Psyllid ID: psy12281
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 456 | ||||||
| 345483547 | 411 | PREDICTED: jmjC domain-containing protei | 0.741 | 0.822 | 0.488 | 1e-91 | |
| 307208074 | 422 | JmjC domain-containing protein 4 [Harpeg | 0.767 | 0.829 | 0.465 | 5e-87 | |
| 322803082 | 420 | hypothetical protein SINV_05930 [Solenop | 0.769 | 0.835 | 0.455 | 2e-85 | |
| 383862030 | 419 | PREDICTED: jmjC domain-containing protei | 0.765 | 0.832 | 0.462 | 9e-85 | |
| 328789207 | 419 | PREDICTED: jmjC domain-containing protei | 0.769 | 0.837 | 0.457 | 3e-84 | |
| 340726915 | 419 | PREDICTED: jmjC domain-containing protei | 0.758 | 0.825 | 0.449 | 5e-84 | |
| 307182696 | 421 | JmjC domain-containing protein 4 [Campon | 0.752 | 0.814 | 0.461 | 6e-84 | |
| 350421437 | 419 | PREDICTED: jmjC domain-containing protei | 0.769 | 0.837 | 0.443 | 7e-84 | |
| 332031019 | 418 | JmjC domain-containing protein 4 [Acromy | 0.800 | 0.873 | 0.437 | 1e-83 | |
| 380018919 | 419 | PREDICTED: jmjC domain-containing protei | 0.769 | 0.837 | 0.448 | 2e-83 |
| >gi|345483547|ref|XP_001601156.2| PREDICTED: jmjC domain-containing protein 4-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 343 bits (879), Expect = 1e-91, Method: Compositional matrix adjust.
Identities = 170/348 (48%), Positives = 223/348 (64%), Gaps = 10/348 (2%)
Query: 94 SHIYPYCFNNFLSKNKPFILKSCVN-EWNSSLHWVQNKQPNFEYLSNHYGDIEVPVANCN 152
S Y F +FL NKP I + + +W+S HW + PNFE+L +G+ +VP+A+CN
Sbjct: 31 SMAYNEFFEDFLIPNKPCIFDAEITKDWSSRRHWNTDNAPNFEWLKECFGNCKVPIADCN 90
Query: 153 SYYFNAHEKTNMTLKEYTIYWQNKIDGKLSETEPLYYLKDWHFTRDFKTEDIYRVPNVFS 212
YFNA K +M ++ Y YW + + S PL YLKDWH + IY VP F+
Sbjct: 91 KRYFNAQHKDDMLIRAYIDYWIDYRNCNYSNKMPLLYLKDWHCIKSHSNISIYNVPKYFA 150
Query: 213 SDWLNEYYSEHLEHKDDYRFVYMGPKETWTPLHADVFHSYSWSVNICGRKQWLLLAPGNE 272
SDWLNEYY+ H DDY FVYMGPK TWTP H DVF SYSWS NI G+K+WLL PG E
Sbjct: 151 SDWLNEYYTAHPNLNDDYMFVYMGPKGTWTPFHVDVFTSYSWSANIVGKKRWLLFPPGQE 210
Query: 273 KYFKDSMGNLISDMRSVDWS-------TLPRDTVIIVE--QEAGDSIFVPSGWHHQVTNL 323
Y K+ G+L+ D+ S + T T+ +E QEAG IFVPSGWHHQV NL
Sbjct: 211 NYLKNVNGDLVYDITSAELDNASNCNYTCKNKTLKSIEVIQEAGQIIFVPSGWHHQVWNL 270
Query: 324 EHTISINHNWINGTNIDHVYHEMVSHLEAVKKEIDDCKDMDDWTSHCQLMLQVSFGINFR 383
E TISINHNW+NG NI +V++ + L AV KEI+DCKDMDDW +HCQ+ML+ SFG+N+
Sbjct: 271 EDTISINHNWLNGCNICNVWNSLRRELAAVIKEIEDCKDMDDWIAHCQIMLKASFGMNYL 330
Query: 384 QFFDMLKFICQKRLTSLKNGTTIRLYGNWILSLDHTMFDLRKASDVLK 431
QF++ L FI +KRL S+ + ++ + W+L +H +FDL++ VLK
Sbjct: 331 QFYEFLSFIAKKRLNSVISSVPVKSFETWLLGKNHCLFDLQQIRVVLK 378
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307208074|gb|EFN85605.1| JmjC domain-containing protein 4 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|322803082|gb|EFZ23170.1| hypothetical protein SINV_05930 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|383862030|ref|XP_003706487.1| PREDICTED: jmjC domain-containing protein 4-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328789207|ref|XP_395655.4| PREDICTED: jmjC domain-containing protein 4-like isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|340726915|ref|XP_003401797.1| PREDICTED: jmjC domain-containing protein 4-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|307182696|gb|EFN69820.1| JmjC domain-containing protein 4 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|350421437|ref|XP_003492843.1| PREDICTED: jmjC domain-containing protein 4-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|332031019|gb|EGI70634.1| JmjC domain-containing protein 4 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|380018919|ref|XP_003693366.1| PREDICTED: jmjC domain-containing protein 4-like [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 456 | ||||||
| MGI|MGI:2144404 | 427 | Jmjd4 "jumonji domain containi | 0.745 | 0.796 | 0.432 | 2.7e-77 | |
| ZFIN|ZDB-GENE-060929-636 | 422 | jmjd4 "jumonji domain containi | 0.767 | 0.829 | 0.418 | 4e-74 | |
| FB|FBgn0032671 | 425 | CG7200 [Drosophila melanogaste | 0.627 | 0.672 | 0.436 | 1.1e-66 | |
| WB|WBGene00011563 | 367 | jmjd-4 [Caenorhabditis elegans | 0.625 | 0.776 | 0.393 | 3.6e-50 | |
| TAIR|locus:2161967 | 462 | AT5G63080 "AT5G63080" [Arabido | 0.620 | 0.612 | 0.341 | 4.1e-49 | |
| POMBASE|SPAC25H1.02 | 464 | jmj1 "histone demethylase Jmj1 | 0.565 | 0.556 | 0.314 | 1.5e-33 | |
| DICTYBASE|DDB_G0270006 | 983 | jcdI "transcription factor jum | 0.517 | 0.240 | 0.294 | 1.1e-17 | |
| TAIR|locus:2032090 | 943 | AT1G78280 [Arabidopsis thalian | 0.495 | 0.239 | 0.263 | 2e-16 | |
| FB|FBgn0038948 | 408 | PSR "phosphatidylserine recept | 0.478 | 0.534 | 0.296 | 2.7e-15 | |
| UNIPROTKB|Q6NYC1 | 403 | JMJD6 "Bifunctional arginine d | 0.475 | 0.538 | 0.272 | 3.7e-14 |
| MGI|MGI:2144404 Jmjd4 "jumonji domain containing 4" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Score = 778 (278.9 bits), Expect = 2.7e-77, P = 2.7e-77
Identities = 155/358 (43%), Positives = 219/358 (61%)
Query: 104 FLSKNKPFILKSCVNE-WNSSLHWVQNK-QPNFEYLSNHYGDIEVPVANCNSYYFNAHEK 161
FL N P + S E W S WV ++ +P+FEYL YGD VPVANC +N++ K
Sbjct: 50 FLLPNLPCVFSSAFTEGWGSRRRWVTSEGKPDFEYLQQKYGDAVVPVANCGVREYNSNPK 109
Query: 162 TNMTLKEYTIYWQNKIDGKLSETEPLYYLKDWHFTRDFKT---EDIYRVPNVFSSDWLNE 218
+M+ ++Y YW++ I G S + YLKDWH RD EDI+ +P FSSDWLNE
Sbjct: 110 EHMSFRDYISYWKDYIQGSYSSSRGCLYLKDWHLCRDSLVNDLEDIFTLPVYFSSDWLNE 169
Query: 219 YYSEHLEHKDDYRFVYMGPKETWTPLHADVFHSYSWSVNICGRKQWLLLAPGNEKYFKDS 278
++ + + DDYRFVY GP+ TW+P HAD+F S+SWSVNICG+K+WL PG E+ +D
Sbjct: 170 FWD--VLNVDDYRFVYAGPRGTWSPFHADIFRSFSWSVNICGKKKWLFFPPGEEEALRDC 227
Query: 279 MGNLISDMRS---VDWSTLPR----DTVIIVEQEAGDSIFVPSGWHHQVTNLEHTISINH 331
GNL D+ S +D P+ I V QE G+ +FVPSGWHHQV NL+ TISINH
Sbjct: 228 HGNLPYDVTSTELLDTHLYPKIQHHSLPIEVIQEPGEMVFVPSGWHHQVYNLDDTISINH 287
Query: 332 NWINGTNIDHVYHEMVSHLEAVKKEIDDCKD-MDDWTSHCQLMLQVSFGINFRQFFDMLK 390
NW+NG N+ +++H + L+AV+ E+++ KD M DW HCQ++++ GINF +F+ LK
Sbjct: 288 NWVNGCNLPNMWHFLQQELQAVQHEVEEWKDSMPDWHHHCQVIMKSCTGINFEEFYHFLK 347
Query: 391 FICQKRLTSLKNGTTIRLYGNWILSL--DHTMFDLRKASDVLKLCAQHEDWDLKLETN 446
I +KRL L+ G + L L FD+ + +DVL + D+ +++T+
Sbjct: 348 VIAEKRLLVLEQGLKGDSGDSRSLDLGLQQAAFDIGRLADVLASVVVNPDFQ-RVDTS 404
|
|
| ZFIN|ZDB-GENE-060929-636 jmjd4 "jumonji domain containing 4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0032671 CG7200 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00011563 jmjd-4 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2161967 AT5G63080 "AT5G63080" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC25H1.02 jmj1 "histone demethylase Jmj1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0270006 jcdI "transcription factor jumonji, jmjC domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2032090 AT1G78280 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0038948 PSR "phosphatidylserine receptor" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6NYC1 JMJD6 "Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 456 | |||
| pfam05207 | 55 | pfam05207, zf-CSL, CSL zinc finger | 3e-24 | |
| pfam13621 | 247 | pfam13621, Cupin_8, Cupin-like domain | 6e-22 | |
| COG5216 | 67 | COG5216, COG5216, Uncharacterized conserved protei | 9e-22 | |
| pfam02373 | 114 | pfam02373, JmjC, JmjC domain, hydroxylase | 8e-14 | |
| smart00558 | 58 | smart00558, JmjC, A domain family that is part of | 0.003 |
| >gnl|CDD|191232 pfam05207, zf-CSL, CSL zinc finger | Back alignment and domain information |
|---|
Score = 94.6 bits (236), Expect = 3e-24
Identities = 31/51 (60%), Positives = 42/51 (82%)
Query: 6 DEIEIEDFEYDEDDETYYYPCPCGDRFQITKEQLKAGEDVATCPTCSLIIK 56
DE+E+EDFE+DE++ ++YYPC CGD F+IT+E L+ GE V CP+CSL IK
Sbjct: 1 DEVELEDFEFDEEEGSFYYPCRCGDEFEITEEDLEEGEVVVQCPSCSLWIK 51
|
This is a zinc binding motif which contains four cysteine residues which chelate zinc. This domain is often found associated with a pfam00226 domain. This domain is named after the conserved motif of the final cysteine. Length = 55 |
| >gnl|CDD|222269 pfam13621, Cupin_8, Cupin-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|227541 COG5216, COG5216, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|202224 pfam02373, JmjC, JmjC domain, hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|214721 smart00558, JmjC, A domain family that is part of the cupin metalloenzyme superfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 456 | |||
| KOG2131|consensus | 427 | 100.0 | ||
| KOG2130|consensus | 407 | 100.0 | ||
| PF13621 | 251 | Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU | 100.0 | |
| KOG2132|consensus | 355 | 99.94 | ||
| KOG2508|consensus | 437 | 99.9 | ||
| KOG2923|consensus | 67 | 99.88 | ||
| PF05207 | 55 | zf-CSL: CSL zinc finger; InterPro: IPR007872 Zinc | 99.83 | |
| COG5216 | 67 | Uncharacterized conserved protein [Function unknow | 99.78 | |
| PF08007 | 319 | Cupin_4: Cupin superfamily protein; InterPro: IPR0 | 99.61 | |
| PF02373 | 114 | JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 | 99.6 | |
| COG2850 | 383 | Uncharacterized conserved protein [Function unknow | 99.59 | |
| KOG1633|consensus | 776 | 99.3 | ||
| KOG1356|consensus | 889 | 99.0 | ||
| KOG3706|consensus | 629 | 98.8 | ||
| COG2140 | 209 | Thermophilic glucose-6-phosphate isomerase and rel | 97.39 | |
| smart00558 | 57 | JmjC A domain family that is part of the cupin met | 96.8 | |
| PF00190 | 144 | Cupin_1: Cupin; InterPro: IPR006045 This family re | 96.52 | |
| PF06560 | 182 | GPI: Glucose-6-phosphate isomerase (GPI); InterPro | 95.95 | |
| TIGR03037 | 159 | anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | 95.83 | |
| PRK04190 | 191 | glucose-6-phosphate isomerase; Provisional | 95.61 | |
| PF07883 | 71 | Cupin_2: Cupin domain; InterPro: IPR013096 This fa | 95.59 | |
| PRK13264 | 177 | 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | 95.55 | |
| KOG2132|consensus | 355 | 95.52 | ||
| TIGR03404 | 367 | bicupin_oxalic bicupin, oxalate decarboxylase fami | 95.05 | |
| TIGR02098 | 38 | MJ0042_CXXC MJ0042 family finger-like domain. This | 94.61 | |
| COG0662 | 127 | {ManC} Mannose-6-phosphate isomerase [Carbohydrate | 93.95 | |
| TIGR02272 | 335 | gentisate_1_2 gentisate 1,2-dioxygenase. This fami | 93.41 | |
| PF06052 | 151 | 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte | 93.06 | |
| COG1917 | 131 | Uncharacterized conserved protein, contains double | 92.92 | |
| smart00835 | 146 | Cupin_1 Cupin. This family represents the conserve | 92.67 | |
| TIGR03404 | 367 | bicupin_oxalic bicupin, oxalate decarboxylase fami | 91.59 | |
| COG1996 | 49 | RPC10 DNA-directed RNA polymerase, subunit RPC10 ( | 91.34 | |
| PF02041 | 167 | Auxin_BP: Auxin binding protein; InterPro: IPR0005 | 91.0 | |
| PF05523 | 131 | FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 | 90.64 | |
| KOG0958|consensus | 690 | 90.29 | ||
| COG4101 | 142 | Predicted mannose-6-phosphate isomerase [Carbohydr | 90.19 | |
| PF13717 | 36 | zinc_ribbon_4: zinc-ribbon domain | 89.94 | |
| PF13719 | 37 | zinc_ribbon_5: zinc-ribbon domain | 89.56 | |
| PF05995 | 175 | CDO_I: Cysteine dioxygenase type I; InterPro: IPR0 | 89.5 | |
| PRK13290 | 125 | ectC L-ectoine synthase; Reviewed | 88.78 | |
| COG5285 | 299 | Protein involved in biosynthesis of mitomycin anti | 88.59 | |
| PF01050 | 151 | MannoseP_isomer: Mannose-6-phosphate isomerase; In | 87.55 | |
| PF05180 | 66 | zf-DNL: DNL zinc finger; InterPro: IPR007853 Zinc | 87.02 | |
| TIGR01221 | 176 | rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en | 85.85 | |
| COG1898 | 173 | RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela | 85.39 | |
| PF13759 | 101 | 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB | 85.26 | |
| PF09723 | 42 | Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 | 84.66 | |
| smart00834 | 41 | CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C | 84.11 | |
| PLN00212 | 493 | glutelin; Provisional | 83.14 | |
| TIGR02466 | 201 | conserved hypothetical protein. This family consis | 82.84 | |
| PF09313 | 82 | DUF1971: Domain of unknown function (DUF1971); Int | 82.43 | |
| PRK09943 | 185 | DNA-binding transcriptional repressor PuuR; Provis | 82.35 | |
| PF00908 | 176 | dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer | 82.28 | |
| TIGR01479 | 468 | GMP_PMI mannose-1-phosphate guanylyltransferase/ma | 80.82 | |
| KOG3277|consensus | 165 | 80.8 |
| >KOG2131|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.1e-61 Score=468.78 Aligned_cols=340 Identities=35% Similarity=0.597 Sum_probs=279.3
Q ss_pred cCCCCceeeCC-CCCHHHHHHhhcCCCCcEEEecCCCccccc----ccccc-CCC-------------------------
Q psy12281 83 ALPQVDYNIDP-SHIYPYCFNNFLSKNKPFILKSCVNEWNSS----LHWVQ-NKQ------------------------- 131 (456)
Q Consensus 83 ~~p~~I~ri~~-~ls~~~F~~~y~~~~~PvVi~g~~~~Wpa~----~~Wt~-~~~------------------------- 131 (456)
+.+..|+|+.. .+++.+|..+|...+.||+|.+...+|+++ ..|.. .+.
T Consensus 25 qlr~~v~r~~g~~~d~~~~a~~~~~k~~~v~is~v~~d~~~~~~~~~s~~dl~~~~~l~n~~~~f~k~~v~~~~~~v~~~ 104 (427)
T KOG2131|consen 25 QLRPCVLRLIGPTADYGDFAERDTHKRPGVLISYVLEDWPCVSRDNESGADLNNNPDLKNFARSFAKRIVQNGDKNVFLC 104 (427)
T ss_pred hhhhhhhhhcccccCcccchhhhcccCCCccccccccCcccccCCCcchhhhccCcchhHHHHHHhHHHHhcCCcccccc
Confidence 45577888865 699999999999999999999988999998 44433 222
Q ss_pred -----CChhHHHHHhCCceEEEEecCcccccCCceEEeeHHHHHHHHHhcccCCCCCCCCeeeeeccccccCCCCCcccc
Q psy12281 132 -----PNFEYLSNHYGDIEVPVANCNSYYFNAHEKTNMTLKEYTIYWQNKIDGKLSETEPLYYLKDWHFTRDFKTEDIYR 206 (456)
Q Consensus 132 -----~~~d~L~~~~Gd~~V~V~~~~~~~y~~~~~~~m~l~efl~~~~~~~~~~~~~~~~~~Yl~d~~~~~~~p~l~~y~ 206 (456)
++.++|.+.||+..|+++.|+..++.+ |+++++.-+.+...... ...+++|++|||+...+|....|.
T Consensus 105 ~~s~f~~~~~Le~ny~d~~v~~a~~~e~e~~~-----l~lad~~~~e~~~~~~~--~q~p~ly~kDwHL~~~~d~~~~~~ 177 (427)
T KOG2131|consen 105 DLSLFPDYEYLERNYGDFVVPVANCNEKERYS-----LKLADWEFREEQVQLAC--PQAPSLYGKDWHLYRFLDNDFPYW 177 (427)
T ss_pred ccccCccHHHHHhhhhhcchhhccccchhhhh-----hhhccchhHHHhHhhhc--CCCccccccchheeeecCcccccc
Confidence 355555556666666665555433222 44444444333322111 235689999999999999888999
Q ss_pred cCcccCcchhhHhhhhhccCCCccceeeeCCCCCcccccccccCccceeEEEEeEEEEEEeCCCCCcccccCCCCccccC
Q psy12281 207 VPNVFSSDWLNEYYSEHLEHKDDYRFVYMGPKETWTPLHADVFHSYSWSVNICGRKQWLLLAPGNEKYFKDSMGNLISDM 286 (456)
Q Consensus 207 ~P~~f~~D~ln~~~~~~~~~~~~~~~l~iG~~gs~T~lH~D~~~~~sW~~~i~G~Krw~L~pP~~~~~Ly~~~g~~p~d~ 286 (456)
+|.+|.+||+|+++.... .++|||+||||+|||||+|.|+++++||+++|||+|+|+|+||+++..|+++.|++|+++
T Consensus 178 ~pd~F~~dwlne~~i~~~--~ddyrFvy~Gp~gSwtp~HaDVf~s~swS~nicG~KrWl~~pP~qe~~l~dr~gnlp~~~ 255 (427)
T KOG2131|consen 178 TPDLFAKDWLNEFVIDGE--SDDYRFVYAGPAGSWTPFHADVFHSPSWSVNICGRKRWLLYPPEQEQTLADRYGNLPLPS 255 (427)
T ss_pred cchhhhhcccchhhccCC--CCceeEEEeccCCCCCccchhhhcCCcceeeeecceeEEEeChHHhhhhhhhccCcCCcc
Confidence 999999999999998766 899999999999999999999999999999999999999999999999999999999988
Q ss_pred CCcccCCCCCCceEEEEEcCCCEEEeCCCCeEEEEeCCCcEEEEeecCCCCCHHHHHHHHHHHHHHHHHhhhhcccchhH
Q psy12281 287 RSVDWSTLPRDTVIIVEQEAGDSIFVPSGWHHQVTNLEHTISINHNWINGTNIDHVYHEMVSHLEAVKKEIDDCKDMDDW 366 (456)
Q Consensus 287 ~~pd~~~fp~~~~~~~~l~pGD~LfIPsgW~H~V~nl~~sIsvn~~~~~~~nl~~~~~~l~~~~~~~~~~~~~~~~~~~~ 366 (456)
..+.+..| +.+.++++|+|||+||||+||+|||.||++||||||||+|++||.+||.+|++++.++.++|+| ..|++|
T Consensus 256 ~~~~ld~~-~~~~lei~Qepge~VFvPsGW~hQV~NL~dTISINHNW~N~~nl~~~w~~Lk~~y~a~~esisd-d~md~~ 333 (427)
T KOG2131|consen 256 WITKLDLF-RGPLLEIFQEPGETVFVPSGWHHQVLNLGDTISINHNWCNATNLAWMWDALKEDYPALAESISD-DLMDDF 333 (427)
T ss_pred cccccccc-ccchhhhhccCCceeeccCccccccccccceeeecccccccccHHHHHHHHHhhhhhhhhhhhh-hccccc
Confidence 88766543 3667999999999999999999999999999999999999999999999999999999999999 669999
Q ss_pred HHHHHHHHhhhcCCCHHHHHHHHHHHHHhhhhhcccCCccccccccccCccchhccHHHHHHHHHHhhcCCccch
Q psy12281 367 TSHCQLMLQVSFGINFRQFFDMLKFICQKRLTSLKNGTTIRLYGNWILSLDHTMFDLRKASDVLKLCAQHEDWDL 441 (456)
Q Consensus 367 ~~~~~~~l~~~~g~~~~~f~~~l~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 441 (456)
+.+||.+|++++|||+.+|+.|+++++ ++..-....+ ..++...+++|+..+-++|..|+.+.+++.
T Consensus 334 ~~~cq~~lra~~gin~~ef~~f~~~~a--~l~h~~~~~~------a~l~~s~~~~~~~~q~evl~~l~~~~~~t~ 400 (427)
T KOG2131|consen 334 PLECQFSLRATEGINANEFIYFPDFWA--MLKHATLNRD------ASLFISTFLSDWPIQPEVLPPLSWEYSITK 400 (427)
T ss_pred hhhhhhhhhhhccccccceEeehHHHH--HHHHHHhccc------hhhhHHhhhcccccchhhhcceeecCceec
Confidence 999999999999999999999999998 3333222222 235555567788888888999998888764
|
|
| >KOG2130|consensus | Back alignment and domain information |
|---|
| >PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A | Back alignment and domain information |
|---|
| >KOG2132|consensus | Back alignment and domain information |
|---|
| >KOG2508|consensus | Back alignment and domain information |
|---|
| >KOG2923|consensus | Back alignment and domain information |
|---|
| >PF05207 zf-CSL: CSL zinc finger; InterPro: IPR007872 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5216 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors | Back alignment and domain information |
|---|
| >PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] | Back alignment and domain information |
|---|
| >COG2850 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1633|consensus | Back alignment and domain information |
|---|
| >KOG1356|consensus | Back alignment and domain information |
|---|
| >KOG3706|consensus | Back alignment and domain information |
|---|
| >COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >smart00558 JmjC A domain family that is part of the cupin metalloenzyme superfamily | Back alignment and domain information |
|---|
| >PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 | Back alignment and domain information |
|---|
| >TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | Back alignment and domain information |
|---|
| >PRK04190 glucose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >KOG2132|consensus | Back alignment and domain information |
|---|
| >TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family | Back alignment and domain information |
|---|
| >TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain | Back alignment and domain information |
|---|
| >COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 | Back alignment and domain information |
|---|
| >COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >smart00835 Cupin_1 Cupin | Back alignment and domain information |
|---|
| >TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family | Back alignment and domain information |
|---|
| >COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] | Back alignment and domain information |
|---|
| >PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) | Back alignment and domain information |
|---|
| >PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] | Back alignment and domain information |
|---|
| >KOG0958|consensus | Back alignment and domain information |
|---|
| >COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF13717 zinc_ribbon_4: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF13719 zinc_ribbon_5: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF05995 CDO_I: Cysteine dioxygenase type I; InterPro: IPR010300 Cysteine dioxygenase type I (1 | Back alignment and domain information |
|---|
| >PRK13290 ectC L-ectoine synthase; Reviewed | Back alignment and domain information |
|---|
| >COG5285 Protein involved in biosynthesis of mitomycin antibiotics/polyketide fumonisin [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 | Back alignment and domain information |
|---|
| >PF05180 zf-DNL: DNL zinc finger; InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase | Back alignment and domain information |
|---|
| >COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF13759 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A | Back alignment and domain information |
|---|
| >PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria | Back alignment and domain information |
|---|
| >smart00834 CxxC_CXXC_SSSS Putative regulatory protein | Back alignment and domain information |
|---|
| >PLN00212 glutelin; Provisional | Back alignment and domain information |
|---|
| >TIGR02466 conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF09313 DUF1971: Domain of unknown function (DUF1971); InterPro: IPR015392 This uncharacterised domain is predominantly found in bacterial Tellurite resistance proteins | Back alignment and domain information |
|---|
| >PRK09943 DNA-binding transcriptional repressor PuuR; Provisional | Back alignment and domain information |
|---|
| >PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5 | Back alignment and domain information |
|---|
| >TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >KOG3277|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 456 | ||||
| 3ld8_A | 334 | Structure Of Jmjd6 And Fab Fragments Length = 334 | 5e-15 | ||
| 3k2o_A | 336 | Structure Of An Oxygenase Length = 336 | 7e-13 | ||
| 1wge_A | 83 | Solution Structure Of The Mouse Desr1 Length = 83 | 3e-10 | ||
| 2jr7_A | 89 | Solution Structure Of Human Desr1 Length = 89 | 5e-10 | ||
| 1yop_A | 83 | The Solution Structure Of Kti11p Length = 83 | 7e-07 | ||
| 1yws_A | 82 | Solution Structure Of Ybl071w-A From Saccharomyces | 8e-07 | ||
| 3kv5_D | 488 | Structure Of Kiaa1718, Human Jumonji Demethylase, I | 5e-05 | ||
| 3kv9_A | 397 | Structure Of Kiaa1718 Jumonji Domain Length = 397 | 2e-04 |
| >pdb|3LD8|A Chain A, Structure Of Jmjd6 And Fab Fragments Length = 334 | Back alignment and structure |
|
| >pdb|3K2O|A Chain A, Structure Of An Oxygenase Length = 336 | Back alignment and structure |
| >pdb|1WGE|A Chain A, Solution Structure Of The Mouse Desr1 Length = 83 | Back alignment and structure |
| >pdb|2JR7|A Chain A, Solution Structure Of Human Desr1 Length = 89 | Back alignment and structure |
| >pdb|1YOP|A Chain A, The Solution Structure Of Kti11p Length = 83 | Back alignment and structure |
| >pdb|1YWS|A Chain A, Solution Structure Of Ybl071w-A From Saccharomyces Cerevisiae Length = 82 | Back alignment and structure |
| >pdb|3KV5|D Chain D, Structure Of Kiaa1718, Human Jumonji Demethylase, In Complex With N-Oxalylglycine Length = 488 | Back alignment and structure |
| >pdb|3KV9|A Chain A, Structure Of Kiaa1718 Jumonji Domain Length = 397 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 456 | |||
| 3k2o_A | 336 | Bifunctional arginine demethylase and lysyl-hydro | 7e-54 | |
| 3uyj_A | 248 | Lysine-specific demethylase 8; jellyroll-like all | 5e-49 | |
| 3k3o_A | 371 | PHF8, PHD finger protein 8; histone demethylase, c | 4e-41 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 5e-41 | |
| 3al5_A | 338 | HTYW5, JMJC domain-containing protein C2ORF60; tRN | 5e-41 | |
| 3kv9_A | 397 | JMJC domain-containing histone demethylation prote | 3e-38 | |
| 3d8c_A | 349 | Hypoxia-inducible factor 1 alpha inhibitor; FIH, H | 6e-37 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 6e-36 | |
| 3pua_A | 392 | GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe | 7e-35 | |
| 2yu1_A | 451 | JMJC domain-containing histone demethylation PROT; | 9e-34 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 4e-30 | |
| 1yop_A | 83 | KTI11P; zinc finger, metal binding protein; NMR {S | 5e-30 | |
| 1wge_A | 83 | Hypothetical protein 2610018L09RIK; diphthamide,CS | 2e-29 | |
| 2jr7_A | 89 | DPH3 homolog; DESR1, CSL zinc finger, metal bindin | 3e-29 | |
| 2xxz_A | 332 | Lysine-specific demethylase 6B; oxidoreductase, hi | 6e-11 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 9e-10 | |
| 4ask_A | 510 | Lysine-specific demethylase 6B; oxidoreductase, KD | 9e-09 | |
| 3avr_A | 531 | Lysine-specific demethylase 6A; cupin superfamily, | 2e-08 | |
| 4diq_A | 489 | Lysine-specific demethylase NO66; structural genom | 1e-07 | |
| 2xdv_A | 442 | MYC-induced nuclear antigen; ribosome biogenesis, | 3e-07 | |
| 1vrb_A | 342 | Putative asparaginyl hydroxylase; 2636534, structu | 1e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-05 |
| >3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* Length = 336 | Back alignment and structure |
|---|
Score = 182 bits (463), Expect = 7e-54
Identities = 59/290 (20%), Positives = 110/290 (37%), Gaps = 38/290 (13%)
Query: 101 FNNFLSKNKPFILKSCVNEWNSSLHWVQNKQPNFEYLSNHYGDIEVPVANCNSYYFNAHE 160
+ KP +L + W++ W E L Y + + N
Sbjct: 61 VERYERPYKPVVLLNAQEGWSAQEKW------TLERLKRKYRNQKFKCGEDND-----GY 109
Query: 161 KTNMTLKEYTIYWQNKIDGKLSETEPLYYLKDWHF---TRDFKTEDIYRVPNVFSSDWLN 217
M +K Y Y ++ + + Y+ D + + K + Y+VP F+ D
Sbjct: 110 SVKMKMKYYIEYMES------TRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQ 163
Query: 218 EYYSEHLEHKDDYRFVYMGPKETWTPLHADVFHSYSWSVNICGRKQWLLLAPGNEKYF-- 275
+ + YR+ MGP + T +H D + +W+ + G K+W L +
Sbjct: 164 YAGEKR---RPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFPTSTPRELIK 220
Query: 276 --KDSMGNLISDMRSVDWSTLPRD---------TVIIVEQEAGDSIFVPSGWHHQVTNLE 324
+D GN + + PR + + Q+ G+++FVP GW H V NL+
Sbjct: 221 VTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLD 280
Query: 325 HTISINHNWINGTNIDHVYHEMVSHLEAVKKEIDDCKDMDDWTSHCQLML 374
TI+I N+ + TN V+H+ V + ++ + + ++
Sbjct: 281 TTIAITQNFASSTNFPVVWHKTVRGRPKLSRKWY--RILKQEHPELAVLA 328
|
| >3uyj_A Lysine-specific demethylase 8; jellyroll-like all beta fold, nuclear, oxidored; HET: AKG; 2.35A {Homo sapiens} PDB: 4aap_A* Length = 248 | Back alignment and structure |
|---|
| >3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* Length = 371 | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 | Back alignment and structure |
|---|
| >3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* Length = 338 | Back alignment and structure |
|---|
| >3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* Length = 397 | Back alignment and structure |
|---|
| >3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... Length = 349 | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 | Back alignment and structure |
|---|
| >3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* Length = 392 | Back alignment and structure |
|---|
| >2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A Length = 451 | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 | Back alignment and structure |
|---|
| >1yop_A KTI11P; zinc finger, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: g.41.17.1 PDB: 1yws_A Length = 83 | Back alignment and structure |
|---|
| >1wge_A Hypothetical protein 2610018L09RIK; diphthamide,CSL zinc finger, ADP-ribosylating toxin, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.17.1 Length = 83 | Back alignment and structure |
|---|
| >2jr7_A DPH3 homolog; DESR1, CSL zinc finger, metal binding protein; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2xxz_A Lysine-specific demethylase 6B; oxidoreductase, histone demethylation, oxygenase, chromatin modification; HET: 8XQ; 1.80A {Homo sapiens} Length = 332 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >4ask_A Lysine-specific demethylase 6B; oxidoreductase, KDM6B, GSK-J1, inhibitor, lysine specific HI demethylase; HET: K0I; 1.86A {Homo sapiens} PDB: 2xue_A* Length = 510 | Back alignment and structure |
|---|
| >3avr_A Lysine-specific demethylase 6A; cupin superfamily, TRI/dimethyllysine demethylase, oxidoredu structural protein complex; HET: M3L OGA EDO; 1.80A {Homo sapiens} PDB: 3avs_A* Length = 531 | Back alignment and structure |
|---|
| >4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} Length = 489 | Back alignment and structure |
|---|
| >2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} Length = 442 | Back alignment and structure |
|---|
| >1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 Length = 342 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 456 | |||
| 3k2o_A | 336 | Bifunctional arginine demethylase and lysyl-hydro | 100.0 | |
| 4gjz_A | 235 | Lysine-specific demethylase 8; JMJC, beta barrel, | 100.0 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 100.0 | |
| 3kv9_A | 397 | JMJC domain-containing histone demethylation prote | 100.0 | |
| 3k3o_A | 371 | PHF8, PHD finger protein 8; histone demethylase, c | 100.0 | |
| 3al5_A | 338 | HTYW5, JMJC domain-containing protein C2ORF60; tRN | 100.0 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 100.0 | |
| 2yu1_A | 451 | JMJC domain-containing histone demethylation PROT; | 100.0 | |
| 3d8c_A | 349 | Hypoxia-inducible factor 1 alpha inhibitor; FIH, H | 100.0 | |
| 3pua_A | 392 | GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe | 100.0 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 99.96 | |
| 1vrb_A | 342 | Putative asparaginyl hydroxylase; 2636534, structu | 99.93 | |
| 2jr7_A | 89 | DPH3 homolog; DESR1, CSL zinc finger, metal bindin | 99.86 | |
| 1wge_A | 83 | Hypothetical protein 2610018L09RIK; diphthamide,CS | 99.85 | |
| 1yop_A | 83 | KTI11P; zinc finger, metal binding protein; NMR {S | 99.84 | |
| 2xdv_A | 442 | MYC-induced nuclear antigen; ribosome biogenesis, | 99.8 | |
| 4diq_A | 489 | Lysine-specific demethylase NO66; structural genom | 99.76 | |
| 2ypd_A | 392 | Probable JMJC domain-containing histone demethyla | 99.72 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.3 | |
| 2xxz_A | 332 | Lysine-specific demethylase 6B; oxidoreductase, hi | 99.07 | |
| 3avr_A | 531 | Lysine-specific demethylase 6A; cupin superfamily, | 99.02 | |
| 4ask_A | 510 | Lysine-specific demethylase 6B; oxidoreductase, KD | 98.62 | |
| 3dxt_A | 354 | JMJC domain-containing histone demethylation PROT; | 98.23 | |
| 3opt_A | 373 | DNA damage-responsive transcriptional repressor R; | 97.77 | |
| 2ox0_A | 381 | JMJC domain-containing histone demethylation PROT; | 97.68 | |
| 3eqe_A | 171 | Putative cystein deoxygenase; YUBC, SR112, NESG, s | 95.94 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 95.45 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 95.2 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 95.07 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 95.06 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 95.04 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 94.94 | |
| 1fi2_A | 201 | Oxalate oxidase, germin; beta-jellyroll, oxidoredu | 94.69 | |
| 1x82_A | 190 | Glucose-6-phosphate isomerase; cupin superfamily, | 94.6 | |
| 3eln_A | 200 | Cysteine dioxygenase type 1; peroxysulfenate, non- | 94.46 | |
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 94.31 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 94.25 | |
| 2pfw_A | 116 | Cupin 2, conserved barrel domain protein; cupin do | 94.24 | |
| 3fjs_A | 114 | Uncharacterized protein with RMLC-like cupin fold; | 94.21 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 94.17 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 94.13 | |
| 3lag_A | 98 | Uncharacterized protein RPA4178; functionally unkn | 94.07 | |
| 4e2g_A | 126 | Cupin 2 conserved barrel domain protein; MCSG, PSI | 94.04 | |
| 1yhf_A | 115 | Hypothetical protein SPY1581; structural genomics, | 94.0 | |
| 2fqp_A | 97 | Hypothetical protein BP2299; double-stranded beta- | 94.0 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 93.73 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 93.67 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 93.58 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 93.53 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 93.52 | |
| 3h8u_A | 125 | Uncharacterized conserved protein with double-STR | 93.5 | |
| 2xlg_A | 239 | SLL1785 protein, CUCA; metal binding protein, cupi | 93.49 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 93.44 | |
| 1yfu_A | 174 | 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid | 93.4 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 93.39 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 93.35 | |
| 1v70_A | 105 | Probable antibiotics synthesis protein; structural | 93.32 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 93.32 | |
| 3ibm_A | 167 | Cupin 2, conserved barrel domain protein; cupin 2 | 93.23 | |
| 1lr5_A | 163 | Auxin binding protein 1; beta jellyroll, double st | 93.19 | |
| 2ozj_A | 114 | Cupin 2, conserved barrel; cupin superfamily prote | 93.14 | |
| 1zvf_A | 176 | 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b | 93.08 | |
| 3kgz_A | 156 | Cupin 2 conserved barrel domain protein; metallopr | 92.96 | |
| 2b8m_A | 117 | Hypothetical protein MJ0764; structural genomics, | 92.94 | |
| 3uss_A | 211 | Putative uncharacterized protein; cupin, three his | 92.82 | |
| 2o8q_A | 134 | Hypothetical protein; cpuin-like fold, structural | 92.72 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 92.64 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 92.55 | |
| 3bb6_A | 127 | Uncharacterized protein YEAR; structural genomics, | 92.54 | |
| 2gu9_A | 113 | Tetracenomycin polyketide synthesis protein; X-RAY | 92.48 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 92.3 | |
| 2gm6_A | 208 | Cysteine dioxygenase type I; structural genomics, | 92.24 | |
| 2y0o_A | 175 | Probable D-lyxose ketol-isomerase; carbohydrate me | 92.22 | |
| 4i4a_A | 128 | Similar to unknown protein; structural genomics, P | 92.22 | |
| 2oa2_A | 148 | BH2720 protein; 10175341, structural genomics, joi | 92.21 | |
| 3jzv_A | 166 | Uncharacterized protein RRU_A2000; structural geno | 92.03 | |
| 3ht1_A | 145 | REMF protein; cupin fold, Zn-binding, antibiotic b | 91.99 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 91.93 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 91.85 | |
| 3ejk_A | 174 | DTDP sugar isomerase; YP_390184.1, structural geno | 91.48 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 91.38 | |
| 3lwc_A | 119 | Uncharacterized protein; structural genomics, unkn | 91.35 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 91.29 | |
| 3l2h_A | 162 | Putative sugar phosphate isomerase; AFE_0303, stru | 91.28 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 91.24 | |
| 3bcw_A | 123 | Uncharacterized protein; structural genomics, join | 90.95 | |
| 3cew_A | 125 | Uncharacterized cupin protein; all beta-protein, j | 90.64 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 90.53 | |
| 2opk_A | 112 | Hypothetical protein; putative mannose-6-phosphate | 90.48 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 90.43 | |
| 4b29_A | 217 | Dimethylsulfoniopropionate lyase; hydrolase, dimet | 90.33 | |
| 3i7d_A | 163 | Sugar phosphate isomerase; YP_168127.1, structural | 90.26 | |
| 1o4t_A | 133 | Putative oxalate decarboxylase; double-stranded be | 90.01 | |
| 2bnm_A | 198 | Epoxidase; oxidoreductase, cupin, HTH, cation-depe | 89.98 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 89.83 | |
| 2qnk_A | 286 | 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol | 89.74 | |
| 1o5u_A | 101 | Novel thermotoga maritima enzyme TM1112; cupin, st | 89.6 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 89.33 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 89.14 | |
| 4axo_A | 151 | EUTQ, ethanolamine utilization protein; structural | 88.65 | |
| 2e2z_A | 100 | TIM15; protein import, zinc finger, protein transp | 88.35 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 88.2 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 88.13 | |
| 3d82_A | 102 | Cupin 2, conserved barrel domain protein; structur | 88.03 | |
| 2vpv_A | 166 | Protein MIF2, MIF2P; nucleus, mitosis, centromere, | 87.99 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 87.95 | |
| 1ep0_A | 185 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race | 87.76 | |
| 2f4p_A | 147 | Hypothetical protein TM1010; double-stranded beta- | 87.47 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 87.44 | |
| 1vj2_A | 126 | Novel manganese-containing cupin TM1459; structura | 87.37 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 87.36 | |
| 2ixk_A | 184 | DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l | 87.32 | |
| 1y9q_A | 192 | Transcriptional regulator, HTH_3 family; transcrip | 87.22 | |
| 1vr3_A | 191 | Acireductone dioxygenase; 13543033, structural gen | 87.09 | |
| 2q30_A | 110 | Uncharacterized protein; double-stranded beta-heli | 86.98 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 86.74 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 85.3 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 85.24 | |
| 2i45_A | 107 | Hypothetical protein; neisseria meningitidis cupin | 85.09 | |
| 1dzr_A | 183 | DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, | 85.05 | |
| 1wlt_A | 196 | 176AA long hypothetical DTDP-4-dehydrorhamnose 3, | 84.69 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 84.27 | |
| 2ozi_A | 98 | Hypothetical protein RPA4178; APC6210, putative pr | 83.56 | |
| 2pa7_A | 141 | DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug | 83.45 | |
| 3ryk_A | 205 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 83.39 | |
| 3dl3_A | 119 | Tellurite resistance protein B; X-RAY NESG VFR98 Q | 82.97 | |
| 1upi_A | 225 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 82.7 | |
| 1nxm_A | 197 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell | 82.44 | |
| 2pyt_A | 133 | Ethanolamine utilization protein EUTQ; structural | 82.25 | |
| 2c0z_A | 216 | NOVW; isomerase, epimerase, antibiotic biosynthesi | 81.72 | |
| 1oi6_A | 205 | PCZA361.16; epimerase, vancomycin group antibiotic | 81.38 | |
| 3es1_A | 172 | Cupin 2, conserved barrel domain protein; YP_00116 | 81.34 | |
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 81.25 | |
| 1sef_A | 274 | Conserved hypothetical protein; structural genomic | 80.69 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 80.33 |
| >3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=6.6e-47 Score=380.30 Aligned_cols=256 Identities=23% Similarity=0.433 Sum_probs=210.7
Q ss_pred ccccccccCcCCCCceeeCC-CCCHHHHHHhhcCCCCcEEEecCCCccccccccccCCCCChhHHHHHhCCceEEEEecC
Q psy12281 74 NEQINVTTTALPQVDYNIDP-SHIYPYCFNNFLSKNKPFILKSCVNEWNSSLHWVQNKQPNFEYLSNHYGDIEVPVANCN 152 (456)
Q Consensus 74 ~~~~~~~~~~~p~~I~ri~~-~ls~~~F~~~y~~~~~PvVi~g~~~~Wpa~~~Wt~~~~~~~d~L~~~~Gd~~V~V~~~~ 152 (456)
++.+.+.....+..|+|++. .+|+++|.++|+.+++||||+|++++|||+++|+ ++||++++|+..|+|....
T Consensus 33 ~~~~~~~~~~~~~~I~Ri~~~~lS~eeF~~~y~~~~~PvVi~g~~~~WpA~~~Wt------~~yL~~~~G~~~V~v~~~~ 106 (336)
T 3k2o_A 33 YESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPVVLLNAQEGWSAQEKWT------LERLKRKYRNQKFKCGEDN 106 (336)
T ss_dssp HHHCCCCGGGCCCCCCEEEGGGCCHHHHHHHTTTTTCCEEEESTTTTCTHHHHCS------HHHHHHHSTTCEEEEEECT
T ss_pred hhhhhhchhhcCCCCCEecCCCCCHHHHHHHhhccCCCEEEeCCcCCChhHhhhh------HHHHHHHhCCceEEEEecC
Confidence 34444333346789999974 8999999999999999999999999999999995 7999999999999987532
Q ss_pred cccccCCceEEeeHHHHHHHHHhcccCCCCCCCCeeeeecccccc--CCCCC-cccccCcccCcchhhHhhhhhccCCCc
Q psy12281 153 SYYFNAHEKTNMTLKEYTIYWQNKIDGKLSETEPLYYLKDWHFTR--DFKTE-DIYRVPNVFSSDWLNEYYSEHLEHKDD 229 (456)
Q Consensus 153 ~~~y~~~~~~~m~l~efl~~~~~~~~~~~~~~~~~~Yl~d~~~~~--~~p~l-~~y~~P~~f~~D~ln~~~~~~~~~~~~ 229 (456)
.+....|+|++|++++.+.. +..++||+++++.. .+|+| .+|.+|.+|.+|+++ ++.... +++
T Consensus 107 -----~~~~~~m~~~~fl~~~~~~~------~~~~lYL~d~~~~e~~~~p~L~~dy~~P~~f~~d~~~-~~~~~~--~p~ 172 (336)
T 3k2o_A 107 -----DGYSVKMKMKYYIEYMESTR------DDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQ-YAGEKR--RPP 172 (336)
T ss_dssp -----TSCEEEEEHHHHHHHHHHCC------CSSCCCEEESCGGGSTTGGGGGGGCCCCGGGCCCGGG-GGCTTT--SCC
T ss_pred -----CCceeeecHHHHHHHHHhcC------CCCCceEecccccccccchhHHHhcCCCcccccchhh-hccccc--CCC
Confidence 23467999999999998753 25689999998864 47888 589999999999885 333222 678
Q ss_pred cceeeeCCCCCcccccccccCccceeEEEEeEEEEEEeCCCCCcccccCCC---Ccc----cc---CCCcc--cCCCCC-
Q psy12281 230 YRFVYMGPKETWTPLHADVFHSYSWSVNICGRKQWLLLAPGNEKYFKDSMG---NLI----SD---MRSVD--WSTLPR- 296 (456)
Q Consensus 230 ~~~l~iG~~gs~T~lH~D~~~~~sW~~~i~G~Krw~L~pP~~~~~Ly~~~g---~~p----~d---~~~pd--~~~fp~- 296 (456)
++++|||++||+|++|+|+.++.+|++||.|+|+|+||||.+...||.... ... ++ ...|. ..+||.
T Consensus 173 ~~~~~~G~~gs~t~~H~D~~~~~~~~~~v~G~K~~~L~pP~~~~~ly~~~~~~~~~~~~~~~~w~~~~~P~~~~~~~p~~ 252 (336)
T 3k2o_A 173 YRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFPTSTPRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPE 252 (336)
T ss_dssp CEEEEEECTTCEEEEECCGGGCEEEEEEEESCEEEEEECTTSCHHHHCCCHHHHGGGTTCHHHHHHHTGGGGGSTTSCGG
T ss_pred ceEEEECCCCccCCcccCCCccceeeEEEeeeEEEEEeCCCcchhcccCcccccCCCccchhhhhhhhCcchhhhccccc
Confidence 999999999999999999999999999999999999999999988886431 111 00 11121 123443
Q ss_pred CceEEEEEcCCCEEEeCCCCeEEEEeCCCcEEEEeecCCCCCHHHHHHHHHHH
Q psy12281 297 DTVIIVEQEAGDSIFVPSGWHHQVTNLEHTISINHNWINGTNIDHVYHEMVSH 349 (456)
Q Consensus 297 ~~~~~~~l~pGD~LfIPsgW~H~V~nl~~sIsvn~~~~~~~nl~~~~~~l~~~ 349 (456)
+++++|+|+|||+||||+||||+|.|+++||+||+||++..|+..+|+.+...
T Consensus 253 ~~~~~~~l~pGd~l~iP~gw~H~v~~~~~sisv~~~f~~~~nl~~~~~~~~~~ 305 (336)
T 3k2o_A 253 FKPLEILQKPGETVFVPGGWWHVVLNLDTTIAITQNFASSTNFPVVWHKTVRG 305 (336)
T ss_dssp GCCEEEEECTTCEEEECTTCEEEEEESSCEEEEEEEECCTTTHHHHHHHHHHH
T ss_pred CceEEEEECCCCEEEeCCCCcEEEecCCCeEEEEcccCCcccHHHHHHHHHhh
Confidence 78999999999999999999999999999999999999999999999998654
|
| >4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* | Back alignment and structure |
|---|
| >3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* | Back alignment and structure |
|---|
| >3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A | Back alignment and structure |
|---|
| >3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... | Back alignment and structure |
|---|
| >3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 | Back alignment and structure |
|---|
| >2jr7_A DPH3 homolog; DESR1, CSL zinc finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wge_A Hypothetical protein 2610018L09RIK; diphthamide,CSL zinc finger, ADP-ribosylating toxin, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.17.1 | Back alignment and structure |
|---|
| >1yop_A KTI11P; zinc finger, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: g.41.17.1 PDB: 1yws_A | Back alignment and structure |
|---|
| >2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} | Back alignment and structure |
|---|
| >4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2ypd_A Probable JMJC domain-containing histone demethyla PROT EIN 2C; oxidoreductase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xxz_A Lysine-specific demethylase 6B; oxidoreductase, histone demethylation, oxygenase, chromatin modification; HET: 8XQ; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3avr_A Lysine-specific demethylase 6A; cupin superfamily, TRI/dimethyllysine demethylase, oxidoredu structural protein complex; HET: M3L OGA EDO; 1.80A {Homo sapiens} PDB: 3avs_A* | Back alignment and structure |
|---|
| >4ask_A Lysine-specific demethylase 6B; oxidoreductase, KDM6B, GSK-J1, inhibitor, lysine specific HI demethylase; HET: K0I; 1.86A {Homo sapiens} PDB: 2xue_A* 4eyu_A* 4ez4_A* 4ezh_A* | Back alignment and structure |
|---|
| >3dxt_A JMJC domain-containing histone demethylation PROT; JMJD2D, histone demethylase, H3K9, jumonji domain-CONT protein 2D, oxidoreductase; 1.80A {Homo sapiens} PDB: 3dxu_A* 4hon_A* 4hoo_A 2w2i_A* | Back alignment and structure |
|---|
| >3opt_A DNA damage-responsive transcriptional repressor R; RPH1, histone demethylase, catalytic core, oxidoreductase; HET: DNA AKG; 2.20A {Saccharomyces cerevisiae} PDB: 3opw_A* | Back alignment and structure |
|---|
| >2ox0_A JMJC domain-containing histone demethylation PROT; double-stranded beta helix, demethylase, oxygenase, SGC, STR genomics, structural genomics consortium, oxidoreductase; HET: MLY ALY OGA; 1.95A {Homo sapiens} PDB: 2oq7_A* 2os2_A* 2ot7_A* 2oq6_A* 2vd7_A* 2ybk_A* 2ybp_A* 2ybs_A* 3njy_A* 3pdq_A* 3u4s_A* 2p5b_A* 2q8c_A* 2q8d_A* 2q8e_A* 2gp5_A* 2gp3_A* 2wwj_A* 2pxj_A* 2xml_A* | Back alignment and structure |
|---|
| >3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A | Back alignment and structure |
|---|
| >1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A | Back alignment and structure |
|---|
| >1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* | Back alignment and structure |
|---|
| >3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A | Back alignment and structure |
|---|
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} | Back alignment and structure |
|---|
| >3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* | Back alignment and structure |
|---|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} | Back alignment and structure |
|---|
| >3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} | Back alignment and structure |
|---|
| >1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* | Back alignment and structure |
|---|
| >1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A | Back alignment and structure |
|---|
| >3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} | Back alignment and structure |
|---|
| >1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* | Back alignment and structure |
|---|
| >2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} | Back alignment and structure |
|---|
| >1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 | Back alignment and structure |
|---|
| >3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 | Back alignment and structure |
|---|
| >3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B | Back alignment and structure |
|---|
| >3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13 | Back alignment and structure |
|---|
| >2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A | Back alignment and structure |
|---|
| >2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} | Back alignment and structure |
|---|
| >2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* | Back alignment and structure |
|---|
| >3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B | Back alignment and structure |
|---|
| >3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* | Back alignment and structure |
|---|
| >2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A | Back alignment and structure |
|---|
| >4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} | Back alignment and structure |
|---|
| >3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A | Back alignment and structure |
|---|
| >1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* | Back alignment and structure |
|---|
| >4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >2e2z_A TIM15; protein import, zinc finger, protein transport, chaperone regulator; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} | Back alignment and structure |
|---|
| >2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A | Back alignment and structure |
|---|
| >1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* | Back alignment and structure |
|---|
| >2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A | Back alignment and structure |
|---|
| >1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* | Back alignment and structure |
|---|
| >2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* | Back alignment and structure |
|---|
| >1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 | Back alignment and structure |
|---|
| >1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 | Back alignment and structure |
|---|
| >2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A | Back alignment and structure |
|---|
| >2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A | Back alignment and structure |
|---|
| >2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* | Back alignment and structure |
|---|
| >1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* | Back alignment and structure |
|---|
| >2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* | Back alignment and structure |
|---|
| >3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3dl3_A Tellurite resistance protein B; X-RAY NESG VFR98 Q5E3X2_VIBF1, structural genomics, PSI-2, protein structure initiative; 2.30A {Vibrio fischeri ES114} SCOP: b.82.2.13 | Back alignment and structure |
|---|
| >1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* | Back alignment and structure |
|---|
| >1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* | Back alignment and structure |
|---|
| >2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 | Back alignment and structure |
|---|
| >2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 | Back alignment and structure |
|---|
| >1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A | Back alignment and structure |
|---|
| >3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} | Back alignment and structure |
|---|
| >1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 456 | ||||
| d1wgea1 | 70 | g.41.17.1 (A:8-77) DelGEF-interacting protein 1, D | 2e-29 | |
| d1ywsa1 | 82 | g.41.17.1 (A:1-82) Diphthamide biosynthesis protei | 2e-26 | |
| d1h2ka_ | 335 | b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibit | 1e-25 | |
| d1vrba1 | 319 | b.82.2.11 (A:8-326) Putative asparaginyl hydroxyla | 2e-16 |
| >d1wgea1 g.41.17.1 (A:8-77) DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 | Back information, alignment and structure |
|---|
class: Small proteins fold: Rubredoxin-like superfamily: CSL zinc finger family: CSL zinc finger domain: DelGEF-interacting protein 1, DelGIP1 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 107 bits (269), Expect = 2e-29
Identities = 44/56 (78%), Positives = 51/56 (91%)
Query: 1 MSVYHDEIEIEDFEYDEDDETYYYPCPCGDRFQITKEQLKAGEDVATCPTCSLIIK 56
M+V+HDE+EIEDF+YDED ETY+YPCPCGD F ITKE L+ GEDVATCP+CSLIIK
Sbjct: 1 MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFAITKEDLENGEDVATCPSCSLIIK 56
|
| >d1ywsa1 g.41.17.1 (A:1-82) Diphthamide biosynthesis protein 3, DPH3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 82 | Back information, alignment and structure |
|---|
| >d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} Length = 335 | Back information, alignment and structure |
|---|
| >d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} Length = 319 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 456 | |||
| d1h2ka_ | 335 | Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum | 100.0 | |
| d1vrba1 | 319 | Putative asparaginyl hydroxylase YxbC {Bacillus su | 99.97 | |
| d1wgea1 | 70 | DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus | 99.9 | |
| d1ywsa1 | 82 | Diphthamide biosynthesis protein 3, DPH3 {Baker's | 99.86 | |
| d1lr5a_ | 160 | Auxin binding protein {Maize (Zea mays) [TaxId: 45 | 97.18 | |
| d1fxza2 | 174 | Seed storage 7S protein {Soybean (Glycine max), pr | 96.85 | |
| d1x82a_ | 190 | Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc | 96.8 | |
| d1od5a2 | 173 | Seed storage 7S protein {Soybean (Glycine max), gl | 96.69 | |
| g1dgw.1 | 168 | Seed storage 7S protein {Jack bean (Canavalia ensi | 96.66 | |
| d2phla2 | 162 | Seed storage 7S protein {French bean (Phaseolus vu | 96.5 | |
| d2b8ma1 | 108 | Hypothetical protein MJ0764 {Archaeon Methanococcu | 96.22 | |
| d1uija1 | 170 | Seed storage 7S protein {Soybean (Glycine max), be | 96.11 | |
| d1j58a_ | 372 | Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil | 96.09 | |
| d2et1a1 | 201 | Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | 95.87 | |
| d1dgwa_ | 178 | Seed storage 7S protein {Jack bean (Canavalia ensi | 95.83 | |
| d1uika2 | 185 | Seed storage 7S protein {Soybean (Glycine max), be | 95.8 | |
| d1o4ta_ | 115 | Hypothetical protein TM1287 {Thermotoga maritima [ | 95.77 | |
| d1uika1 | 203 | Seed storage 7S protein {Soybean (Glycine max), be | 95.76 | |
| d1j58a_ | 372 | Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil | 95.71 | |
| d1v70a_ | 105 | Hypothetical protein TTHA0104 {Thermus thermophilu | 95.69 | |
| d1zvfa1 | 175 | 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea | 95.64 | |
| d1yhfa1 | 112 | Hypothetical protein SPy1581 {Streptococcus pyogen | 94.98 | |
| d3elna1 | 186 | Cysteine dioxygenase type I {Rattus norvegicus [Ta | 94.91 | |
| d2phda1 | 351 | Gentisate 1,2-dioxygenase {Pseudaminobacter salicy | 94.86 | |
| d2f4pa1 | 134 | Hypothetical protein TM1010 {Thermotoga maritima [ | 94.81 | |
| d1vj2a_ | 114 | Hypothetical protein TM1459 {Thermotoga maritima [ | 94.74 | |
| d2d40a1 | 308 | Gentisate 1,2-dioxygenase {Escherichia coli [TaxId | 94.42 | |
| d2ixca1 | 198 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac | 94.28 | |
| d2d40a1 | 308 | Gentisate 1,2-dioxygenase {Escherichia coli [TaxId | 94.18 | |
| d2pa7a1 | 135 | dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane | 94.04 | |
| d1dzra_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone | 93.8 | |
| d1wlta1 | 176 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 93.79 | |
| d3bu7a1 | 355 | Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ | 93.73 | |
| d1y3ta1 | 330 | Hypothetical protein YxaG {Bacillus subtilis [TaxI | 93.15 | |
| d1juha_ | 348 | Quercetin 2,3-dioxygenase {Aspergillus japonicus [ | 92.93 | |
| d3bu7a1 | 355 | Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ | 92.6 | |
| d1yfua1 | 174 | 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m | 92.53 | |
| d2phda1 | 351 | Gentisate 1,2-dioxygenase {Pseudaminobacter salicy | 92.25 | |
| d1y3ta1 | 330 | Hypothetical protein YxaG {Bacillus subtilis [TaxI | 91.95 | |
| d2phla1 | 200 | Seed storage 7S protein {French bean (Phaseolus vu | 91.88 | |
| d2ixha1 | 184 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom | 91.53 | |
| d3bb6a1 | 109 | Uncharacterized protein YeaR {Escherichia coli [Ta | 91.03 | |
| d2c0za1 | 190 | Novobiocin biosynthesis protein NovW {Streptomyces | 91.01 | |
| d2bnma2 | 122 | Hydroxypropylphosphonic acid epoxidase Fom4, C-ter | 90.8 | |
| d1nxma_ | 194 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto | 90.22 | |
| d2pyta1 | 128 | Ethanolamine utilization protein EutQ {Salmonella | 90.0 | |
| d1juha_ | 348 | Quercetin 2,3-dioxygenase {Aspergillus japonicus [ | 89.89 | |
| d1ep0a_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 89.74 | |
| d1oi6a_ | 202 | dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amyc | 88.68 | |
| d1sefa_ | 250 | Hypothetical protein EF2996 {Enterococcus faecalis | 88.32 | |
| d1y9qa2 | 99 | Probable transcriptional regulator VC1968, C-termi | 85.49 | |
| d2gm6a1 | 192 | Cysteine dioxygenase type I {Ralstonia eutropha [T | 85.36 | |
| d1sq4a_ | 273 | Glyoxylate-induced protein PA1140 {Pseudomonas aer | 84.82 | |
| d1sfna_ | 245 | Hypothetical protein DR1152 {Deinococcus radiodura | 84.2 | |
| d1fxza1 | 239 | Seed storage 7S protein {Soybean (Glycine max), pr | 83.49 | |
| d3dl3a1 | 96 | Tellurite resistance protein B, TehB {Vibrio fisch | 83.36 | |
| d1rc6a_ | 253 | Hypothetical protein YlbA {Escherichia coli [TaxId | 83.27 | |
| d1sefa_ | 250 | Hypothetical protein EF2996 {Enterococcus faecalis | 81.74 |
| >d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: Clavaminate synthase-like family: Hypoxia-inducible factor HIF ihhibitor (FIH1) domain: Hypoxia-inducible factor HIF ihhibitor (FIH1) species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=4.5e-37 Score=307.47 Aligned_cols=234 Identities=17% Similarity=0.250 Sum_probs=173.8
Q ss_pred CCceeeCCCCCHHHHHHhhcCCCCcEEEecCCCccccccccccCCCCChhHHHHHhCCceEEEEecCccc--c-------
Q psy12281 86 QVDYNIDPSHIYPYCFNNFLSKNKPFILKSCVNEWNSSLHWVQNKQPNFEYLSNHYGDIEVPVANCNSYY--F------- 156 (456)
Q Consensus 86 ~~I~ri~~~ls~~~F~~~y~~~~~PvVi~g~~~~Wpa~~~Wt~~~~~~~d~L~~~~Gd~~V~V~~~~~~~--y------- 156 (456)
..|+|++ ..+. +.++|+.+++||||+|++.+|||. +|+ ++||++++|+..|+|....... |
T Consensus 26 ~~vpr~~-~~~~--~~e~y~~~~~PvVi~g~~~~Wpa~-kWt------~dyL~~~~Gd~~V~v~~~~~~~~~~~~~~~~~ 95 (335)
T d1h2ka_ 26 RPIPRLS-QSDP--RAEELIENEEPVVLTDTNLVYPAL-KWD------LEYLQENIGNGDFSVYSASTHKFLYYDEKKMA 95 (335)
T ss_dssp EECCEEC-TTCH--HHHHHHHTTCCEEESCCCTTGGGG-GCC------HHHHHHHSCSCCEEEEEESSSBCCCCCGGGGG
T ss_pred cccCccC-CCCc--CHHHHhcCCCCEEEeCCCCCCCcc-cCC------HHHHHHhhCCceEEEEEecCcccccccccccc
Confidence 5688885 3333 457899999999999999999998 595 7999999999999987543211 1
Q ss_pred -----c-CCceEEeeHHHHHHHHHhcccCCCCCCCCeeeeeccccccCCCCC-cccccCcccCcchhhHhhhhhccCCCc
Q psy12281 157 -----N-AHEKTNMTLKEYTIYWQNKIDGKLSETEPLYYLKDWHFTRDFKTE-DIYRVPNVFSSDWLNEYYSEHLEHKDD 229 (456)
Q Consensus 157 -----~-~~~~~~m~l~efl~~~~~~~~~~~~~~~~~~Yl~d~~~~~~~p~l-~~y~~P~~f~~D~ln~~~~~~~~~~~~ 229 (456)
. ......|++++|++++..... ......+|+.+.......+.+ .++..|.+ ++.+............
T Consensus 96 ~~~~~~~~~~~~~~~~~ef~~~~~~~~~---~~~~~~~yl~~~~~~~~~~~~~~d~~~~~~---~~~~~~~~~~~~~~~~ 169 (335)
T d1h2ka_ 96 NFQNFKPRSNREEMKFHEFVEKLQDIQQ---RGGEERLYLQQTLNDTVGRKIVMDFLGFNW---NWINKQQGKRGWGQLT 169 (335)
T ss_dssp GGTTCCCSEEEEEECHHHHHHHHHHHHH---TTCCCEEEEEEECCTTSCHHHHHHHHTSCH---HHHHHHHHHHTCCCEE
T ss_pred cccccccccchhcccHHHHHHHHHhccc---cCCCcceEhhhccccccChhhhcccccCcc---cccchhhccccccCCc
Confidence 1 123578999999999876543 123567888876544333332 23333332 2222222111112345
Q ss_pred cceeeeCCCCCcccccccccCccceeEEEEeEEEEEEeCCCCCcccccCCCC------ccccCCCcccCCCCC---CceE
Q psy12281 230 YRFVYMGPKETWTPLHADVFHSYSWSVNICGRKQWLLLAPGNEKYFKDSMGN------LISDMRSVDWSTLPR---DTVI 300 (456)
Q Consensus 230 ~~~l~iG~~gs~T~lH~D~~~~~sW~~~i~G~Krw~L~pP~~~~~Ly~~~g~------~p~d~~~pd~~~fp~---~~~~ 300 (456)
..++|||++|+.|++|+|+++++ ++||.|+|+|+||||.+...+|+.... ..+|+.++++.++|. ++++
T Consensus 170 ~~~lwiG~~gs~t~~H~D~~~~~--~~q~~G~K~~~l~~p~~~~~~~~~~~~~~~~~~s~~d~~~~d~~~~p~~~~~~~~ 247 (335)
T d1h2ka_ 170 SNLLLIGMEGNVTPAHYDEQQNF--FAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGY 247 (335)
T ss_dssp ECEEEEECTTCEEEEECCSEEEE--EEEEESCEEEEEECGGGHHHHCBCCTTSTTTTBBCCCTTSCCTTTCGGGGGCCEE
T ss_pred ceEEEEcCCCCCCccccccccce--EEEeccceEEEEeccccccccccccccCCCCcceeccccCcchhhccchhcCCce
Confidence 57899999999999999999766 999999999999999999988875422 247788888888764 8999
Q ss_pred EEEEcCCCEEEeCCCCeEEEEeCCC---cEEEEeecCCCC
Q psy12281 301 IVEQEAGDSIFVPSGWHHQVTNLEH---TISINHNWINGT 337 (456)
Q Consensus 301 ~~~l~pGD~LfIPsgW~H~V~nl~~---sIsvn~~~~~~~ 337 (456)
+|+|+|||+||||+||||+|+|+++ |||||+||.+..
T Consensus 248 ~~~l~pGd~L~iP~~w~H~V~~~~~~~~sisvn~w~~~~~ 287 (335)
T d1h2ka_ 248 ETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAP 287 (335)
T ss_dssp EEEECTTCEEEECTTCEEEEEECTTSCCEEEEEEEEECCC
T ss_pred EEEECCCCEEeeCCCCeEEEEEcCCCCeEEEEEeeecCCC
Confidence 9999999999999999999999976 899999887653
|
| >d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wgea1 g.41.17.1 (A:8-77) DelGEF-interacting protein 1, DelGIP1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ywsa1 g.41.17.1 (A:1-82) Diphthamide biosynthesis protein 3, DPH3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} | Back information, alignment and structure |
|---|
| >d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} | Back information, alignment and structure |
|---|
| >d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3bb6a1 b.82.2.13 (A:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} | Back information, alignment and structure |
|---|
| >d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} | Back information, alignment and structure |
|---|
| >d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} | Back information, alignment and structure |
|---|
| >d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d3dl3a1 b.82.2.13 (A:5-100) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]} | Back information, alignment and structure |
|---|
| >d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|