Psyllid ID: psy12258


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MCDTCGKSFFSSTALKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRVRSDMKRHLNTHNVDARQYLTVTGSQTGAPIKKEPKQECNGDYWSYES
ccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHHHHccccEEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHccccccccccccccEccccHHHHHHHHccccccccc
mcdtcgksffsstaLKVHNrvhlglkpygcevcgrhfrqwgdlkyhkaslhsdvkafqceycgkdfarKYSLVVHRRihtgernyqcefchkafrassylqnhrrihtgekphfcpvcnkMFRVRSDMKRHLNTHNVDARQYLTvtgsqtgapikkepkqecngdywsyes
mcdtcgksffsstalkvhnRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRIhtgekphfcpvCNKMFRVRSDMKRHLNthnvdarqyltvtgsqtgapikkepkqecngdywsyes
MCDTCGKSFFSSTALKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRVRSDMKRHLNTHNVDARQYLTVTGSQTGAPIKKEPKQECNGDYWSYES
*****GKSFFSSTALKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRVRSDMKRHLNTHNVDARQYLTV**************************
MCDTCGKSFFSSTALKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRVRSDMKRHLNTHNVDARQYLTVTGSQTGAPIKKEPKQECNGD**SY**
MCDTCGKSFFSSTALKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRVRSDMKRHLNTHNVDARQYLTVTGSQTGAPIKKEPKQECNGDYWSYES
MCDTCGKSFFSSTALKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRVRSDMKRHLNTHNVDARQYLTVTGSQTGAPIKKEPKQECNG*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCDTCGKSFFSSTALKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRVRSDMKRHLNTHNVDARQYLTVTGSQTGAPIKKEPKQECNGDYWSYES
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query171 2.2.26 [Sep-21-2011]
Q9UK10 706 Zinc finger protein 225 O yes N/A 0.777 0.188 0.514 7e-33
Q8NDQ6660 Zinc finger protein 540 O no N/A 0.789 0.204 0.492 2e-32
Q5R5S6660 Zinc finger protein 540 O no N/A 0.789 0.204 0.492 2e-32
Q8IWY8852 Zinc finger and SCAN doma no N/A 0.783 0.157 0.488 2e-31
Q8NB50 900 Zinc finger protein 62 ho no N/A 0.777 0.147 0.5 3e-31
Q12901 538 Zinc finger protein 155 O no N/A 0.783 0.249 0.503 4e-31
P85977 480 Zinc finger protein (Frag N/A N/A 0.795 0.283 0.489 7e-31
Q14591 655 Zinc finger protein 271 O no N/A 0.777 0.203 0.485 7e-31
A6NN14 1173 Zinc finger protein 729 O no N/A 0.783 0.114 0.503 7e-31
A8MTY0619 Putative zinc finger prot no N/A 0.777 0.214 0.485 8e-31
>sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 Back     alignment and function desciption
 Score =  139 bits (351), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 91/134 (67%), Gaps = 1/134 (0%)

Query: 2   CDTCGKSFFSSTALKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEY 61
           CD CGKSF  S+AL++H RVH+G K Y C+VCG+ F Q   L+ H+  +H+  K F+CE 
Sbjct: 178 CDECGKSFCYSSALRIHQRVHMGEKLYNCDVCGKEFNQSSHLQIHQ-RIHTGEKPFKCEQ 236

Query: 62  CGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKM 121
           CGK F+R+  L VHR++HTG + + CE C KAF   S LQ H+RIHTGEKP  C +C K 
Sbjct: 237 CGKGFSRRSGLYVHRKLHTGVKPHICEKCGKAFIHDSQLQEHQRIHTGEKPFKCDICCKS 296

Query: 122 FRVRSDMKRHLNTH 135
           FR R+++ RH   H
Sbjct: 297 FRSRANLNRHSMVH 310




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 Back     alignment and function description
>sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 Back     alignment and function description
>sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 Back     alignment and function description
>sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=2 SV=3 Back     alignment and function description
>sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=2 SV=4 Back     alignment and function description
>sp|P85977|ZNFP_CHLAE Zinc finger protein (Fragment) OS=Chlorocebus aethiops PE=1 SV=1 Back     alignment and function description
>sp|Q14591|ZN271_HUMAN Zinc finger protein 271 OS=Homo sapiens GN=ZNF271 PE=2 SV=4 Back     alignment and function description
>sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=3 Back     alignment and function description
>sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
383853992 649 PREDICTED: zinc finger protein 195-like 0.789 0.208 0.777 3e-61
350411473 647 PREDICTED: zinc finger protein 45-like [ 0.789 0.208 0.770 9e-61
380020763 644 PREDICTED: zinc finger protein 227-like 0.789 0.209 0.770 9e-61
340729771 647 PREDICTED: zinc finger protein 45-like [ 0.789 0.208 0.770 9e-61
328787424 646 PREDICTED: zinc finger protein 227-like 0.789 0.208 0.770 9e-61
242009920 900 zinc finger protein, putative [Pediculus 0.918 0.174 0.670 3e-60
270005714 779 hypothetical protein TcasGA2_TC007815 [T 0.730 0.160 0.777 7e-59
91080335 696 PREDICTED: similar to AGAP010009-PA [Tri 0.730 0.179 0.777 9e-59
332016289 642 Zinc finger protein 192 [Acromyrmex echi 0.789 0.210 0.748 9e-59
328722486 756 PREDICTED: zinc finger protein 611-like 0.994 0.224 0.634 1e-57
>gi|383853992|ref|XP_003702506.1| PREDICTED: zinc finger protein 195-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  239 bits (610), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 105/135 (77%), Positives = 119/135 (88%)

Query: 2   CDTCGKSFFSSTALKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEY 61
           C+ CGKSFF+ +ALKVH R+H G KPY CE CGRHFRQWGDLKYH  S+HS+ K +QCEY
Sbjct: 415 CEVCGKSFFAPSALKVHKRLHSGDKPYKCEECGRHFRQWGDLKYHSTSIHSEQKQYQCEY 474

Query: 62  CGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKM 121
           CGKDFARKYSL+VHRRIHTGE+NY+CEFC+K FRASSYLQNHRRIHTGEKPH C VC K 
Sbjct: 475 CGKDFARKYSLIVHRRIHTGEKNYRCEFCNKTFRASSYLQNHRRIHTGEKPHPCTVCGKR 534

Query: 122 FRVRSDMKRHLNTHN 136
           FRVRSDMKRH++TH+
Sbjct: 535 FRVRSDMKRHMHTHS 549




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350411473|ref|XP_003489363.1| PREDICTED: zinc finger protein 45-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380020763|ref|XP_003694248.1| PREDICTED: zinc finger protein 227-like [Apis florea] Back     alignment and taxonomy information
>gi|340729771|ref|XP_003403169.1| PREDICTED: zinc finger protein 45-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328787424|ref|XP_395120.3| PREDICTED: zinc finger protein 227-like [Apis mellifera] Back     alignment and taxonomy information
>gi|242009920|ref|XP_002425730.1| zinc finger protein, putative [Pediculus humanus corporis] gi|212509631|gb|EEB12992.1| zinc finger protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|270005714|gb|EFA02162.1| hypothetical protein TcasGA2_TC007815 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91080335|ref|XP_974602.1| PREDICTED: similar to AGAP010009-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332016289|gb|EGI57202.1| Zinc finger protein 192 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|328722486|ref|XP_001946974.2| PREDICTED: zinc finger protein 611-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
FB|FBgn0031573714 CG3407 [Drosophila melanogaste 0.789 0.189 0.6 4.4e-47
UNIPROTKB|H9KYX9421 ZNF517 "Uncharacterized protei 0.812 0.330 0.475 1.9e-35
UNIPROTKB|Q9UK10 706 ZNF225 "Zinc finger protein 22 0.777 0.188 0.514 3.1e-35
UNIPROTKB|Q8NDQ6660 ZNF540 "Zinc finger protein 54 0.789 0.204 0.492 6.3e-35
UNIPROTKB|F1MUM4460 ZNF500 "Uncharacterized protei 0.777 0.289 0.470 7.4e-34
UNIPROTKB|Q12901 538 ZNF155 "Zinc finger protein 15 0.777 0.247 0.507 8.7e-34
UNIPROTKB|F1MX34 1053 F1MX34 "Uncharacterized protei 0.777 0.126 0.492 1.1e-33
UNIPROTKB|J3KQ08 549 ZNF155 "Zinc finger protein 15 0.777 0.242 0.507 1.1e-33
UNIPROTKB|Q9UK13 617 ZNF221 "Zinc finger protein 22 0.777 0.215 0.514 1.2e-33
ZFIN|ZDB-GENE-110913-29 443 si:ch73-289h5.2 "si:ch73-289h5 0.807 0.311 0.467 1.5e-33
FB|FBgn0031573 CG3407 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 494 (179.0 bits), Expect = 4.4e-47, P = 4.4e-47
 Identities = 81/135 (60%), Positives = 103/135 (76%)

Query:     2 CDTCGKSFFSSTALKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEY 61
             CD+C +SF++ +ALK H R H G+KP+ C+ C   FRQWGDLKYH  S HSDVKA  CE+
Sbjct:   525 CDSCERSFYTQSALKAHERTHSGVKPFKCDKCEFQFRQWGDLKYHIISRHSDVKAHMCEF 584

Query:    62 CGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKM 121
             CGK F+R+YSLVVHRRIHT E+NY C++C K FRASSYL +H ++HTGE+P+ C +C K 
Sbjct:   585 CGKSFSRRYSLVVHRRIHTREKNYACQYCDKTFRASSYLLSHIKVHTGERPYECSICEKK 644

Query:   122 FRVRSDMKRHLNTHN 136
             FRV  D+KRH   H+
Sbjct:   645 FRVSGDLKRHSRIHD 659


GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
UNIPROTKB|H9KYX9 ZNF517 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UK10 ZNF225 "Zinc finger protein 225" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NDQ6 ZNF540 "Zinc finger protein 540" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MUM4 ZNF500 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q12901 ZNF155 "Zinc finger protein 155" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MX34 F1MX34 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J3KQ08 ZNF155 "Zinc finger protein 155" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UK13 ZNF221 "Zinc finger protein 221" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-29 si:ch73-289h5.2 "si:ch73-289h5.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9UK10ZN225_HUMANNo assigned EC number0.51490.77770.1883yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
COG5048 467 COG5048, COG5048, FOG: Zn-finger [General function 7e-04
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.001
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.003
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
 Score = 38.9 bits (90), Expect = 7e-04
 Identities = 20/57 (35%), Positives = 23/57 (40%), Gaps = 4/57 (7%)

Query: 83  RNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRVRSDM---KRHLNTHN 136
           R   C  C  +F    +L  H R HTGEKP  C          S      RHL TH+
Sbjct: 32  RPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSYSGCDKS-FSRPLELSRHLRTHH 87


Length = 467

>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 171
KOG2462|consensus279 99.97
KOG2462|consensus279 99.91
KOG1074|consensus 958 99.85
KOG3608|consensus 467 99.84
KOG3576|consensus267 99.77
KOG1074|consensus958 99.77
KOG3608|consensus467 99.75
KOG3576|consensus267 99.75
KOG3623|consensus 1007 99.68
KOG3623|consensus1007 99.62
PLN03086567 PRLI-interacting factor K; Provisional 99.41
PHA00733128 hypothetical protein 99.26
PHA00733128 hypothetical protein 99.17
PHA0276855 hypothetical protein; Provisional 99.12
PLN03086567 PRLI-interacting factor K; Provisional 99.11
PHA0276855 hypothetical protein; Provisional 98.92
KOG3993|consensus500 98.85
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.8
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.78
KOG3993|consensus500 98.69
PHA0061644 hypothetical protein 98.57
PHA0061644 hypothetical protein 98.52
PHA0073279 hypothetical protein 98.49
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.47
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.31
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.23
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.17
PHA0073279 hypothetical protein 98.15
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.02
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.93
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.89
COG5189423 SFP1 Putative transcriptional repressor regulating 97.88
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.84
COG5189423 SFP1 Putative transcriptional repressor regulating 97.61
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.6
smart0035526 ZnF_C2H2 zinc finger. 97.53
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.44
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.44
KOG1146|consensus 1406 97.43
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.13
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.13
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.0
smart0035526 ZnF_C2H2 zinc finger. 96.97
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.96
PRK04860160 hypothetical protein; Provisional 96.94
KOG2231|consensus 669 96.67
KOG2231|consensus 669 96.57
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.53
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.11
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.03
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.84
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.65
PRK04860160 hypothetical protein; Provisional 95.5
COG5048467 FOG: Zn-finger [General function prediction only] 95.09
COG404965 Uncharacterized protein containing archaeal-type C 95.03
KOG1146|consensus1406 94.85
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 94.64
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 94.33
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.21
COG404965 Uncharacterized protein containing archaeal-type C 94.18
KOG2482|consensus423 94.08
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 93.88
KOG4173|consensus253 93.69
KOG4173|consensus253 93.67
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 93.43
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 93.1
KOG2893|consensus 341 92.43
KOG2482|consensus423 92.16
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 91.73
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 91.06
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 90.51
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 90.49
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 90.16
PHA0062659 hypothetical protein 89.82
PRK00464154 nrdR transcriptional regulator NrdR; Validated 89.73
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 89.65
KOG2893|consensus 341 89.11
PF1371937 zinc_ribbon_5: zinc-ribbon domain 88.82
COG5048467 FOG: Zn-finger [General function prediction only] 88.73
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 88.39
KOG2186|consensus 276 86.94
PF1371736 zinc_ribbon_4: zinc-ribbon domain 86.89
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 86.8
COG1592166 Rubrerythrin [Energy production and conversion] 86.66
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 86.41
PF09986214 DUF2225: Uncharacterized protein conserved in bact 86.21
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 86.17
KOG2785|consensus 390 85.87
PF09986214 DUF2225: Uncharacterized protein conserved in bact 85.79
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 85.5
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 84.88
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 84.18
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 84.13
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 83.09
PF14353128 CpXC: CpXC protein 82.9
smart00531147 TFIIE Transcription initiation factor IIE. 82.51
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 81.86
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 81.85
PRK06266178 transcription initiation factor E subunit alpha; V 81.6
PRK06266178 transcription initiation factor E subunit alpha; V 80.65
>KOG2462|consensus Back     alignment and domain information
Probab=99.97  E-value=1.7e-32  Score=185.35  Aligned_cols=131  Identities=37%  Similarity=0.750  Sum_probs=124.3

Q ss_pred             CCCccccccCChhhHHHHHHHcCC---CCCeeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhccChHHHHHHHh
Q psy12258          1 MCDTCGKSFFSSTALKVHNRVHLG---LKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRR   77 (171)
Q Consensus         1 ~C~~C~~~f~~~~~l~~H~~~h~~---~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~   77 (171)
                      +|++|++.+.+..+|.+|.+.|..   .+.+.|++|++.+.+...|..|++ +|.  -+.+|.+||+.|...|.|+.|++
T Consensus       132 ~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHir-TH~--l~c~C~iCGKaFSRPWLLQGHiR  208 (279)
T KOG2462|consen  132 KCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIR-THT--LPCECGICGKAFSRPWLLQGHIR  208 (279)
T ss_pred             eccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhh-ccC--CCcccccccccccchHHhhcccc
Confidence            699999999999999999999876   467999999999999999999998 575  57899999999999999999999


Q ss_pred             hhcCCCCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccCCchhHHHHHHH
Q psy12258         78 IHTGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRVRSDMKRHLNT  134 (171)
Q Consensus        78 ~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  134 (171)
                      .|+|+|||.|+.|+++|...+.|+.|+++|.+.++|.|..|+|.|...+.|.+|...
T Consensus       209 THTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  209 THTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             cccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            999999999999999999999999999999999999999999999999999999764



>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-27
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 4e-17
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 3e-15
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 3e-14
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 5e-08
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 6e-14
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 4e-06
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 1e-13
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 9e-13
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 1e-12
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 2e-12
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-12
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 3e-12
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 4e-12
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 4e-12
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 5e-12
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 5e-12
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-11
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 4e-11
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 5e-11
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 9e-11
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 3e-10
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 7e-10
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 9e-10
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 1e-08
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-08
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-07
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-08
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-07
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 2e-08
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 3e-08
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 7e-08
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 3e-07
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 5e-07
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 1e-06
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 3e-06
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 5e-06
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 7e-06
2ct1_A77 Solution Structure Of The Zinc Finger Domain Of Tra 1e-05
2ep0_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-05
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 2e-05
2em6_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-05
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 5e-05
2ena_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-05
2emw_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-05
2emw_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2eor_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-05
2ene_A46 Solution Structure Of The C2h2 Type Zinc Finger (re 8e-05
2eog_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2ytp_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2eme_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2eq1_A46 Solution Structure Of The 9th C2h2 Type Zinc Finger 2e-04
2epu_A45 Solution Structure Of The Secound C2h2 Type Zinc Fi 2e-04
2eon_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 3e-04
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 3e-04
2ytk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2ytr_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2yth_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2emk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2yta_A41 Solution Structure Of C2h2 Type Zinc Finger Domain 4e-04
2dlk_A79 Solution Structure Of The First And The Second Zf-C 6e-04
2em2_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2eq2_A46 Solution Structure Of The 16th C2h2 Type Zinc Finge 7e-04
2ysv_A42 Solution Structure Of C2h2 Type Zinc Finger Domain 7e-04
2emf_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
2eoe_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 9e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 118 bits (295), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 58/138 (42%), Positives = 79/138 (57%), Gaps = 1/138 (0%) Query: 1 MCDTCGKSFFSSTALKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCE 60 C CGKSF S L H R H G KPY C CG+ F DL H+ + H+ K ++C Sbjct: 23 ACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRT-HTGEKPYKCP 81 Query: 61 YCGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNK 120 CGK F+++ +L H+R HTGE+ Y C C K+F ++L+ H+R HTGEKP+ CP C K Sbjct: 82 ECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGK 141 Query: 121 MFRVRSDMKRHLNTHNVD 138 F ++ H TH + Sbjct: 142 SFSREDNLHTHQRTHTGE 159
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2CT1|A Chain A, Solution Structure Of The Zinc Finger Domain Of Transcriptional Repressor Ctcf Protein Length = 77 Back     alignment and structure
>pdb|2EP0|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 528- 560) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2EM6|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 199- 231) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2ENA|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 311- 343) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EMW|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 301- 331) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2EMW|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 301- 331) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2EOR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 255- 287) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2ENE|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (region 592- 624) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EOG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 693- 723) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2YTP|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 687- 719) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EME|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 725- 757) Of Human Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2EQ1|A Chain A, Solution Structure Of The 9th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EPU|A Chain A, Solution Structure Of The Secound C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 32 Length = 45 Back     alignment and structure
>pdb|2EON|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 397- 429) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|2YTK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 396- 428) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 760- 792) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 479- 511) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EMK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 668- 700) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2YTA|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 3 In Zinc Finger Protein 32 Length = 41 Back     alignment and structure
>pdb|2DLK|A Chain A, Solution Structure Of The First And The Second Zf-C2h2 Domains Of Zinc Finger Protein 692 Length = 79 Back     alignment and structure
>pdb|2EM2|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 584- 616) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EQ2|A Chain A, Solution Structure Of The 16th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YSV|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 17 In Zinc Finger Protein 473 Length = 42 Back     alignment and structure
>pdb|2EMF|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 379- 411) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EOE|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 508- 540) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 9e-45
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-44
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-41
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-37
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 8e-37
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-33
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-26
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-08
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-36
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 9e-32
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-36
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-23
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-35
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-25
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-24
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-10
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-34
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-31
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-33
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-30
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-07
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 5e-05
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-33
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-21
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-14
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-33
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-27
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 9e-19
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-33
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-30
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-14
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-29
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 7e-26
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 9e-29
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-28
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-12
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 9e-28
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 6e-27
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-26
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-25
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-25
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-21
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 7e-24
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-22
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 7e-13
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 9e-24
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-22
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-12
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-23
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 7e-15
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-08
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-23
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-21
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-08
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-04
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-23
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-22
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 6e-13
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-09
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-22
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-20
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-07
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-21
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-20
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-11
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-21
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-18
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-21
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-17
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-13
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-19
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-14
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 7e-10
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-19
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-15
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-15
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-19
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-17
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-15
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-15
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-17
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-16
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-16
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-16
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-16
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-16
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-16
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-16
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-16
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-16
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-06
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-16
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-16
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-16
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-16
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-16
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-16
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-16
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-16
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-16
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-16
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-16
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-16
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 9e-16
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-15
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-15
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-15
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-15
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-15
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-15
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-15
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 6e-08
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-15
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 7e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 7e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-15
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-15
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-15
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-15
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-09
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-15
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-15
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-09
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-15
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-15
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-15
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-15
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-15
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-06
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-15
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-15
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-15
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-15
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-15
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-15
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-05
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-15
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-15
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-15
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-06
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-15
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-15
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-15
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-15
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-15
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-15
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-15
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-15
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-15
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 5e-15
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-15
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-13
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-15
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-15
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-14
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 9e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-14
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 8e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-14
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-14
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-14
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-14
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-14
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-14
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-09
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-14
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-09
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-06
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-14
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-14
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 7e-12
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-14
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-05
2epa_A72 Krueppel-like factor 10; transforming growth facto 5e-14
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-11
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-14
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 8e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-14
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-09
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-14
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-14
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-14
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-09
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-05
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-13
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-09
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-05
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-13
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 8e-09
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 7e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-13
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-13
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-09
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 5e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 4e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-13
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-10
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-07
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 6e-13
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 7e-07
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 9e-04
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-13
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-12
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 8e-08
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 9e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-12
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 5e-10
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 6e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 6e-12
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 7e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-11
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-10
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 8e-07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-09
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-08
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-08
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 4e-08
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 5e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 4e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 4e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-05
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 2e-05
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 7e-04
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 3e-05
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 4e-05
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 3e-04
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 2e-04
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 3e-04
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 3e-04
1ard_A29 Yeast transcription factor ADR1; transcription reg 8e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  144 bits (367), Expect = 9e-45
 Identities = 58/134 (43%), Positives = 73/134 (54%), Gaps = 1/134 (0%)

Query: 2   CDTCGKSFFSSTALKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEY 61
           C  CGKSF     L  H R H G KPY C  CG+ F Q  +L+ H+   H+  K + C  
Sbjct: 52  CPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQ-RTHTGEKPYACPE 110

Query: 62  CGKDFARKYSLVVHRRIHTGERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKM 121
           CGK F++   L  H+R HTGE+ Y+C  C K+F     L  H+R HTGEKP+ CP C K 
Sbjct: 111 CGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKS 170

Query: 122 FRVRSDMKRHLNTH 135
           F  R  +  H  TH
Sbjct: 171 FSRRDALNVHQRTH 184


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 36 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 36 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.97
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.96
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.96
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.96
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.94
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.94
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.93
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.92
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.92
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.92
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.92
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.9
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.9
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.89
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.87
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.86
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.85
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.85
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.85
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.85
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.84
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.83
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.83
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.82
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.82
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.81
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.81
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.8
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.8
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.79
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.79
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.79
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.78
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.76
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.74
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.73
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.73
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.73
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.71
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.71
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.7
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.7
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.69
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.69
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.66
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.65
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.65
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.65
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.65
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.64
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.64
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.64
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.62
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.62
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.61
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.6
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.6
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.6
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.6
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.6
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.59
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.58
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.57
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.56
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.55
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.54
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.54
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.53
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.53
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.5
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.5
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.5
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.47
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.47
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.46
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.44
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.43
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.42
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.4
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.39
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.37
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.33
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.32
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.31
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.31
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.31
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.3
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.3
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.3
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.29
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.29
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.28
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.28
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.27
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.26
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.26
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.22
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.21
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.2
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.2
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.18
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.18
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.18
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.17
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.17
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.17
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.16
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.16
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.16
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.16
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.16
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.16
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.15
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.14
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.14
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.14
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.13
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.12
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.12
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.1
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.1
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.1
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.1
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.1
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.1
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.1
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.09
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.08
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.08
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.08
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.03
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.03
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.02
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.02
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.01
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.0
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.99
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.99
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.98
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.98
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.96
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.94
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.94
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.94
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.9
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.9
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.87
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.85
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.84
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.84
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.81
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.8
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.8
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.8
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.78
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.76
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.75
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.74
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.69
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.69
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.69
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.66
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.66
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.66
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.66
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.65
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.64
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.63
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.63
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.62
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.57
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.56
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.54
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.53
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.52
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.52
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.51
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.51
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.51
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.51
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.5
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.5
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.49
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.49
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.49
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.47
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.47
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.47
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.46
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.46
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.45
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.82
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.43
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.42
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.76
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.38
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.73
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.34
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.29
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.29
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.28
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.28
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.27
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.24
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.23
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.23
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.23
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.23
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.22
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.2
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.18
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.17
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.16
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.16
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.45
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.15
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.13
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.4
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.07
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.26
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.0
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.99
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.88
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.75
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.33
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.04
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.76
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.56
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.29
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.91
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.91
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.57
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.47
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.07
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 91.31
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 90.55
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 90.48
2k5c_A95 Uncharacterized protein PF0385; structural genomic 88.67
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 88.62
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 88.1
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 87.0
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 86.54
2i5o_A39 DNA polymerase ETA; zinc finger, DNA polymerase,PO 86.2
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 85.51
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 84.7
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 84.38
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 83.93
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 83.43
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 81.94
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=9.4e-34  Score=190.09  Aligned_cols=136  Identities=43%  Similarity=0.842  Sum_probs=66.1

Q ss_pred             CCccccccCChhhHHHHHHHcCCCCCeeCCccchhccCcccHHHhhhhcCCCCCcccccchhhhccChHHHHHHHhhhcC
Q psy12258          2 CDTCGKSFFSSTALKVHNRVHLGLKPYGCEVCGRHFRQWGDLKYHKASLHSDVKAFQCEYCGKDFARKYSLVVHRRIHTG   81 (171)
Q Consensus         2 C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~~~~   81 (171)
                      |+.|+..|.....|..|++.|.++++|.|+.|++.|.....|..|++ .|.++++|.|..|++.|.+...|..|+..|++
T Consensus        24 C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~-~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  102 (190)
T 2i13_A           24 CPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQR-THTGEKPYKCPECGKSFSQRANLRAHQRTHTG  102 (190)
T ss_dssp             -------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHH-HHHCCCCEECTTTCCEESCHHHHHHHHHHHHT
T ss_pred             CCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHH-hcCCCCCccCcccCCccCCHHHHHHHHHhcCC
Confidence            45555555555555555555555555555555555555555555554 34444455555555555555555555555555


Q ss_pred             CCCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccCCchhHHHHHHHhccC
Q psy12258         82 ERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRVRSDMKRHLNTHNVD  138 (171)
Q Consensus        82 ~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~  138 (171)
                      +++|.|+.|++.|.....|..|++.|+++++|.|++|++.|.+.+.|..|+++|+++
T Consensus       103 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~  159 (190)
T 2i13_A          103 EKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGE  159 (190)
T ss_dssp             CCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCC
T ss_pred             CCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCC
Confidence            555555555555555555555555555555555555555555555555555555443



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 171
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-11
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-08
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 7e-10
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.001
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 9e-10
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-09
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 7e-09
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 7e-09
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-08
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 4e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 5e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-07
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-08
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 4e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-07
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-07
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 7e-07
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 8e-07
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 1e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 3e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.003
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-06
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 2e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 4e-05
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 5e-05
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 7e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 7e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 6e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 2e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 4e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-04
d2epra135 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [ 0.002
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 24
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 53.0 bits (128), Expect = 4e-11
 Identities = 19/33 (57%), Positives = 23/33 (69%)

Query: 78  IHTGERNYQCEFCHKAFRASSYLQNHRRIHTGE 110
           IH+GE+ Y C  C KAF  SS L  H+R+HTGE
Sbjct: 1   IHSGEKPYGCVECGKAFSRSSILVQHQRVHTGE 33


>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.73
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.59
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.36
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.35
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.35
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.32
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.29
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.29
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.26
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.22
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.19
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.15
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.12
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.12
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.1
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.07
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.05
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.04
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.02
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.01
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.98
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.98
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.95
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.94
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.94
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.89
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.85
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.81
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.81
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.76
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.73
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.72
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.69
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.68
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.64
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.6
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.58
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.47
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.41
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.4
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.36
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.32
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.3
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.29
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.23
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.22
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.15
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.11
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.05
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.02
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.01
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 98.0
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.98
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.94
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.92
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.84
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.83
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.8
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.73
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.72
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.7
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.69
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.59
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.58
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.54
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.53
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.49
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.46
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.4
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.36
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.32
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.27
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.24
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.21
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.16
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.12
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.05
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.04
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.99
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.94
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.93
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.68
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.55
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.55
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.5
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.46
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.45
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.33
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 96.27
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.26
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.13
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.99
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.87
d1y0jb136 U-shaped transcription factor, different fingers { 95.5
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.46
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.29
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.27
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 94.79
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.69
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.64
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 94.61
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.49
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.19
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 94.01
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.87
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 93.61
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 92.6
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 91.77
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.12
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 91.09
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 90.64
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 90.58
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 89.29
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 88.57
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 88.15
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 88.14
d2yrka148 Zinc finger homeobox protein 4, ZFHX4 {Human (Homo 85.32
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 84.46
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 83.74
d1fu9a_36 U-shaped transcription factor, different fingers { 82.18
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.73  E-value=8.3e-19  Score=91.47  Aligned_cols=53  Identities=32%  Similarity=0.712  Sum_probs=50.0

Q ss_pred             CCCccCccchhhcCCHHHHHHHHHHhcCCCCccCcccccccCCchhHHHHHHHh
Q psy12258         82 ERNYQCEFCHKAFRASSYLQNHRRIHTGEKPHFCPVCNKMFRVRSDMKRHLNTH  135 (171)
Q Consensus        82 ~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  135 (171)
                      ++||.| .||+.|.....|..|+++|++++||.|++||++|...+.|..|+++|
T Consensus         1 EK~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            589999 49999999999999999999999999999999999999999999876



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure