Psyllid ID: psy1220


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------
MGSTAINFTGLFGVLLAGVVLSSFILSTDAYTYETKFFDAKLDHFTYVSNQTFPLKYLINDEFWDEDGGAPVFFYCGNEDAIETFAENLGFLWESAKRFSARVVLVEHRYYGSSLPFGPKSLSSPRLSGYLTVAQTLADFVDVIQSLEDASRLRIGAAFKPHPVIAFGGSYGGMLAFWLRLKYPHIVQGALASSAPMFQTNDLAPCDIYYKEVTKIYRDVSPKCEENIRNSWTFINTELQTDSGRVEFSREWNLCSSLKTQVDVAIFKRYLSDMYTTMAMTNYPYPSNFLTPLPGNPVKVDVAIFKRYLSDMYTTMAMTNYPYPSNFLTPLPGNPVK
ccccccHHHHHHHHHHccccccccccccccccEEEEEEEEEccccccccccEEEEEEEEEcccccccccccEEEEEccccccccHHHHHHHHHHHHHHcccEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccccHHHHHHHHHccccEEEEEEcccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
cccEEEEEHHHHHHcccHHHHHcccccccccccEEEEEEEEEccccccccccEEEEEEEEcHHccccccccEEEEEcccccHHHHHccccHHHHHHHHcccEEEEEEEEEccccccccccccccHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEccHHHHHHHHHHHHcccHEHEHHHccccEEEEccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccHccHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccc
MGSTAINFTGLFGVLLAGVVLSSFILSTDAYTYETKFfdakldhftyvsnqtfplkylindefwdedggapvffycGNEDAIETFAENLGFLWESAKRFSARVVLVEHRyygsslpfgpkslssprlsgyLTVAQTLADFVDVIQSLEDASRLrigaafkphpviafggsygGMLAFWLRLKYphivqgalassapmfqtndlapcdiyYKEVTKIYrdvspkceenIRNSWTFINTelqtdsgrveFSREWNLCSSLKTQVDVAIFKRYLSDMYTtmamtnypypsnfltplpgnpvkVDVAIFKRYLSDMYTtmamtnypypsnfltplpgnpvk
MGSTAINFTGLFGVLLAGVVLSSFILSTDAYTYETKFFDAKLDHFTYVSNQTFPLKYLINDEFWDEDGGAPVFFYCGNEDAIETFAENLGFLWESAKRFSARVVLVEHRYYGsslpfgpkslssPRLSGYLTVAQTLADFVDVIQSLEDASRLRIGAAFKPHPVIAFGGSYGGMLAFWLRLKYPHIVQGALASSAPMFQTNDLAPCDIYYKEVTKIYRDVSPKCEENIRNSWTFINTELQTDSGRVEFSREWNLcsslktqvdVAIFKRYLSDMYTTMAMTNYPYPSNFLTPLPGNPVKVDVAIFKRYLSDMYTTMAMTNYPypsnfltplpgnpvk
MGSTAINFTglfgvllagvvlSSFILSTDAYTYETKFFDAKLDHFTYVSNQTFPLKYLINDEFWDEDGGAPVFFYCGNEDAIETFAENLGFLWESAKRFSARVVLVEHRYYGSSLPFGPKSLSSPRLSGYLTVAQTLADFVDVIQSLEDASRLRIGAAFKPHPVIAFGGSYGGMLAFWLRLKYPHIVQGALASSAPMFQTNDLAPCDIYYKEVTKIYRDVSPKCEENIRNSWTFINTELQTDSGRVEFSREWNLCSSLKTQVDVAIFKRYLSDMYTTMAMTNYPYPSNFLTPLPGNPVKVDVAIFKRYLSDMYTTMAMTNYPYPSNFLTPLPGNPVK
****AINFTGLFGVLLAGVVLSSFILSTDAYTYETKFFDAKLDHFTYVSNQTFPLKYLINDEFWDEDGGAPVFFYCGNEDAIETFAENLGFLWESAKRFSARVVLVEHRYYGSSLPFGPKSL*SPRLSGYLTVAQTLADFVDVIQSLEDASRLRIGAAFKPHPVIAFGGSYGGMLAFWLRLKYPHIVQGALASSAPMFQTNDLAPCDIYYKEVTKIYRDVSPKCEENIRNSWTFINTELQTDSGRVEFSREWNLCSSLKTQVDVAIFKRYLSDMYTTMAMTNYPYPSNFLTPLPGNPVKVDVAIFKRYLSDMYTTMAMTNYPYPSNFL*********
****A*NFTGLFGVLLAG*************TYETKFFDAKLDHFTYVSNQTFPLKYLINDEFWDEDGGAPVFFYCGNEDAIETFAENLGFLWESAKRFSARVVLVEHRYYGSSLPFGPKSLSSPRLSGYLTVAQTLADFVDVIQSLEDASRLRIGAAFKPHPVIAFGGSYGGMLAFWLRLKYPHIVQGALASSAPMFQTNDLAPCDIYYKEVTKIYRDVSPKCEENIRNSWTFINTELQTDSGRVEFSREWNLCSSLKTQVDVAIFKRYLSDMYTTMAMTNYPYPSNFLTPLPGNPVKVDVAIFKRYLSDMYTTMAMTNYPYPSNFLT*L******
MGSTAINFTGLFGVLLAGVVLSSFILSTDAYTYETKFFDAKLDHFTYVSNQTFPLKYLINDEFWDEDGGAPVFFYCGNEDAIETFAENLGFLWESAKRFSARVVLVEHRYYGSSLPFGPKSLSSPRLSGYLTVAQTLADFVDVIQSLEDASRLRIGAAFKPHPVIAFGGSYGGMLAFWLRLKYPHIVQGALASSAPMFQTNDLAPCDIYYKEVTKIYRDVSPKCEENIRNSWTFINTELQTDSGRVEFSREWNLCSSLKTQVDVAIFKRYLSDMYTTMAMTNYPYPSNFLTPLPGNPVKVDVAIFKRYLSDMYTTMAMTNYPYPSNFLTPLPGNPVK
*GSTAINFTGLFGVLLAGVVLSSFILSTDAYTYETKFFDAKLDHFTYVSNQTFPLKYLINDEFWDEDGGAPVFFYCGNEDAIETFAENLGFLWESAKRFSARVVLVEHRYYGSSLPFGPKSLSSPRLSGYLTVAQTLADFVDVIQSLEDASRLRIGAAFKPHPVIAFGGSYGGMLAFWLRLKYPHIVQGALASSAPMFQTNDLAPCDIYYKEVTKIYRDVSPKCEENIRNSWTFINTELQTDSGRVEFSREWNLCSSLKTQVDVAIFKRYLSDMYTTMAMTNYPYPSNFLTPLPGNPVKVDVAIFKRYLSDMYTTMAMTNYPYPSNFLTPLPG****
iiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSTAINFTGLFGVLLAGVVLSSFILSTDAYTYETKFFDAKLDHFTYVSNQTFPLKYLINDEFWDEDGGAPVFFYCGNEDAIETFAENLGFLWESAKRFSARVVLVEHRYYGSSLPFGPKSLSSPRLSGYLTVAQTLADFVDVIQSLEDASRLRIGAAFKPHPVIAFGGSYGGMLAFWLRLKYPHIVQGALASSAPMFQTNDLAPCDIYYKEVTKIYRDVSPKCEENIRNSWTFINTELQTDSGRVEFSREWNLCSSLKTQVDVAIFKRYLSDMYTTMAMTNYPYPSNFLTPLPGNPVKVDVAIFKRYLSDMYTTMAMTNYPYPSNFLTPLPGNPVK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query337 2.2.26 [Sep-21-2011]
Q2TA14 499 Lysosomal Pro-X carboxype yes N/A 0.795 0.537 0.474 7e-67
Q5RBU7 496 Lysosomal Pro-X carboxype yes N/A 0.801 0.544 0.444 1e-64
P42785 496 Lysosomal Pro-X carboxype yes N/A 0.801 0.544 0.444 3e-64
Q7TMR0 491 Lysosomal Pro-X carboxype yes N/A 0.780 0.535 0.425 7e-61
Q9UHL4 492 Dipeptidyl peptidase 2 OS no N/A 0.759 0.520 0.413 2e-53
Q9EPB1 500 Dipeptidyl peptidase 2 OS no N/A 0.813 0.548 0.399 1e-52
P34676 507 Prolyl carboxy peptidase yes N/A 0.804 0.534 0.412 2e-52
Q9ET22 506 Dipeptidyl peptidase 2 OS no N/A 0.813 0.541 0.392 6e-47
P34610 565 Putative serine protease no N/A 0.756 0.451 0.376 3e-41
Q9QXE5 509 Thymus-specific serine pr no N/A 0.661 0.438 0.299 2e-18
>sp|Q2TA14|PCP_BOVIN Lysosomal Pro-X carboxypeptidase OS=Bos taurus GN=PRCP PE=2 SV=1 Back     alignment and function desciption
 Score =  254 bits (649), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 165/274 (60%), Gaps = 6/274 (2%)

Query: 33  YETKFFDAKLDHFTYVSNQTFPLKYLINDEFWDEDGGAPVFFYCGNEDAIETFAENLGFL 92
           Y  ++   K+DHF +  ++TF  +YLI D +W EDGG+ + FY GNE  I  F  N GF+
Sbjct: 50  YSIRYIQQKVDHFGFNIDRTFKQRYLIADNYWKEDGGS-ILFYTGNEGDIIWFCNNTGFM 108

Query: 93  WESAKRFSARVVLVEHRYYGSSLPFGPKSLSSPRLSGYLTVAQTLADFVDVIQSLEDASR 152
           W+ A+   A +V  EHRYYG SLPFG  S S  R   +LT  Q LADF  +I+ L+    
Sbjct: 109 WDIAEEMKAMLVFAEHRYYGESLPFGADSFSDSRHLNFLTTEQALADFAKLIRYLKRT-- 166

Query: 153 LRIGAAFKPHPVIAFGGSYGGMLAFWLRLKYPHIVQGALASSAPMFQTNDLAPCDIYYKE 212
             I  A   H VIA GGSYGGMLA W R+KYPH+V GALASSAP++Q NDL PCDI+ K 
Sbjct: 167 --IPGARNQH-VIALGGSYGGMLAAWFRMKYPHLVVGALASSAPIWQFNDLVPCDIFMKI 223

Query: 213 VTKIYRDVSPKCEENIRNSWTFINTELQTDSGRVEFSREWNLCSSLKTQVDVAIFKRYLS 272
           VT  +    P C E+IR SW  IN   +  +G    S   +LC+ L    DV   K ++S
Sbjct: 224 VTTDFSQSGPNCSESIRRSWDAINRLAKKGTGLRWLSEALHLCTPLTKSQDVQRLKDWIS 283

Query: 273 DMYTTMAMTNYPYPSNFLTPLPGNPVKVDVAIFK 306
           + +  +AM +YPY SNFL PLP  PVKV    FK
Sbjct: 284 ETWVNVAMVDYPYESNFLQPLPAWPVKVVCQYFK 317




Cleaves C-terminal amino acids linked to proline in peptides such as angiotensin II, III and des-Arg9-bradykinin. This cleavage occurs at acidic pH, but enzymatic activity is retained with some substrates at neutral pH.
Bos taurus (taxid: 9913)
EC: 3EC: .EC: 4EC: .EC: 1EC: 6EC: .EC: 2
>sp|Q5RBU7|PCP_PONAB Lysosomal Pro-X carboxypeptidase OS=Pongo abelii GN=PRCP PE=2 SV=1 Back     alignment and function description
>sp|P42785|PCP_HUMAN Lysosomal Pro-X carboxypeptidase OS=Homo sapiens GN=PRCP PE=1 SV=1 Back     alignment and function description
>sp|Q7TMR0|PCP_MOUSE Lysosomal Pro-X carboxypeptidase OS=Mus musculus GN=Prcp PE=2 SV=2 Back     alignment and function description
>sp|Q9UHL4|DPP2_HUMAN Dipeptidyl peptidase 2 OS=Homo sapiens GN=DPP7 PE=1 SV=3 Back     alignment and function description
>sp|Q9EPB1|DPP2_RAT Dipeptidyl peptidase 2 OS=Rattus norvegicus GN=Dpp7 PE=1 SV=1 Back     alignment and function description
>sp|P34676|PCP5_CAEEL Prolyl carboxy peptidase like protein 5 OS=Caenorhabditis elegans GN=pcp-5 PE=1 SV=1 Back     alignment and function description
>sp|Q9ET22|DPP2_MOUSE Dipeptidyl peptidase 2 OS=Mus musculus GN=Dpp7 PE=2 SV=2 Back     alignment and function description
>sp|P34610|PCP1_CAEEL Putative serine protease pcp-1 OS=Caenorhabditis elegans GN=pcp-1 PE=1 SV=2 Back     alignment and function description
>sp|Q9QXE5|TSSP_MOUSE Thymus-specific serine protease OS=Mus musculus GN=Prss16 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query337
328702869 507 PREDICTED: lysosomal Pro-X carboxypeptid 0.863 0.573 0.459 3e-76
193718325 469 PREDICTED: lysosomal Pro-X carboxypeptid 0.836 0.601 0.475 1e-74
332025885 484 Lysosomal Pro-X carboxypeptidase [Acromy 0.813 0.566 0.470 7e-74
242006450 457 Lysosomal Pro-X carboxypeptidase, putati 0.747 0.551 0.507 3e-72
307189813 453 Lysosomal Pro-X carboxypeptidase [Campon 0.753 0.560 0.496 1e-70
357606522 467 putative Lysosomal Pro-X carboxypeptidas 0.810 0.584 0.464 2e-70
167888448 488 prolyl carboxypeptidase [Tenebrio molito 0.813 0.561 0.484 5e-70
321468146 477 hypothetical protein DAPPUDRAFT_225197 [ 0.792 0.559 0.450 3e-69
91088397 478 PREDICTED: similar to prolylcarboxypepti 0.768 0.541 0.509 4e-69
383861707 493 PREDICTED: lysosomal Pro-X carboxypeptid 0.801 0.547 0.473 2e-67
>gi|328702869|ref|XP_001949478.2| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  291 bits (745), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 142/309 (45%), Positives = 192/309 (62%), Gaps = 18/309 (5%)

Query: 26  LSTDAYTYETKFFDAKLDHFTYVSNQTFPLKYLINDEFWDEDGGAPVFFYCGNEDAIETF 85
           L+   Y Y+T++F   +DHF++ +N TF +KYLIND FW+ + G P+FFY GNE AIE F
Sbjct: 16  LANGGYVYKTEYFTVPVDHFSFTNNDTFRMKYLINDTFWERENG-PIFFYAGNEGAIEMF 74

Query: 86  AENLGFLWESAKRFSARVVLVEHRYYGSSLPFGPKSLSSPRLSGYLTVAQTLADFVDVIQ 145
            EN GF+WE A+ F A VV  EHRYYG S+P+G +S       GYLT  Q LAD+VD+I 
Sbjct: 75  CENTGFMWEIAEEFRALVVFAEHRYYGVSMPYGNRSFDDIGRVGYLTSQQALADYVDLIT 134

Query: 146 SLE--------------DASRLRIGAAFKP---HPVIAFGGSYGGMLAFWLRLKYPHIVQ 188
            L               D     +G    P   +PVIAFGGSYGGMLA W R+KYP I++
Sbjct: 135 YLRHNGSYSNRELYQTGDIYDTAVGDTPAPSASNPVIAFGGSYGGMLAAWFRIKYPAIIE 194

Query: 189 GALASSAPMFQTNDLAPCDIYYKEVTKIYRDVSPKCEENIRNSWTFINTELQTDSGRVEF 248
           GA+ASSAP++Q   + PC+ +Y+  + +Y D S +C   I  SW  I+   +T  G+   
Sbjct: 195 GAIASSAPIWQFTGMTPCNAFYRVTSSVYTDTSAECGLTILASWKAIDNVTKTVDGKAWL 254

Query: 249 SREWNLCSSLKTQVDVAIFKRYLSDMYTTMAMTNYPYPSNFLTPLPGNPVKVDVAIFKRY 308
           S++WNLCS L    DV+I K ++S++Y  +AM NYPYP+NFLTPLPG+PVK      K +
Sbjct: 255 SQKWNLCSPLTNDNDVSILKEWVSELYVNLAMINYPYPANFLTPLPGHPVKEVCKPMKNH 314

Query: 309 LSDMYTTMA 317
             D +T + 
Sbjct: 315 KEDDFTLLG 323




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|193718325|ref|XP_001949511.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|332025885|gb|EGI66041.1| Lysosomal Pro-X carboxypeptidase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|242006450|ref|XP_002424063.1| Lysosomal Pro-X carboxypeptidase, putative [Pediculus humanus corporis] gi|212507369|gb|EEB11325.1| Lysosomal Pro-X carboxypeptidase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307189813|gb|EFN74085.1| Lysosomal Pro-X carboxypeptidase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|357606522|gb|EHJ65099.1| putative Lysosomal Pro-X carboxypeptidase [Danaus plexippus] Back     alignment and taxonomy information
>gi|167888448|gb|ACA09612.1| prolyl carboxypeptidase [Tenebrio molitor] Back     alignment and taxonomy information
>gi|321468146|gb|EFX79132.1| hypothetical protein DAPPUDRAFT_225197 [Daphnia pulex] Back     alignment and taxonomy information
>gi|91088397|ref|XP_972807.1| PREDICTED: similar to prolylcarboxypeptidase [Tribolium castaneum] gi|270012192|gb|EFA08640.1| hypothetical protein TcasGA2_TC006303 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383861707|ref|XP_003706326.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query337
UNIPROTKB|F1MAU4 499 PRCP "Lysosomal Pro-X carboxyp 0.830 0.561 0.468 5.4e-63
FB|FBgn0032864 475 CG2493 [Drosophila melanogaste 0.813 0.576 0.439 1.4e-62
UNIPROTKB|Q2TA14 499 PRCP "Lysosomal Pro-X carboxyp 0.830 0.561 0.465 1.8e-62
UNIPROTKB|F1NWF2 433 PRCP "Uncharacterized protein" 0.783 0.609 0.468 5.5e-61
UNIPROTKB|P42785 496 PRCP "Lysosomal Pro-X carboxyp 0.783 0.532 0.457 3.9e-60
ZFIN|ZDB-GENE-040718-447 490 prcp "prolylcarboxypeptidase ( 0.774 0.532 0.453 1.7e-59
UNIPROTKB|F1STV0 493 PRCP "Uncharacterized protein" 0.786 0.537 0.450 2.7e-59
UNIPROTKB|F1PWK3 497 PRCP "Uncharacterized protein" 0.777 0.527 0.458 2.5e-58
RGD|1307842 493 Prcp "prolylcarboxypeptidase ( 0.771 0.527 0.442 8.4e-58
MGI|MGI:1919711 491 Prcp "prolylcarboxypeptidase ( 0.780 0.535 0.437 2.8e-57
UNIPROTKB|F1MAU4 PRCP "Lysosomal Pro-X carboxypeptidase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 643 (231.4 bits), Expect = 5.4e-63, P = 5.4e-63
 Identities = 135/288 (46%), Positives = 174/288 (60%)

Query:    33 YETKFFDAKLDHFTYVSNQTFPLKYLINDEFWDEDGGAPVFFYCGNEDAIETFAENLGFL 92
             Y  ++   K+DHF +  ++TF  +YLI D +W EDGG+ + FY GNE  I  F  N GF+
Sbjct:    50 YSIRYIQQKVDHFGFNIDRTFKQRYLIADNYWKEDGGS-ILFYTGNEGDIIWFCNNTGFM 108

Query:    93 WESAKRFSARVVLVEHRYYGSSLPFGPKSLSSPRLSGYLTVAQTLADFVDVIQSLEDASR 152
             W+ A+   A +V  EHRYYG SLPFG  S S  R   +LT  Q LADF  +I+ L+   R
Sbjct:   109 WDIAEEMKAMLVFAEHRYYGESLPFGADSFSDSRHLNFLTTEQALADFAKLIRYLK---R 165

Query:   153 LRIGAAFKPHPVIAFGGSYGGMLAFWLRLKYPHIVQGALASSAPMFQTNDLAPCDIYYKE 212
                GA  +  PVIA GGSYGGMLA W R+KYPH+V GALASSAP++Q NDL PCDI+ K 
Sbjct:   166 TIPGA--RNQPVIALGGSYGGMLAAWFRMKYPHLVVGALASSAPIWQFNDLVPCDIFMKI 223

Query:   213 VTKIYRDVSPKCEENIRNSWTFINTELQTDSGRVEFSREWNLCSSLKTQVDVAIFKRYLS 272
             VT  +    P C E+IR SW  IN   +   G    S   +LC+ L    DV   K ++S
Sbjct:   224 VTTDFSQSGPNCSESIRRSWDAINRLAKKGPGLRWLSEALHLCTPLTKSQDVQRLKDWIS 283

Query:   273 DMYTTMAMTNYPYPSNFLTPLPGNPVKVDVAIFKRYLSDMYTTMAMTN 320
             + +  +AM +YPY SNFL PLP  PVKV    FK Y S++  T+ + N
Sbjct:   284 ETWVNVAMVDYPYESNFLQPLPAWPVKVVCQYFK-Y-SNVPDTVMVQN 329




GO:0008236 "serine-type peptidase activity" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
FB|FBgn0032864 CG2493 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q2TA14 PRCP "Lysosomal Pro-X carboxypeptidase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWF2 PRCP "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P42785 PRCP "Lysosomal Pro-X carboxypeptidase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-447 prcp "prolylcarboxypeptidase (angiotensinase C)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1STV0 PRCP "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PWK3 PRCP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1307842 Prcp "prolylcarboxypeptidase (angiotensinase C)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1919711 Prcp "prolylcarboxypeptidase (angiotensinase C)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
pfam05577 433 pfam05577, Peptidase_S28, Serine carboxypeptidase 7e-58
pfam12697187 pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam 2e-05
pfam00561226 pfam00561, Abhydrolase_1, alpha/beta hydrolase fol 1e-04
COG0596282 COG0596, MhpC, Predicted hydrolases or acyltransfe 6e-04
pfam12695145 pfam12695, Abhydrolase_5, Alpha/beta hydrolase fam 0.002
>gnl|CDD|218645 pfam05577, Peptidase_S28, Serine carboxypeptidase S28 Back     alignment and domain information
 Score =  192 bits (490), Expect = 7e-58
 Identities = 82/260 (31%), Positives = 114/260 (43%), Gaps = 13/260 (5%)

Query: 40  AKLDHFTYVSNQTFPLKYLINDEFWDEDGGAPVFFYCGNEDAIETFAENLGFLWESAKRF 99
            KLDHF   +N+TF  +Y  ND+ +    G P+F   G E          G   + AK F
Sbjct: 1   QKLDHFDPSNNRTFQQRYFYNDQHYR--NGGPIFLMIGGEGPESASWVRNGHWLDLAKEF 58

Query: 100 SARVVLVEHRYYGSSLPFGPKSLSSPRLSGYLTVAQTLADFVDVIQSLEDASRLRIGAAF 159
            A V  +EHR+YG S P G  S ++ R   YL+  Q LAD    I+++   ++   G   
Sbjct: 59  GALVFSLEHRFYGQSKPIGDLSTANLR---YLSSLQALADVASFIKAM---NQKFNG--L 110

Query: 160 KPHPVIAFGGSYGGMLAFWLRLKYPHIVQGALASSAPMFQTNDLAPCDIYYKEVTKIYRD 219
                I FGGSY G LA W R KYPH+V GA+ASSAP+    D      Y   V      
Sbjct: 111 SSSKWITFGGSYSGSLAAWARKKYPHLVVGAVASSAPLLAKVDFKE---YNMVVETSLAQ 167

Query: 220 VSPKCEENIRNSWTFINTELQTDSGRVEFSREWNLCSSLKTQVDVAIFKRYLSDMYTTMA 279
              +C + + N +  +   L T  GR   S+   LC  L    D+ I   + +       
Sbjct: 168 TGGECYDAVENGFAEVEELLLTKEGRQALSKLLQLCPPLNVTTDLDILNFFSNIYSPFQG 227

Query: 280 MTNYPYPSNFLTPLPGNPVK 299
           +  Y Y     + L G  + 
Sbjct: 228 VVQYTYDGQGNSTLNGYSIP 247


These serine proteases include several eukaryotic enzymes such as lysosomal Pro-X carboxypeptidase, dipeptidyl-peptidase II, and thymus-specific serine peptidase. Length = 433

>gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|201306 pfam00561, Abhydrolase_1, alpha/beta hydrolase fold Back     alignment and domain information
>gnl|CDD|223669 COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|221718 pfam12695, Abhydrolase_5, Alpha/beta hydrolase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 337
KOG2183|consensus 492 100.0
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 100.0
KOG2182|consensus 514 100.0
PLN02824294 hydrolase, alpha/beta fold family protein 99.78
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 99.74
PRK10673255 acyl-CoA esterase; Provisional 99.72
PRK00870302 haloalkane dehalogenase; Provisional 99.68
PF05576 448 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR0 99.68
PRK03592295 haloalkane dehalogenase; Provisional 99.68
PLN02965255 Probable pheophorbidase 99.66
PRK06489360 hypothetical protein; Provisional 99.66
PRK10349256 carboxylesterase BioH; Provisional 99.66
KOG4178|consensus322 99.65
PLN02578354 hydrolase 99.64
KOG4409|consensus365 99.64
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 99.63
PLN02298330 hydrolase, alpha/beta fold family protein 99.63
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.63
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.63
TIGR03611257 RutD pyrimidine utilization protein D. This protei 99.62
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 99.62
PHA02857276 monoglyceride lipase; Provisional 99.62
PLN02385349 hydrolase; alpha/beta fold family protein 99.61
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 99.61
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 99.61
PLN02679360 hydrolase, alpha/beta fold family protein 99.6
KOG2382|consensus315 99.59
PLN02211273 methyl indole-3-acetate methyltransferase 99.59
PRK03204286 haloalkane dehalogenase; Provisional 99.59
KOG1455|consensus313 99.59
PRK10749330 lysophospholipase L2; Provisional 99.59
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 99.58
PRK08775343 homoserine O-acetyltransferase; Provisional 99.56
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.56
COG2267298 PldB Lysophospholipase [Lipid metabolism] 99.56
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 99.55
PLN03084383 alpha/beta hydrolase fold protein; Provisional 99.54
KOG2564|consensus343 99.54
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 99.53
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 99.53
PLN02894402 hydrolase, alpha/beta fold family protein 99.48
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 99.46
PRK07581339 hypothetical protein; Validated 99.45
COG1647243 Esterase/lipase [General function prediction only] 99.44
PLN02511388 hydrolase 99.44
PLN02652395 hydrolase; alpha/beta fold family protein 99.44
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 99.42
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.42
PRK00175379 metX homoserine O-acetyltransferase; Provisional 99.39
KOG1454|consensus326 99.37
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 99.34
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 99.34
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 99.33
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 99.33
PRK05855 582 short chain dehydrogenase; Validated 99.31
PRK10985324 putative hydrolase; Provisional 99.3
PRK10566249 esterase; Provisional 99.29
PRK13604307 luxD acyl transferase; Provisional 99.27
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 99.26
PRK05077414 frsA fermentation/respiration switch protein; Revi 99.2
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 99.2
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 99.19
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 99.19
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 99.16
PRK11071190 esterase YqiA; Provisional 99.11
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 99.09
PRK06765389 homoserine O-acetyltransferase; Provisional 99.09
KOG4391|consensus300 99.07
PLN02442283 S-formylglutathione hydrolase 99.05
PLN02872395 triacylglycerol lipase 99.02
KOG1552|consensus258 98.95
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 98.93
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 98.93
PF10503220 Esterase_phd: Esterase PHB depolymerase 98.91
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 98.91
PLN00021313 chlorophyllase 98.89
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 98.86
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 98.86
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 98.84
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 98.79
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 98.75
PRK11460232 putative hydrolase; Provisional 98.73
PRK07868 994 acyl-CoA synthetase; Validated 98.73
PRK10162318 acetyl esterase; Provisional 98.69
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 98.64
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 98.63
COG2021368 MET2 Homoserine acetyltransferase [Amino acid tran 98.6
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 98.57
KOG2984|consensus277 98.55
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 98.49
KOG1838|consensus409 98.48
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 98.45
PRK10115686 protease 2; Provisional 98.44
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 98.43
KOG2565|consensus469 98.42
KOG4667|consensus269 98.37
KOG1553|consensus517 98.36
PTZ00472 462 serine carboxypeptidase (CBP1); Provisional 98.36
PRK102521296 entF enterobactin synthase subunit F; Provisional 98.34
KOG2183|consensus 492 98.34
COG3208244 GrsT Predicted thioesterase involved in non-riboso 98.32
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 98.29
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 98.28
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 98.25
COG3319257 Thioesterase domains of type I polyketide synthase 98.19
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 98.19
KOG3724|consensus 973 98.17
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 98.16
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 98.11
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 98.11
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 98.1
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 98.07
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 98.04
KOG2931|consensus326 98.02
COG0657312 Aes Esterase/lipase [Lipid metabolism] 98.0
COG4099387 Predicted peptidase [General function prediction o 98.0
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 97.98
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 97.96
COG2945210 Predicted hydrolase of the alpha/beta superfamily 97.95
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 97.92
KOG2281|consensus867 97.83
KOG2100|consensus755 97.81
COG0412236 Dienelactone hydrolase and related enzymes [Second 97.8
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 97.79
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 97.78
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 97.78
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 97.78
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 97.77
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 97.77
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 97.75
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 97.68
COG4757281 Predicted alpha/beta hydrolase [General function p 97.68
KOG1515|consensus336 97.68
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 97.67
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 97.65
COG0400207 Predicted esterase [General function prediction on 97.6
COG1075336 LipA Predicted acetyltransferases and hydrolases w 97.59
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 97.57
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 97.55
KOG4627|consensus270 97.55
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 97.54
PLN02209437 serine carboxypeptidase 97.54
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 97.53
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 97.48
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 97.43
COG4814288 Uncharacterized protein with an alpha/beta hydrola 97.41
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 97.36
COG2819264 Predicted hydrolase of the alpha/beta superfamily 97.32
PRK04940180 hypothetical protein; Provisional 97.24
PF07224307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 97.24
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 97.13
COG4782377 Uncharacterized protein conserved in bacteria [Fun 97.05
COG3150191 Predicted esterase [General function prediction on 97.05
KOG2624|consensus403 97.04
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 96.96
KOG1282|consensus 454 96.95
PF02450389 LCAT: Lecithin:cholesterol acyltransferase; InterP 96.93
COG4188365 Predicted dienelactone hydrolase [General function 96.93
PLN02633314 palmitoyl protein thioesterase family protein 96.92
PF00135 535 COesterase: Carboxylesterase family The prints ent 96.9
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 96.9
COG0627316 Predicted esterase [General function prediction on 96.84
KOG3101|consensus283 96.63
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 96.62
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 96.62
COG2936 563 Predicted acyl esterases [General function predict 96.6
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 96.58
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 96.55
COG3243445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 96.52
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 96.51
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 96.48
PLN02606306 palmitoyl-protein thioesterase 96.46
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 96.38
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 96.31
KOG2112|consensus206 96.25
COG2939 498 Carboxypeptidase C (cathepsin A) [Amino acid trans 96.23
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 96.22
KOG2541|consensus296 96.2
PF02089279 Palm_thioest: Palmitoyl protein thioesterase; Inte 96.16
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 96.15
PF02273294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 95.98
KOG3967|consensus297 95.92
KOG3847|consensus399 95.75
PLN02213319 sinapoylglucose-malate O-sinapoyltransferase/ carb 95.73
KOG4840|consensus299 95.71
PLN02454414 triacylglycerol lipase 95.4
PLN02310405 triacylglycerol lipase 95.3
KOG3975|consensus301 95.23
KOG2369|consensus 473 95.18
PLN02162475 triacylglycerol lipase 95.03
PLN02571413 triacylglycerol lipase 94.92
PLN03037525 lipase class 3 family protein; Provisional 94.75
PLN00413479 triacylglycerol lipase 94.5
COG1770682 PtrB Protease II [Amino acid transport and metabol 94.46
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 94.45
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 94.38
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 94.32
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 94.17
PLN02408365 phospholipase A1 94.07
KOG1283|consensus 414 93.82
PLN02324415 triacylglycerol lipase 93.66
PLN02934515 triacylglycerol lipase 93.45
PLN02847 633 triacylglycerol lipase 93.13
PLN02802509 triacylglycerol lipase 93.06
PLN02753531 triacylglycerol lipase 93.02
COG4947227 Uncharacterized protein conserved in bacteria [Fun 92.94
KOG2237|consensus712 92.94
PLN02761527 lipase class 3 family protein 92.42
KOG1516|consensus 545 92.38
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 91.64
PLN02719518 triacylglycerol lipase 91.55
PF07519 474 Tannase: Tannase and feruloyl esterase; InterPro: 90.41
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 89.92
KOG4569|consensus336 89.68
KOG4388|consensus 880 89.55
PF04301213 DUF452: Protein of unknown function (DUF452); Inte 89.47
COG3946456 VirJ Type IV secretory pathway, VirJ component [In 88.7
PF07082250 DUF1350: Protein of unknown function (DUF1350); In 88.61
KOG1202|consensus2376 87.72
KOG3043|consensus242 87.43
COG1505648 Serine proteases of the peptidase family S9A [Amin 86.72
KOG4540|consensus425 85.59
COG5153425 CVT17 Putative lipase essential for disintegration 85.59
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 84.01
KOG1551|consensus371 83.75
KOG2551|consensus230 81.5
TIGR03712511 acc_sec_asp2 accessory Sec system protein Asp2. Th 80.25
>KOG2183|consensus Back     alignment and domain information
Probab=100.00  E-value=1.4e-60  Score=435.70  Aligned_cols=270  Identities=48%  Similarity=0.915  Sum_probs=257.8

Q ss_pred             CceeeeEEeecCCCCCCCCCeEeeEEEEeCcccCCCCCCcEEEEeCCCCCccchhhhhHHHHHHHHhcCCcEEEeccccc
Q psy1220          32 TYETKFFDAKLDHFTYVSNQTFPLKYLINDEFWDEDGGAPVFFYCGNEDAIETFAENLGFLWESAKRFSARVVLVEHRYY  111 (337)
Q Consensus        32 ~~~~~~f~q~~dhf~~~~~~tf~qry~~~~~~~~~~~~~pivl~hGg~g~~~~~~~~~~~~~~la~~~~~~vi~~D~rg~  111 (337)
                      .++++||.|+||||++.+..||.|||++|++||+++ ++||||+.|+||+.+.|..++||+|++|+++++.+|+.|||+|
T Consensus        44 ~ye~~yf~q~LDHFsF~~~~tF~qRylin~~fw~~g-~gPIffYtGNEGdie~Fa~ntGFm~D~Ap~~~AllVFaEHRyY  122 (492)
T KOG2183|consen   44 NYETRYFQQPLDHFSFTDNKTFDQRYLINDDFWKKG-EGPIFFYTGNEGDIEWFANNTGFMWDLAPELKALLVFAEHRYY  122 (492)
T ss_pred             cceeEEeecccccccccCccceeeEEEEecccccCC-CCceEEEeCCcccHHHHHhccchHHhhhHhhCceEEEeehhcc
Confidence            599999999999999999999999999999999987 6999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCCCCCCCcccccCCHHHHHHHHHHHHHHHHhhhhhhccCCCCCCCEEEEecchhHHHHHHHHHhCCCceeEee
Q psy1220         112 GSSLPFGPKSLSSPRLSGYLTVAQTLADFVDVIQSLEDASRLRIGAAFKPHPVIAFGGSYGGMLAFWLRLKYPHIVQGAL  191 (337)
Q Consensus       112 G~S~~~~~~s~~~~~~~~~~t~~~~~~D~~~~i~~l~~~~~~~~~~~~~~~~~il~G~S~GG~la~~~~~~~P~~v~~~v  191 (337)
                      |+|.|+++.++...+++.|||.+|+++|.++++.+++++      ...+..|+|++|+|||||||+|+++|||+.|.|++
T Consensus       123 GeS~PFG~~s~k~~~hlgyLtseQALADfA~ll~~lK~~------~~a~~~pvIafGGSYGGMLaAWfRlKYPHiv~GAl  196 (492)
T KOG2183|consen  123 GESLPFGSQSYKDARHLGYLTSEQALADFAELLTFLKRD------LSAEASPVIAFGGSYGGMLAAWFRLKYPHIVLGAL  196 (492)
T ss_pred             ccCCCCcchhccChhhhccccHHHHHHHHHHHHHHHhhc------cccccCcEEEecCchhhHHHHHHHhcChhhhhhhh
Confidence            999999999888888999999999999999999999976      36667899999999999999999999999999999


Q ss_pred             ecCccccccCCCCChhHHHHHHHHHHhccCcccHHHHHHHHHHHHHhhhCCchhHHHHHhcCCCCCCCCHHHHHHHHHHH
Q psy1220         192 ASSAPMFQTNDLAPCDIYYKEVTKIYRDVSPKCEENIRNSWTFINTELQTDSGRVEFSREWNLCSSLKTQVDVAIFKRYL  271 (337)
Q Consensus       192 ~~sap~~~~~~~~~~~~~~~~v~~~~~~~~~~c~~~~~~~~~~i~~~~~~~~~~~~l~~~f~~~~~~~~~~di~~~~~~~  271 (337)
                      ++|||+..+.+.++...|++.|++.|.+.+++|...|+++|..++++...+.+.+.|.+.|++|.+++  +|+..+++|+
T Consensus       197 AaSAPvl~f~d~vp~~~f~~ivT~~F~~as~~C~~~I~~sW~ai~~l~~~~nG~q~Ls~~f~lc~~ln--~d~~~l~d~l  274 (492)
T KOG2183|consen  197 AASAPVLYFEDTVPKDVFYRIVTRDFKDASPNCRNTIRKSWDAIDRLAAKDNGLQILSKAFKLCKPLN--DDIGDLKDYL  274 (492)
T ss_pred             hccCceEeecCCCCcchhhhHHHHHHHhhcHHHHHHHHHHHHHHHHHhcCcchHHHHHHHhhhccccc--ccHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999989999999999999987  4999999999


Q ss_pred             HHHHhhhhhccCCCCCCCCCCCCCCchhhHHHHHhhccc
Q psy1220         272 SDMYTTMAMTNYPYPSNFLTPLPGNPVKVDVAIFKRYLS  310 (337)
Q Consensus       272 ~~~~~~~am~~y~~~~~~l~~~~~~pv~~icg~~~~~~~  310 (337)
                      ++++..+||+||||+++||+++|++||.++|+.++...+
T Consensus       275 ~ea~~ylAMVdYPy~t~Fl~pLPa~PV~~~C~~i~~~~~  313 (492)
T KOG2183|consen  275 REAYEYLAMVDYPYPTSFLAPLPAWPVKVVCKYINAPGP  313 (492)
T ss_pred             HHHHHHHHHhcCCCCccccCcCCCCcHHHHHHHhccCCC
Confidence            999999999999999999999999999999999986543



>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2182|consensus Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF05576 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR008761 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>KOG4178|consensus Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>KOG4409|consensus Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>KOG2382|consensus Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>KOG1455|consensus Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>KOG2564|consensus Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>KOG1454|consensus Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>KOG4391|consensus Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>KOG1552|consensus Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>KOG2984|consensus Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>KOG1838|consensus Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>KOG2565|consensus Back     alignment and domain information
>KOG4667|consensus Back     alignment and domain information
>KOG1553|consensus Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>KOG2183|consensus Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>KOG3724|consensus Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>KOG2931|consensus Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>KOG2281|consensus Back     alignment and domain information
>KOG2100|consensus Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG1515|consensus Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>KOG4627|consensus Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG2624|consensus Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>KOG1282|consensus Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PLN02633 palmitoyl protein thioesterase family protein Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG3101|consensus Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>PLN02606 palmitoyl-protein thioesterase Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>KOG2112|consensus Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>KOG2541|consensus Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>KOG3967|consensus Back     alignment and domain information
>KOG3847|consensus Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>KOG4840|consensus Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>KOG3975|consensus Back     alignment and domain information
>KOG2369|consensus Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>KOG1283|consensus Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>COG4947 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2237|consensus Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>KOG1516|consensus Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>KOG4569|consensus Back     alignment and domain information
>KOG4388|consensus Back     alignment and domain information
>PF04301 DUF452: Protein of unknown function (DUF452); InterPro: IPR007398 This is a family of uncharacterised proteins Back     alignment and domain information
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>KOG3043|consensus Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4540|consensus Back     alignment and domain information
>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information
>KOG1551|consensus Back     alignment and domain information
>KOG2551|consensus Back     alignment and domain information
>TIGR03712 acc_sec_asp2 accessory Sec system protein Asp2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
3n2z_B 446 The Structure Of Human Prolylcarboxypeptidase At 2. 5e-65
3jyh_A 469 Human Dipeptidyl Peptidase Dpp7 Length = 469 8e-55
4ebb_A 472 Structure Of Dpp2 Length = 472 7e-53
>pdb|3N2Z|B Chain B, The Structure Of Human Prolylcarboxypeptidase At 2.80 Angstroms Resolution Length = 446 Back     alignment and structure

Iteration: 1

Score = 244 bits (623), Expect = 5e-65, Method: Compositional matrix adjust. Identities = 122/274 (44%), Positives = 165/274 (60%), Gaps = 7/274 (2%) Query: 33 YETKFFDAKLDHFTYVSNQTFPLKYLINDEFWDEDGGAPVFFYCGNEDAIETFAENLGFL 92 Y +F K+DHF + + +TF +YL+ D++W ++GG+ + FY GNE I F N GF+ Sbjct: 3 YSVLYFQQKVDHFGFNTVKTFNQRYLVADKYWKKNGGS-ILFYTGNEGDIIWFCNNTGFM 61 Query: 93 WESAKRFSARVVLVEHRYYGSSLPFGPKSLSSPRLSGYLTVAQTLADFVDVIQSLEDASR 152 W+ A+ A +V EHRYYG SLPFG S R +LT Q LADF ++I+ L+ Sbjct: 62 WDVAEELKAMLVFAEHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKHLK---- 117 Query: 153 LRIGAAFKPHPVIAFGGSYGGMLAFWLRLKYPHIVQGALASSAPMFQTNDLAPCDIYYKE 212 R + PVIA GGSYGGMLA W R+KYPH+V GALA+SAP++Q DL PC ++ K Sbjct: 118 -RTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKI 176 Query: 213 VTKIYRDVSPKCEENIRNSWTFINTELQTDSGRVEFSREWNLCSSLKTQVDVAIFKRYLS 272 VT +R P C E+I SW IN T SG + +LCS L +Q D+ K ++S Sbjct: 177 VTTDFRKSGPHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQ-DIQHLKDWIS 235 Query: 273 DMYTTMAMTNYPYPSNFLTPLPGNPVKVDVAIFK 306 + + +AM +YPY SNFL PLP P+KV K Sbjct: 236 ETWVNLAMVDYPYASNFLQPLPAWPIKVVCQYLK 269
>pdb|3JYH|A Chain A, Human Dipeptidyl Peptidase Dpp7 Length = 469 Back     alignment and structure
>pdb|4EBB|A Chain A, Structure Of Dpp2 Length = 472 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 2e-74
3jyh_A 469 Dipeptidyl-peptidase 2; structural genomics, struc 2e-68
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 6e-06
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 3e-05
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 5e-05
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 1e-04
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 1e-04
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 1e-04
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 3e-04
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 3e-04
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 3e-04
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 5e-04
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 6e-04
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 7e-04
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 9e-04
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Length = 446 Back     alignment and structure
 Score =  235 bits (600), Expect = 2e-74
 Identities = 125/317 (39%), Positives = 169/317 (53%), Gaps = 21/317 (6%)

Query: 33  YETKFFDAKLDHFTYVSNQTFPLKYLINDEFWDEDGGAPVFFYCGNEDAIETFAENLGFL 92
           Y   +F  K+DHF + + +TF  +YL+ D++W ++GG  + FY GNE  I  F  N GF+
Sbjct: 3   YSVLYFQQKVDHFGFNTVKTFNQRYLVADKYWKKNGG-SILFYTGNEGDIIWFCNNTGFM 61

Query: 93  WESAKRFSARVVLVEHRYYGSSLPFGPKSLSSPRLSGYLTVAQTLADFVDVIQSLEDASR 152
           W+ A+   A +V  EHRYYG SLPFG  S    R   +LT  Q LADF ++I+ L+    
Sbjct: 62  WDVAEELKAMLVFAEHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKHLKRTIP 121

Query: 153 LRIGAAFKPHPVIAFGGSYGGMLAFWLRLKYPHIVQGALASSAPMFQTNDLAPCDIYYKE 212
                     PVIA GGSYGGMLA W R+KYPH+V GALA+SAP++Q  DL PC ++ K 
Sbjct: 122 GAENQ-----PVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKI 176

Query: 213 VTKIYRDVSPKCEENIRNSWTFINTELQTDSGRVEFSREWNLCSSLKTQVDVAIFKRYLS 272
           VT  +R   P C E+I  SW  IN    T SG    +   +LCS L +Q D+   K ++S
Sbjct: 177 VTTDFRKSGPHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQ-DIQHLKDWIS 235

Query: 273 DMYTTMAMTNYPYPSNFLTPLPGNPVKVD--------------VAIFKRYLSDMYTTMAM 318
           + +  +AM +YPY SNFL PLP  P+KV               +    + L+  Y     
Sbjct: 236 ETWVNLAMVDYPYASNFLQPLPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQ 295

Query: 319 TNYPYPSNFLTPLPGNP 335
                 S   T   G  
Sbjct: 296 VKCLNISETATSSLGTL 312


>3jyh_A Dipeptidyl-peptidase 2; structural genomics, structural genomics consortium, SGC, aminopeptidase, cleavage on PAIR of basic residues; HET: NAG BMA; 2.19A {Homo sapiens} PDB: 3n0t_A* Length = 469 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Length = 398 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Length = 251 Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Length = 258 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Length = 306 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Length = 262 Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Length = 286 Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Length = 315 Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Length = 330 Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} Length = 270 Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Length = 254 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} Length = 266 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Length = 278 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Length = 238 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query337
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 100.0
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 100.0
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 99.81
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.79
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 99.78
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 99.78
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 99.77
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 99.77
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 99.77
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 99.77
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.76
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 99.76
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 99.76
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 99.75
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 99.75
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 99.74
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 99.74
1iup_A282 META-cleavage product hydrolase; aromatic compound 99.74
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.74
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 99.74
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 99.74
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 99.74
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.74
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 99.74
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.74
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 99.73
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 99.73
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.73
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 99.73
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 99.73
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.72
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 99.72
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 99.72
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 99.71
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.71
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.71
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 99.71
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 99.7
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 99.7
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 99.7
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 99.69
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 99.69
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 99.69
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 99.69
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.69
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 99.69
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 99.69
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.69
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 99.69
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 99.69
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 99.68
1r3d_A264 Conserved hypothetical protein VC1974; structural 99.68
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.67
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.67
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 99.67
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 99.67
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.66
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 99.66
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.66
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 99.66
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 99.65
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.65
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 99.65
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.64
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 99.64
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 99.63
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 99.61
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 99.61
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.61
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 99.61
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 99.6
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 99.6
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 99.6
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 99.6
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 99.6
3llc_A270 Putative hydrolase; structural genomics, joint cen 99.59
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 99.59
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 99.59
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 99.59
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 99.59
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 99.58
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 99.58
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.58
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 99.35
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 99.57
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 99.56
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.56
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 99.55
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 99.54
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 99.54
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 99.52
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 99.51
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 99.51
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 99.51
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 99.5
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 99.5
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 99.49
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 99.47
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 99.46
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 99.45
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 99.45
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 99.45
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 99.44
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 99.44
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 99.44
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 99.43
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 99.43
3lp5_A250 Putative cell surface hydrolase; structural genom 99.43
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 99.42
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 99.41
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 99.41
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 99.41
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.41
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 99.39
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 99.39
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 99.39
3h04_A275 Uncharacterized protein; protein with unknown func 99.39
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 99.38
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 99.37
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 99.37
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 99.37
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 99.37
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 99.37
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 99.36
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 99.36
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 99.36
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 99.36
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 99.36
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 99.35
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 99.34
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 99.33
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 99.33
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 99.33
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 99.32
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 99.32
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 99.32
3ain_A323 303AA long hypothetical esterase; carboxylesterase 99.32
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 99.32
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 99.32
1kez_A300 Erythronolide synthase; polyketide synthase, modul 99.31
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 99.31
4fle_A202 Esterase; structural genomics, PSI-biology, northe 99.31
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 99.3
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 99.3
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 99.3
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 99.3
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 99.29
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 99.29
1vkh_A273 Putative serine hydrolase; structural genomics, jo 99.28
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 99.28
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 99.28
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 99.28
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 99.27
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 99.27
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 99.27
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 99.27
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 99.27
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 99.26
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 99.26
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 99.25
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 99.25
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 99.24
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 99.23
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 99.23
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 99.23
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 99.23
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 99.23
3tej_A329 Enterobactin synthase component F; nonribosomal pe 99.22
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 99.21
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 99.2
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 99.19
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 99.19
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 99.19
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 99.19
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 99.18
3bjr_A283 Putative carboxylesterase; structural genomics, jo 99.18
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.17
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 99.17
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 99.16
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 99.16
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 99.16
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 99.14
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.13
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.12
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.12
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.11
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 99.1
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.09
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 99.08
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 99.08
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 99.07
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 99.07
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.05
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.05
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 99.03
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.02
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.02
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.01
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 99.01
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 99.0
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 99.0
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 98.99
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 98.98
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 98.98
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 98.98
3nuz_A398 Putative acetyl xylan esterase; structural genomic 98.97
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 98.97
3d59_A383 Platelet-activating factor acetylhydrolase; secret 98.96
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.96
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 98.94
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 98.92
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 98.89
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 98.88
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 98.87
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 98.84
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 98.84
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 98.8
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 98.71
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 98.7
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 98.69
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 98.65
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 98.57
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 98.47
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 98.39
1ivy_A 452 Human protective protein; carboxypeptidase, serine 98.29
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 98.29
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 98.27
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 98.25
4f21_A246 Carboxylesterase/phospholipase family protein; str 98.23
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 98.12
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 98.11
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 98.09
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 98.07
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 98.03
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 98.01
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 97.96
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 97.95
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 97.92
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 97.8
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 97.8
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 97.73
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 97.67
1ac5_A 483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 97.67
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 97.66
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 97.64
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 97.56
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 97.55
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 97.31
1cpy_A 421 Serine carboxypeptidase; hydrolase (carboxypeptida 97.17
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 97.13
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 96.97
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 96.97
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 96.67
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 96.57
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 96.31
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 96.16
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 95.73
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 95.65
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 95.04
2vsq_A1304 Surfactin synthetase subunit 3; ligase, peptidyl c 94.61
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 94.37
4g4g_A433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 92.95
2vz8_A2512 Fatty acid synthase; transferase, phosphopantethei 92.76
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 92.66
3hc7_A254 Gene 12 protein, GP12; alpha/beta sandwich, cell a 92.56
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 91.82
3qpa_A197 Cutinase; alpha-beta hydrolase fold, esterase, hyd 90.62
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 89.77
2czq_A205 Cutinase-like protein; alpha/beta hydrolase fold, 88.39
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 87.75
3dcn_A201 Cutinase, cutin hydrolase; catalytic triad, secret 86.95
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 86.48
3qpd_A187 Cutinase 1; alpha-beta hydrolase fold, esterase, h 84.24
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 80.68
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-52  Score=409.86  Aligned_cols=269  Identities=39%  Similarity=0.763  Sum_probs=247.4

Q ss_pred             CCCceeeeEEeecCCCCCC--CCCeEeeEEEEeCcccCCCCCCcEEEEeCCCCCccchhhhhHHHHHHHHhcCCcEEEec
Q psy1220          30 AYTYETKFFDAKLDHFTYV--SNQTFPLKYLINDEFWDEDGGAPVFFYCGNEDAIETFAENLGFLWESAKRFSARVVLVE  107 (337)
Q Consensus        30 ~~~~~~~~f~q~~dhf~~~--~~~tf~qry~~~~~~~~~~~~~pivl~hGg~g~~~~~~~~~~~~~~la~~~~~~vi~~D  107 (337)
                      .+.++++||+|+||||++.  +++||+||||++++||+++ ++||||+.|||++...+..+.|++.++|+++|+.+|++|
T Consensus         2 ~P~~~~~~f~Q~lDHFn~~~~~~~TF~QRY~~n~~~~~~~-~gPIfl~~gGEg~~~~~~~~~g~~~~lA~~~~a~~v~lE   80 (472)
T 4ebb_A            2 DPGFQERFFQQRLDHFNFERFGNKTFPQRFLVSDRFWVRG-EGPIFFYTGNEGDVWAFANNSAFVAELAAERGALLVFAE   80 (472)
T ss_dssp             CCCCEEEEEEEESCSSCSSTTTTCEEEEEEEEECTTCCTT-TCCEEEEECCSSCHHHHHHHCHHHHHHHHHHTCEEEEEC
T ss_pred             CCCCceeeEEeecCCCCCCCCCCCEEEEEEEEecceeCCC-CCcEEEEECCCccccccccCccHHHHHHHHhCCeEEEEe
Confidence            5678999999999999964  4789999999999999876 799999999999999888889999999999999999999


Q ss_pred             ccccccCCCCCCCCCCCCcccccCCHHHHHHHHHHHHHHHHhhhhhhccCCCCCCCEEEEecchhHHHHHHHHHhCCCce
Q psy1220         108 HRYYGSSLPFGPKSLSSPRLSGYLTVAQTLADFVDVIQSLEDASRLRIGAAFKPHPVIAFGGSYGGMLAFWLRLKYPHIV  187 (337)
Q Consensus       108 ~rg~G~S~~~~~~s~~~~~~~~~~t~~~~~~D~~~~i~~l~~~~~~~~~~~~~~~~~il~G~S~GG~la~~~~~~~P~~v  187 (337)
                      ||+||+|.|+++.+++ .+++++||++|+++|++.|+++++.+     + ..++.|||++|+||||++|+|++.|||+.|
T Consensus        81 HRyYG~S~P~~~~st~-~~nL~yLt~eQALaD~a~fi~~~k~~-----~-~~~~~pwI~~GGSY~G~LaAW~R~kYP~lv  153 (472)
T 4ebb_A           81 HRYYGKSLPFGAQSTQ-RGHTELLTVEQALADFAELLRALRRD-----L-GAQDAPAIAFGGSYGGMLSAYLRMKYPHLV  153 (472)
T ss_dssp             CTTSTTCCTTGGGGGS-TTSCTTCSHHHHHHHHHHHHHHHHHH-----T-TCTTCCEEEEEETHHHHHHHHHHHHCTTTC
T ss_pred             cccccCCcCCCCCCcc-ccccccCCHHHHHHHHHHHHHHHHhh-----c-CCCCCCEEEEccCccchhhHHHHhhCCCeE
Confidence            9999999999887764 24899999999999999999999977     4 456689999999999999999999999999


Q ss_pred             eEeeecCccccccCCCCChhHHHHHHHHHHhccCcccHHHHHHHHHHHHHhhhCCchhHHHHHhcCCCCCCCCHHHHHHH
Q psy1220         188 QGALASSAPMFQTNDLAPCDIYYKEVTKIYRDVSPKCEENIRNSWTFINTELQTDSGRVEFSREWNLCSSLKTQVDVAIF  267 (337)
Q Consensus       188 ~~~v~~sap~~~~~~~~~~~~~~~~v~~~~~~~~~~c~~~~~~~~~~i~~~~~~~~~~~~l~~~f~~~~~~~~~~di~~~  267 (337)
                      .|+|++|||+.+..++.++++|++.+.+.+...+++|.+.++++++.|++++.++ ..+.+++.|++|.++++..|+..+
T Consensus       154 ~ga~ASSApv~a~~df~~y~~~~~~v~~~~~~~~~~C~~~i~~a~~~i~~~~~~~-~~~~~~~~f~~c~~~~~~~d~~~~  232 (472)
T 4ebb_A          154 AGALAASAPVLAVAGLGDSNQFFRDVTADFEGQSPKCTQGVREAFRQIKDLFLQG-AYDTVRWEFGTCQPLSDEKDLTQL  232 (472)
T ss_dssp             SEEEEETCCTTGGGTCSCTTHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHT-CHHHHHHHHTBSSCCCSHHHHHHH
T ss_pred             EEEEecccceEEeccccccHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHHhcc-hHHHHHHHhcCCCCCCChHHHHHH
Confidence            9999999999999888889999999998887778899999999999999988765 477899999999999999999999


Q ss_pred             HHHHHHHHhhhhhccCCCCCCCCCCCCCCchhhHHHHHhh
Q psy1220         268 KRYLSDMYTTMAMTNYPYPSNFLTPLPGNPVKVDVAIFKR  307 (337)
Q Consensus       268 ~~~~~~~~~~~am~~y~~~~~~l~~~~~~pv~~icg~~~~  307 (337)
                      +.++.+.+...+|.+||+..+++..+++.|+..+|..+.+
T Consensus       233 ~~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~c~~~~~  272 (472)
T 4ebb_A          233 FMFARNAFTVLAMMDYPYPTDFLGPLPANPVKVGCDRLLS  272 (472)
T ss_dssp             HHHHHHHHHHHHHTCCSSCEESSSEECSSHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHhhhccccchhhcccCccchHHHHHHHhcc
Confidence            9999999999999999999999999998999999998765



>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query337
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.8
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.77
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.77
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 99.77
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.77
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.76
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.75
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 99.75
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 99.73
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.73
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.72
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 99.71
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 99.7
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.7
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 99.69
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.68
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.68
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 99.66
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.64
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 99.64
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 99.64
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 99.63
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.61
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 99.59
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 99.57
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.56
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 99.55
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.55
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 99.54
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 99.54
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 99.51
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 99.51
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 99.49
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 99.38
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 99.32
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 99.2
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 99.16
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 99.16
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 99.15
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 99.14
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 99.05
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 98.99
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 98.95
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 98.9
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 98.83
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 98.83
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 98.83
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 98.82
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 98.8
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 98.79
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 98.79
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 98.78
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 98.75
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 98.73
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 98.71
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 98.71
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 98.7
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 98.69
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 98.68
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 98.67
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 98.64
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 98.59
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 98.55
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 98.5
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 98.46
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 98.42
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 98.42
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 98.35
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 98.33
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 98.3
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 98.29
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 98.22
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 98.17
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 98.15
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 98.11
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 98.09
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 98.09
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 97.87
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 97.85
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 97.84
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 97.38
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 97.3
d1ac5a_ 483 Serine carboxypeptidase II {Baker's yeast (Sacchar 97.03
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 96.94
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 96.85
d1wpxa1 421 Serine carboxypeptidase II {Baker's yeast (Sacchar 96.8
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 96.77
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 96.75
g1gxs.1425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 96.72
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 96.72
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 96.7
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 96.63
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 96.61
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 96.45
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 96.43
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 96.16
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 96.13
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 96.13
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 95.9
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 95.79
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 95.68
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 95.59
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 94.6
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 87.28
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 80.82
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carbon-carbon bond hydrolase
domain: 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD)
species: Burkholderia xenovorans [TaxId: 36873]
Probab=99.80  E-value=2e-19  Score=159.17  Aligned_cols=108  Identities=14%  Similarity=0.145  Sum_probs=85.3

Q ss_pred             CCCCcEEEEeCCCCCccchhhhhHHHHHHHHhcCCcEEEecccccccCCCCCCCCCCCCcccccCCHHHHHHHHHHHHHH
Q psy1220          67 DGGAPVFFYCGNEDAIETFAENLGFLWESAKRFSARVVLVEHRYYGSSLPFGPKSLSSPRLSGYLTVAQTLADFVDVIQS  146 (337)
Q Consensus        67 ~~~~pivl~hGg~g~~~~~~~~~~~~~~la~~~~~~vi~~D~rg~G~S~~~~~~s~~~~~~~~~~t~~~~~~D~~~~i~~  146 (337)
                      |+|.||||+||.+++...|......+..+++ .|++|+++|+||||.|.+...         ...+....++|+.+++++
T Consensus        28 G~G~~ivllHG~~~~~~~~~~~~~~l~~~~~-~g~~v~~~D~~G~G~S~~~~~---------~~~~~~~~~~~i~~li~~   97 (283)
T d2rhwa1          28 GNGETVIMLHGGGPGAGGWSNYYRNVGPFVD-AGYRVILKDSPGFNKSDAVVM---------DEQRGLVNARAVKGLMDA   97 (283)
T ss_dssp             CCSSEEEEECCCSTTCCHHHHHTTTHHHHHH-TTCEEEEECCTTSTTSCCCCC---------SSCHHHHHHHHHHHHHHH
T ss_pred             cCCCeEEEECCCCCChhHHHHHHHHHHHHHH-CCCEEEEEeCCCCcccccccc---------cccccchhhhhccccccc
Confidence            4467899999998887777543222344443 478999999999999976422         224466678899999988


Q ss_pred             HHhhhhhhccCCCCCCCEEEEecchhHHHHHHHHHhCCCceeEeeecCcc
Q psy1220         147 LEDASRLRIGAAFKPHPVIAFGGSYGGMLAFWLRLKYPHIVQGALASSAP  196 (337)
Q Consensus       147 l~~~~~~~~~~~~~~~~~il~G~S~GG~la~~~~~~~P~~v~~~v~~sap  196 (337)
                      ++       .     .+++++||||||.+|+.++.++|+.|.++|+.+++
T Consensus        98 l~-------~-----~~~~lvGhS~Gg~ia~~~a~~~p~~v~~lil~~~~  135 (283)
T d2rhwa1          98 LD-------I-----DRAHLVGNAMGGATALNFALEYPDRIGKLILMGPG  135 (283)
T ss_dssp             HT-------C-----CCEEEEEETHHHHHHHHHHHHCGGGEEEEEEESCS
T ss_pred             cc-------c-----cccccccccchHHHHHHHHHHhhhhcceEEEeCCC
Confidence            77       4     68999999999999999999999999999977654



>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure