHHHHHTCSCTTSCGGGTCCCCCHHHHHHHHHHHHTTCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhCchHHHHHhhhCCCCHHHHHHHHHCCCCCCCCChhHCCCCCCHHHHHHHHHHHHhhCchHHHHHHHH
Confidence            3789999999999999998999999999999999999999999999998                               


Q ss_pred             -------------------------------------------cccccEEEEeCCeEEEeeeeeeeeCCCCCcEEEEEEE
Q psy1215          50 -------------------------------------------GAASTVAKQDSNGWTLNGTKAWITNGYESEATVVFAT   86 (260)
Q Consensus        50 -------------------------------------------~~~~~~a~~~~~g~~l~G~k~~~s~~~~a~~~~v~a~   86 (260)
                                                                 .+++|+|++++|||+|||+|.|+||++.||+++|+++
T Consensus       105 ~~~~~~l~~~g~~~q~~~~l~~~~~G~~~~~~a~tEp~~gsd~~~~~t~A~~~~~g~~lnG~K~~~s~~~~Ad~~~v~a~  184 (393)
T 3pfd_A          105 KLGTMGLILRGSEELKKQVLPAVASGEAMASYALSEREAGSDAASMRTRAVADGDDWILNGSKCWITNGGKSTWYTVMAV  184 (393)
T ss_dssp             HHTTHHHHHHCCHHHHHHHHHHHHTTSCCEEEECCBTTBSSCGGGCCCEEEEETTEEEEEEEEEEEETTTTCSEEEEEEE
T ss_pred             HHHHHHHHHhCCHHHHHHHHHHHhCCCceeEEEEcCCCCCCCcccCeeEEEEcCCEEEEeeEEEEecCCcccCEEEEEEE
Confidence                                                       2357899999999999999999999999999999999


Q ss_pred             eCCCCCCCceEEEEEeCCCCCeeecccCCcccCCCCCeeeEEEeceeeCCCCccCCCCccHHHHHHHHhhHhHHHHHHHH
Q psy1215          87 TDKSKKHKGISAFIVDKPTKGLSLGKKEDKLGINASSTCSLIFEDCSIPAENLLGEPGMGFKIAMMTLDAGRIGIASQAL  166 (260)
Q Consensus        87 ~~~~~~~~~~~~~~v~~~~~gv~~~~~~~~~G~~~~~~~~~~f~~v~Vp~~~vl~~~~~g~~~~~~~~~~~r~~~~a~~~  166 (260)
                      ++++++.+++++|+||+++|||++.++|+++|+++++++++.||||+||++++||.++.|+......+...|+.+++.++
T Consensus       185 ~~~~~~~~g~~~flV~~~~pGv~v~~~~~~~G~~~~~~~~v~fddv~Vp~~~~lg~~g~g~~~~~~~l~~~r~~~aa~~~  264 (393)
T 3pfd_A          185 TDPDKGANGISAFMVHKDDEGFTVGPKERKLGIKGSPTTELYFENCRIPGDRIIGEPGTGFKTALATLDHTRPTIGAQAV  264 (393)
T ss_dssp             SCGGGGGGGEEEEEEETTSTTEEEEEECCBSSCTTSCEEEEEEEEEEEEGGGEESSTTCHHHHHHHHHHTTHHHHHHHHH
T ss_pred             eCCCCCCCceEEEEEECCCCCeEecCCCCcccCCCCCceEEEEccEEEcHHHcCCCCCchHHHHHHHHHHHHHHHHHHHH
Confidence            97544456899999999999999999999999999999999999999999999999999999988999999999999999


Q ss_pred             HHHHHHHHHHHHHHhhccccCcccccchhHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCC-chhHHHHHHHHHHHHHHHH
Q psy1215         167 GIAQASLDCAVEYASKRTAFGQPIIKLQSIQQKIADMSLKLESARLLTWRAAYLKDNKQP-FTKEAAMAKLAASETATYN  245 (260)
Q Consensus       167 G~~~~~l~~~~~~~~~r~~~g~~l~~~~~v~~~la~~~~~l~~~~a~~~~~~~~~~~~~~-~~~~~~~~k~~~~~~~~~~  245 (260)
                      |+++++++.+++|+++|.+||+++.++|.+|++|+++..+++++|+++++++..++.+.+ .....+++|.++++.+.++
T Consensus       265 G~a~~al~~a~~~a~~R~~fg~~i~~~q~vq~~la~~~~~~~aar~~~~~aa~~~~~~~~~~~~~~~~aK~~a~~~a~~~  344 (393)
T 3pfd_A          265 GIAQGALDAAIAYTKERKQFGRPVSDNQGVQFMLADMAMKIEAARLMVYSAAARAERGEGDLGFISAASKCFASDVAMEV  344 (393)
T ss_dssp             HHHHHHHHHHHHHHHHCEETTEEGGGSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC----CHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHhcCccCCcchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCcchHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999988765 6678899999999999999


Q ss_pred             HHHHHHccCCCCcC
Q psy1215         246 AHQAIQIPIITKYL  259 (260)
Q Consensus       246 ~~~~~~~~Gg~g~~  259 (260)
                      ++.++|++||.||+
T Consensus       345 ~~~a~q~~Gg~g~~  358 (393)
T 3pfd_A          345 TTDAVQLFGGYGYT  358 (393)
T ss_dssp             HHHHHHHTGGGGGB
T ss_pred             HHHHHHHhchhhcc
Confidence            99999999999986
>3r7k_A Probable acyl COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FDA; 2.50A {Mycobacterium abscessus} Back     alignment and structure
>2d29_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; HET: FAD; 1.65A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 PDB: 1ws9_A 2cx9_A* Back     alignment and structure
>2vig_A Short-chain specific acyl-COA dehydrogenase,; fatty acid metabolism, FAD, polymorphism, flavoprotein, mitochondrion, disease mutation; HET: FAD COS; 1.9A {Homo sapiens} PDB: 1jqi_A* Back     alignment and structure
>2jif_A Short/branched chain specific acyl-COA dehydrogen; mitochondrion, oxidoreductase, transit peptide, fatty acid metabolism, FAD, flavoprotein; HET: FAD COS; 2.0A {Homo sapiens} Back     alignment and structure
>1ukw_A Acyl-COA dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: FAD; 2.40A {Thermus thermophilus} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>3p4t_A Putative acyl-COA dehydrogenase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: FAO; 1.70A {Mycobacterium smegmatis} PDB: 3oib_A* Back     alignment and structure
>2pg0_A Acyl-COA dehydrogenase; GK1316, geobacillus kaustophilus HTA structural genomics, PSI, protein structure initiative; HET: FAD; 1.80A {Geobacillus kaustophilus} Back     alignment and structure
>1egd_A Medium chain acyl-COA dehydrogenase; flavoprotein, electron transfer; HET: FAD; 2.40A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 1egc_A* 1ege_A* 1t9g_A* 2a1t_A* 1udy_A* 3mdd_A* 3mde_A* Back     alignment and structure
>3nf4_A Acyl-COA dehydrogenase; seattle structural genomics center for infectious disease, S FAD, FADH, tuberculosis, oxidoredu; HET: FAD; 2.35A {Mycobacterium thermoresistibile} Back     alignment and structure
>1buc_A Butyryl-COA dehydrogenase; acyl-COA dehydrogenase short-chain acyl-COA dehydrogenase, flavoprotein, oxidoreductase; HET: CAA FAD; 2.50A {Megasphaera elsdenii} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>2dvl_A Acyl-COA dehydrogenase; structural genomics, NPPSFA, national project on protein STR and functional analyses; HET: FAD; 2.50A {Thermus thermophilus} Back     alignment and structure
>1ivh_A Isovaleryl-COA dehydrogenase; oxidoreductase, acyl-COA dehydrogenase, flavoprotein, isovaleric acidemia; HET: FAD COS; 2.60A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>3ii9_A Glutaryl-COA dehydrogenase; slipchip, microfluidics, screening, optimization, protein crystallization, structural genomics; HET: PGE PG4; 1.74A {Burkholderia pseudomallei 1710B} PDB: 3eon_A* 3eom_A* 3gqt_A* 3gnc_A* 3d6b_A Back     alignment and structure
>1rx0_A Acyl-COA dehydrogenase family member 8, mitochondrial; flavoprotein, coenzyme A, oxidoreductase; HET: FAD 2MC; 1.77A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>3mpi_A Glutaryl-COA dehydrogenase; alpha-beta fold, oxidoreductase; HET: FAD GRA; 2.05A {Desulfococcus multivorans} PDB: 3mpj_A* Back     alignment and structure
>3sf6_A Glutaryl-COA dehydrogenase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; HET: FDA; 1.70A {Mycobacterium smegmatis} Back     alignment and structure
>3swo_A Glutaryl-COA dehydrogenase; ssgcid, glutaryl-COA dehdrogenase, mycobacerium smegmatis, S genomics; HET: FDA; 1.45A {Mycobacterium smegmatis} Back     alignment and structure
>4hr3_A Putative acyl-COA dehydrogenase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: FAD; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>1r2j_A Protein FKBI; polyketide synthase, polyketide, acyl-COA dehydrogenase, , aldehyde dehydrogenase, oxidoreductase; HET: FAD; 2.10A {Streptomyces hygroscopicus} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>2eba_A Putative glutaryl-COA dehydrogenase; thermus thermophilius, FAD, STRU genomics, NPPSFA; HET: FAD; 2.21A {Thermus thermophilus} Back     alignment and structure
>2ix5_A Acyl-coenzyme A oxidase 4, peroxisomal; FAD, ACX4, flavin, peroxisome, glyoxysome, fatty acid metabo lipid metabolism, acyl-COA oxidase; HET: CAA FAD; 2.7A {Arabidopsis thaliana} PDB: 2ix6_A* Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Back     alignment and structure
>1siq_A GCD, glutaryl-COA dehydrogenase; acyl-COA dehydrogenase, decarboxylation, flavin protein, oxidoreductase; HET: FAD; 2.10A {Homo sapiens} SCOP: a.29.3.1 e.6.1.1 PDB: 2r0n_A* 1sir_A* 2r0m_A* Back     alignment and structure
>2z1q_A Acyl-COA dehydrogenase; FAD, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: FAD; 2.30A {Thermus thermophilus} Back     alignment and structure
>2uxw_A VERY-long-chain specific acyl-COA dehydrogenase; fatty acid metabolism, transit peptide, disease mutation, LI metabolism, coenzyme A dehydrogenase; HET: FAD TH3; 1.45A {Homo sapiens} PDB: 3b96_A* Back     alignment and structure
>3mkh_A Nitroalkane oxidase; oxidoreductase flavoenzyme, acyl-COA dehydrogen flavoprotein, oxidoreductase; HET: FAD; 2.00A {Podospora anserina} Back     alignment and structure
>2jbr_A P-hydroxyphenylacetate hydroxylase C2 oxygenase C; flavoenzyme hydroxylase, oxidoreductase; 2.3A {Acinetobacter baumannii} PDB: 2jbs_A* 2jbt_A* Back     alignment and structure
>2or0_A Hydroxylase; APC7385, rhodococcus SP. RHA1, structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 2.10A {Rhodococcus SP} Back     alignment and structure
>2rfq_A 3-HSA hydroxylase, oxygenase; rhodococcus SP. RHA1, structural genomics protein structure initiative, midwest center for structural genomics, MCSG; HET: 1PS; 1.65A {Rhodococcus SP} PDB: 3aff_A 3afe_A Back     alignment and structure
>2wbi_A Acyl-COA dehydrogenase family member 11; human, phosphoprotein, oxidoreducta; HET: FAD; 2.80A {Homo sapiens} Back     alignment and structure
>2c12_A Nitroalkane oxidase; oxidoreductase, flavoenzyme, acyl-COA dehydrogenase, long cell EDGE, FAD, inhibitor, flavoprotein; HET: SPM FAD PE4; 2.07A {Fusarium oxysporum} SCOP: a.29.3.1 e.6.1.1 PDB: 2c0u_A* 2zaf_A* 2reh_A* 3d9g_A* 3d9f_A* 3d9d_A* 3d9e_A* 3fcj_A* Back     alignment and structure
>3m9v_A FAD-dependent oxidoreductase; KIJD3, fatty acyl-COA dehydrogenase family, kijanose, kijani FAD, flavoprotein; HET: TYD; 2.05A {Actinomadura kijaniata} Back     alignment and structure
>3mxl_A Nitrososynthase; flavin monooxygenase, acyl-COA dehydrogenas oxidoreductase; 3.15A {Micromonospora carbonacea} Back     alignment and structure
>3djl_A Protein AIDB; alpha helix, beta-barrel, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.70A {Escherichia coli} PDB: 3u33_A* Back     alignment and structure
>1w07_A Acyl-COA oxidase; oxidoreductase, peroxisomal beta-oxidation, FAD cofactor; HET: FAD; 2.0A {Arabidopsis thaliana} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 2fon_A* Back     alignment and structure
>2ddh_A Acyl-COA oxidase; beta barrel, alpha UP-DOWN bundle, oxidoreductase; HET: FAD HXD; 2.07A {Rattus norvegicus} SCOP: a.29.3.2 a.29.3.2 e.6.1.2 PDB: 1is2_A* Back     alignment and structure
>2yyk_A 4-hydroxyphenylacetate-3-hydroxylase; structurome, riken spring-8 center, oxygnase component, 4- hydroxyphenylacetate 3-monooxygenase; 1.60A {Thermus thermophilus} PDB: 2yyl_A* 2yym_A* 2yyi_A* 2yyg_A* 2yyj_A* Back     alignment and structure
>1u8v_A Gamma-aminobutyrate metabolism dehydratase/isomerase; ALFA-helixes, beta-strands, lyase; HET: FAD; 1.60A {Clostridium aminobutyricum} SCOP: a.29.3.1 e.6.1.1 Back     alignment and structure
>3hwc_A Chlorophenol-4-monooxygenase component 2; beta barrel, helix bundle, oxidoreductase; 2.50A {Burkholderia cepacia} Back     alignment and structure
>4g5e_A 2,4,6-trichlorophenol 4-monooxygenase; oxidoreductase; 2.50A {Cupriavidus necator JMP134} Back     alignment and structure
>3owa_A Acyl-COA dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-structure, beta-barrel; HET: MSE FAD 1PE; 1.97A {Bacillus anthracis} Back     alignment and structure
>2uxw_A VERY-long-chain specific acyl-COA dehydrogenase; fatty acid metabolism, transit peptide, disease mutation, LI metabolism, coenzyme A dehydrogenase; HET: FAD TH3; 1.45A {Homo sapiens} PDB: 3b96_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 260
d1rx0a2231 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {H 8e-30
d1rx0a2231 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {H 1e-09
d1buca2232 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM do 3e-28
d1buca2232 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM do 2e-06
d1jqia2231 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM do 9e-28
d1jqia2231 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM do 1e-09
d1ivha2236 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM 4e-26
d1ivha2236 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM 5e-04
d1ukwa2227 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydroge 2e-24
d1ukwa2227 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydroge 4e-06
d3mdea2231 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydroge 8e-24
d3mdea2231 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydroge 1e-05
d2d29a2233 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus 9e-23
d2d29a2233 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus 5e-08
d1ukwa1152 a.29.3.1 (A:259-410) Medium chain acyl-CoA dehydro 2e-22
d2ddha3267 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, 6e-22
d1u8va2275 e.6.1.1 (A:1-275) 4-hydroxybutyryl-CoA dehydratase 1e-20
d1jqia1153 a.29.3.1 (A:235-387) Butyryl-CoA dehydrogenase, C- 1e-20
d2d29a1153 a.29.3.1 (A:235-387) Acyl-CoA dehydrogenase {Therm 2e-20
d1w07a3271 e.6.1.2 (A:2-272) Acyl-coenzyme A oxidase 1, domai 1e-19
d1siqa2236 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH 1e-19
d1siqa2236 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH 1e-05
d1buca1151 a.29.3.1 (A:233-383) Butyryl-CoA dehydrogenase, C- 1e-19
d2c12a2259 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fusarium ox 1e-17
d2c12a2259 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fusarium ox 2e-07
d1w07a1189 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, do 4e-17
d1r2ja2210 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygro 5e-16
d1r2ja2210 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygro 6e-10
d3mdea1154 a.29.3.1 (A:242-395) Medium chain acyl-CoA dehydro 1e-14
d1rx0a1153 a.29.3.1 (A:241-393) Isobutyryl-CoA dehydrogenase 1e-13
d1siqa1154 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GC 1e-13
d1ivha1151 a.29.3.1 (A:242-392) Isovaleryl-CoA dehydrogenase, 1e-13
d2ddha1183 a.29.3.2 (A:278-460) Peroxisomal acyl-CoA oxidase- 8e-12
d1r2ja1153 a.29.3.1 (A:213-365) Protein FkbI {Streptomyces hy 9e-11
d2c12a1170 a.29.3.1 (A:261-430) Nitroalkane oxidase {Fusarium 7e-10
>d1rx0a2 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 231 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Acyl-CoA dehydrogenase NM domain-like
superfamily: Acyl-CoA dehydrogenase NM domain-like
family: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains
domain: Isobutyryl-CoA dehydrogenase
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  110 bits (274), Expect = 8e-30
 Identities = 44/119 (36%), Positives = 64/119 (53%), Gaps = 1/119 (0%)

Query: 24  EHLYPKEQIKKMGELGLMGVEVPEDLGAASTVAKQDSNGWTLNGTKAWITNGYESEATVV 83
           +   P   ++K     L       D  +  T AK+  + + LNG+KA+I+   ES+  VV
Sbjct: 113 KFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVV 172

Query: 84  FATTDKSKKHKGISAFIVDKPTKGLSLGKKEDKLGINASSTCSLIFEDCSIPAENLLGE 142
              T      KGIS  +V+K T GLS GKKE K+G N+  T ++IFEDC++P  N +G 
Sbjct: 173 MCRTG-GPGPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGS 230
>d1rx0a2 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 231 Back     information, alignment and structure
>d1buca2 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM domains {Megasphaera elsdenii [TaxId: 907]} Length = 232 Back     information, alignment and structure
>d1buca2 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM domains {Megasphaera elsdenii [TaxId: 907]} Length = 232 Back     information, alignment and structure
>d1jqia2 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 231 Back     information, alignment and structure
>d1jqia2 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 231 Back     information, alignment and structure
>d1ivha2 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d1ivha2 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d1ukwa2 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydrogenase, NM domains {Thermus thermophilus [TaxId: 274]} Length = 227 Back     information, alignment and structure
>d1ukwa2 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydrogenase, NM domains {Thermus thermophilus [TaxId: 274]} Length = 227 Back     information, alignment and structure
>d3mdea2 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydrogenase, NM domains {Pig (Sus scrofa) [TaxId: 9823]} Length = 231 Back     information, alignment and structure
>d3mdea2 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydrogenase, NM domains {Pig (Sus scrofa) [TaxId: 9823]} Length = 231 Back     information, alignment and structure
>d2d29a2 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 233 Back     information, alignment and structure
>d2d29a2 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 233 Back     information, alignment and structure
>d1ukwa1 a.29.3.1 (A:259-410) Medium chain acyl-CoA dehydrogenase, C-domain {Thermus thermophilus [TaxId: 274]} Length = 152 Back     information, alignment and structure
>d2ddha3 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 267 Back     information, alignment and structure
>d1u8va2 e.6.1.1 (A:1-275) 4-hydroxybutyryl-CoA dehydratase AbfD, NM domains {Clostridium aminobutyricum [TaxId: 33953]} Length = 275 Back     information, alignment and structure
>d1jqia1 a.29.3.1 (A:235-387) Butyryl-CoA dehydrogenase, C-domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 153 Back     information, alignment and structure
>d2d29a1 a.29.3.1 (A:235-387) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 153 Back     information, alignment and structure
>d1w07a3 e.6.1.2 (A:2-272) Acyl-coenzyme A oxidase 1, domains 1 and 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 271 Back     information, alignment and structure
>d1siqa2 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d1siqa2 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure
>d1buca1 a.29.3.1 (A:233-383) Butyryl-CoA dehydrogenase, C-domain {Megasphaera elsdenii [TaxId: 907]} Length = 151 Back     information, alignment and structure
>d2c12a2 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Length = 259 Back     information, alignment and structure
>d2c12a2 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Length = 259 Back     information, alignment and structure
>d1w07a1 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 189 Back     information, alignment and structure
>d1r2ja2 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Length = 210 Back     information, alignment and structure
>d1r2ja2 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Length = 210 Back     information, alignment and structure
>d3mdea1 a.29.3.1 (A:242-395) Medium chain acyl-CoA dehydrogenase, C-domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 154 Back     information, alignment and structure
>d1rx0a1 a.29.3.1 (A:241-393) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure
>d1siqa1 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1ivha1 a.29.3.1 (A:242-392) Isovaleryl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d2ddha1 a.29.3.2 (A:278-460) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 183 Back     information, alignment and structure
>d1r2ja1 a.29.3.1 (A:213-365) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Length = 153 Back     information, alignment and structure
>d2c12a1 a.29.3.1 (A:261-430) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Length = 170 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query260
d1ukwa2227 Medium chain acyl-CoA dehydrogenase, NM domains {T 100.0
d1rx0a2231 Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) 100.0
d1jqia2231 Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus 100.0
d1buca2232 Butyryl-CoA dehydrogenase, NM domains {Megasphaera 99.98
d2d29a2233 Acyl-CoA dehydrogenase {Thermus thermophilus [TaxI 99.97
d3mdea2231 Medium chain acyl-CoA dehydrogenase, NM domains {P 99.97
d1r2ja2210 Protein FkbI {Streptomyces hygroscopicus [TaxId: 1 99.97
d1ivha2236 Isovaleryl-coa dehydrogenase, NM domains {Human (H 99.97
d1siqa2236 Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapie 99.96
d2c12a2259 Nitroalkane oxidase {Fusarium oxysporum [TaxId: 55 99.93
d1siqa1154 Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapie 99.86
d2d29a1153 Acyl-CoA dehydrogenase {Thermus thermophilus [TaxI 99.85
d1ivha1151 Isovaleryl-CoA dehydrogenase, C-domain {Human (Hom 99.85
d1jqia1153 Butyryl-CoA dehydrogenase, C-domain {Rat (Rattus n 99.85
d3mdea1154 Medium chain acyl-CoA dehydrogenase, C-domain {Pig 99.84
d1ukwa1152 Medium chain acyl-CoA dehydrogenase, C-domain {The 99.83
d2c12a1170 Nitroalkane oxidase {Fusarium oxysporum [TaxId: 55 99.83
d1buca1151 Butyryl-CoA dehydrogenase, C-domain {Megasphaera e 99.82
d1rx0a1153 Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) 99.82
d1r2ja1153 Protein FkbI {Streptomyces hygroscopicus [TaxId: 1 99.81
d2ddha3267 Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 { 99.77
d1u8va2275 4-hydroxybutyryl-CoA dehydratase AbfD, NM domains 99.74
d1w07a3271 Acyl-coenzyme A oxidase 1, domains 1 and 2 {Thale 99.7
d1w07a1189 Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale 99.69
d2ddha1183 Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 { 99.63
d1u8va1215 4-hydroxybutyryl-CoA dehydratase AbfD, C-terminal 97.78
>d1ukwa2 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydrogenase, NM domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Acyl-CoA dehydrogenase NM domain-like
superfamily: Acyl-CoA dehydrogenase NM domain-like
family: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains
domain: Medium chain acyl-CoA dehydrogenase, NM domains
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=5.3e-33  Score=222.33  Aligned_cols=143  Identities=39%  Similarity=0.617  Sum_probs=134.0

Q ss_pred             CHHHHHHHHHhcccCchhhhhhhcCCCCHHHHHHHHHcCCccccCcccc-------------------------------
Q psy1215           1 MLYKTVRDFTEGELKPIAAKLDREHLYPKEQIKKMGELGLMGVEVPEDL-------------------------------   49 (260)
Q Consensus         1 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~G~~~~~vp~~~-------------------------------   49 (260)
                      +|++.+++|+++.+.|.+.++|+++.+|+++|++|++.|++++.+|++|                               
T Consensus        11 ~l~~~~r~f~~~~~~p~a~~~d~~~~~p~~~~~~l~~~G~~~~~~P~~~GG~g~~~~~~~~v~e~~~~~~~~~~~~~~~~   90 (227)
T d1ukwa2          11 QLQALARRFAKEVILPVAQEYDEKEEVPWPVIEKLHEVGLLNAIIPEEYGGMGLKMLDEVIVGEELAYACMGIYTIPMAS   90 (227)
T ss_dssp             HHHHHHHHHHHHTTGGGHHHHHHHTCCCHHHHHHHHHTTCTTTTSCGGGTSCCCCHHHHHHHHHHHHHHCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhChHHHHHHHhcCCCCHHHHHHHHhhhhhhhccccccCcccccccccccchhhhcccccccccccccc
Confidence            4789999999999999999999999999999999999999999999998                               


Q ss_pred             -------------------------------------------cccccEEEEeCCeEEEeeeeeeeeCCCCCcEEEEEEE
Q psy1215          50 -------------------------------------------GAASTVAKQDSNGWTLNGTKAWITNGYESEATVVFAT   86 (260)
Q Consensus        50 -------------------------------------------~~~~~~a~~~~~g~~l~G~k~~~s~~~~a~~~~v~a~   86 (260)
                                                                 .+++|+|++++|||+|||+|.||||+..||++++.++
T Consensus        91 ~~~~~~i~~~g~~~qk~~~l~~~~~g~~~~~~a~tE~~~gsd~~~~~t~a~~~~~g~~lnG~K~~vs~~~~Ad~~~v~a~  170 (227)
T d1ukwa2          91 DLGITPVLLAGTEEQKERFLRPLTEKPALAAFALSEPGNGSDAAALKTRAIRQGDHYVLNGTKMWISNGGEAEWVVVFAT  170 (227)
T ss_dssp             HHHHHHHHHHCCHHHHHHHHGGGTSSSCEEEEECCBTTBSSCGGGCCCEEEEETTEEEEEEEEEEEETTTTEEEEEEEEE
T ss_pred             ccchhhhhccCCHHHHHHhccccccccccccccccCCCcCcCCcCceEEEEEECCEEEEEeEEeccCccccchhhccccc
Confidence                                                       4577899999999999999999999999999999999


Q ss_pred             eCCCCCCCceEEEEEeCCCCCeeecccCCcccCCCCCeeeEEEeceeeCCCCccCCC
Q psy1215          87 TDKSKKHKGISAFIVDKPTKGLSLGKKEDKLGINASSTCSLIFEDCSIPAENLLGEP  143 (260)
Q Consensus        87 ~~~~~~~~~~~~~~v~~~~~gv~~~~~~~~~G~~~~~~~~~~f~~v~Vp~~~vl~~~  143 (260)
                      +++..+..++++|+||+++|||++.+.|+++|+|++++++|.|+||+||++++||.+
T Consensus       171 ~~~~~~~~g~~~f~V~~~~~Gv~~~~~~~~~G~r~~~~~~v~f~~v~Vp~~~llGeE  227 (227)
T d1ukwa2         171 VNPELRHKGVVALVVERGTPGFKAIKIHGKMGQRASGTYELVFEDVKVPVENRLGEE  227 (227)
T ss_dssp             SCGGGGGGGEEEEEEETTCTTEEEEECCCCSSCTTSCEEEEEEEEEEEEGGGEESCT
T ss_pred             cCCccCcCCcEEEEEeCCCCceEeccccCcccCCCCceEEEEEeeEEEcHHHccCCC
Confidence            986555568999999999999999999999999999999999999999999999863
>d1rx0a2 e.6.1.1 (A:10-240) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqia2 e.6.1.1 (A:4-234) Butyryl-CoA dehydrogenase, NM domains {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1buca2 e.6.1.1 (A:1-232) Butyryl-CoA dehydrogenase, NM domains {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d2d29a2 e.6.1.1 (A:2-234) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3mdea2 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydrogenase, NM domains {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1r2ja2 e.6.1.1 (A:3-212) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Back     information, alignment and structure
>d1ivha2 e.6.1.1 (A:6-241) Isovaleryl-coa dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1siqa2 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c12a2 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Back     information, alignment and structure
>d1siqa1 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d29a1 a.29.3.1 (A:235-387) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ivha1 a.29.3.1 (A:242-392) Isovaleryl-CoA dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqia1 a.29.3.1 (A:235-387) Butyryl-CoA dehydrogenase, C-domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3mdea1 a.29.3.1 (A:242-395) Medium chain acyl-CoA dehydrogenase, C-domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ukwa1 a.29.3.1 (A:259-410) Medium chain acyl-CoA dehydrogenase, C-domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c12a1 a.29.3.1 (A:261-430) Nitroalkane oxidase {Fusarium oxysporum [TaxId: 5507]} Back     information, alignment and structure
>d1buca1 a.29.3.1 (A:233-383) Butyryl-CoA dehydrogenase, C-domain {Megasphaera elsdenii [TaxId: 907]} Back     information, alignment and structure
>d1rx0a1 a.29.3.1 (A:241-393) Isobutyryl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2ja1 a.29.3.1 (A:213-365) Protein FkbI {Streptomyces hygroscopicus [TaxId: 1912]} Back     information, alignment and structure
>d2ddha3 e.6.1.2 (A:1-267) Peroxisomal acyl-CoA oxidase-II, domains 1 and 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u8va2 e.6.1.1 (A:1-275) 4-hydroxybutyryl-CoA dehydratase AbfD, NM domains {Clostridium aminobutyricum [TaxId: 33953]} Back     information, alignment and structure
>d1w07a3 e.6.1.2 (A:2-272) Acyl-coenzyme A oxidase 1, domains 1 and 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w07a1 a.29.3.2 (A:273-461) Acyl-coenzyme A oxidase 1, domains 3 and 4 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ddha1 a.29.3.2 (A:278-460) Peroxisomal acyl-CoA oxidase-II, domains 3 and 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u8va1 a.29.3.1 (A:276-490) 4-hydroxybutyryl-CoA dehydratase AbfD, C-terminal domain {Clostridium aminobutyricum [TaxId: 33953]} Back     information, alignment and structure