Psyllid ID: psy12350

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------113
MVQDKTSPTLHIGVIGGGAGGLTATKRLTEPGSGFTCTTFEQTDNVGGTWVYTEQTGRDQYGLPVHSSMYKSLKTNLPKEIMELSGYHHKGHPDKSYIAANDVLEYLNDFADNFNLRNLCLVNKNVQPLYKHLINIEHPSMCIIGIPRDTVGFYLFDLQVRFFLQLMQGHVTLPSKAEMLADTEQDVRGRLREGQNPNAFHIMGQRSEKYLNSLCSMMRDESPVPPVLLKIYFESFARCSEDFTEFRKDKYKIINEKAFVRDPGAANGPSGLDITHDISTEATTVFLSHHSEHVKKLRFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPVESCGIKVVNKNVQPLYKHLINIDHPSMCIIGIPGDTVVFYMFDLQDKIRPGRGNPRPSACEADALPTNLTRLTYIISSRNYSNPVYPDFKGKDVCQIPIMHSHEYRTPEPFAGKRAVVVGSGPSGLDITHDISTEATTVSAYLRFDNKTITKRKKFDKGRNYNHPIYPEFKGKDMCQIPILHSRDYRTPEPFAGKQAVVVGSGQSGLDITLDIATRASTVFLSHHSERVTSLCLPNNVVLKPDVAELTPTGVRFQDGSYEQVDIILCCTGYTNHYPFLHESCGIKVVNKNVQPLYKHTINIEHPTMFILGVSFTIEEFIKVCPNIVDRHGPGGLTATKRLTEAGNGFTCTTFEQADNIGGTWLYTEHIGCDQYGLPVHSSMYKSLKTNLPKDLMELCGYGHKGNADKSYIGAKDVLENYNHPIYPEFKGKDMCQIPILHSRDYRTPEPFAGKQAVVVGSGQSGLDITLDIATTGKQAVVVGSGQSGLDITLDIATRASTVFLSHHSERVTSLCLPNNVVLKPDVAELTPTGVRFQDGSYEQVDIILCCTGYSNHYPFLHESCGIKVVNKNVQPLYKHTINIEHPTMFILGVPRHTLLFNLFDLQVRLFQQLMQGHITLPSKEEMLADTKQEVLAHLNEGQNPNTFHIIGHRSENFLNSIISMMRDESPLPPVLLKVYFDSYGQLTEDFIGFRNNKYQIFNDQAYVRTGPVT
ccccccccccEEEEEcccHHHHHHHHHHHcccccccEEEEEEEccccEEEEEccccccccccccccccccccEEcccccccccccccccccccccccccHHHHHHHHHHHHHHccccccEEEEEEEEEEEEEcccccccEEEEEEEEcccEEEEEEEEEEEEEEEEEEcccccccccccccccEEEcccEEEEcccccEEEEEcccccccccEEEEEEEcccccccEEEEEEccccccccccHHHcccccEEEEEccccccccccccccccccccccccccccEEEEEccccccccccccccEEEcccEEEEEcccEEEccccEEEccEEEEccccccccccccccccEEEccccccccccEEcccccccEEEEEEccccccccHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccEEEEEEEEcccccccccccccccccccccccEEEEEEEEEEccccccccccccccccccccccEEEEEEcccccccccccEEEEEccccccEEEEEccccEEEEEEEEEEccEEEEEEEEEcccccccEEccccccccccccccEEEEccccccHHcccccEEEEccccccccccccccccccEEEEEEEccccccccccccEEEccccEEEEcccEEEccccEEEccEEEEcccccccccccccccccEEccccccccccEEcccccccEEEEEEcccccccccccccHHccccccccccccccccccccccccEEccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccccccccccEEEEEEEEEEEcccccccccccEEEEccccccccccccccccccEEEEEEEccccccccccccccccEEEEEEcccccccccccccEEEcccEEEEccccEEEccccEEEccEEEEccccccccccccccccEEEccccccccccEEcccccccEEEEEccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccEEEcccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccEEEccccccEEEcccc
ccccccccccEEEEEEccHHHHHHHHHHHHccccccEEEEEEccccccEEEEccccccccccccccccEEEEEEEcccccHccccccccccccccccccHHHHHHHHHHHHHHcccHEEEEEEEEEEEEEcccccccccEEEEEEEccccEEEEEEcEEEEEEEEEEcccccccccccEEEccHHHHHHHcccccccccccccccEEEcccccccccccccEEEEEEEEEEccccHHHHHHHHHHHHHHHHEccccccEEEEEEccccccHHHHHHHHHcccHHcccccccccccccEcccEEEEEccEEEEEcccEEEEcccEEEEEEEEEEcccEEEccccccccEEEEEcccccccHHcccccccccEEEEEccccccccccccEEEEEHHHHHHHHHHHHcccccccccccccccHHHHHHHHHcccccccccccccccHHHHHHccHHHHHHHHHHHHHccccccccEEEEEEEccccEEEEEEEEEEEEcccccccccccccccccccccEEEcccccccccccccEEEEEEcccccccHHHHHHHHHHEEEEEcccccEEEEEEEEEcccccccccccccccHHHHccccHHHHHHcccccHHcccEEEEEccccccccccHHHHHccccEEcccccccccccEEccEEEEEccEEEEEcccEEEEcccEEEEEEEEEEcccEEcccccccccEEEEEcccccccHHcccccccccEEEEEcccccccHHHcccEEEEEccHHHHHHHHHHHHcccccEEEEEEEccccccEEEEccccccccccccccccEEEEEEEcccccHcccccccccccccccccccEEEEEccccccccccccHHHccccEEEEEcccccccccccEEEEEEcccccccEEEEEcccccEEEEEccccccccHHHHHHHHHHHHHHHHcccccccccccccEEEEccEEEEEcccEEEEcccEEEEEEEEEEcccEEcccccccccEEEEccccccccHHcccccccccEEEEEccccccHcHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHHHHccccEEEEccHHHHcccccc
mvqdktsptlhigvigggaggltatkrltepgsgftcttfeqtdnvggtwvyteqtgrdqyglpvhssMYKSLKTNLPKEIMELsgyhhkghpdksyiAANDVLEYLNDFADNFNLRNLCLVNKNVQPLYKHLIniehpsmciigiprdtvgFYLFDLQVRFFLQLMQGhvtlpskaemLADTEQDVRGRlregqnpnafhiMGQRSEKYLNSLCSmmrdespvppvLLKIYFESFARCSEDFTEFRKDKYKIINekafvrdpgaangpsgldithdisTEATTVFLSHHSEhvkklrfpnnvvkkpdiaeltptgvrfqdgsyeqVDIILYCTgytyrypflhescgikvvnknvqPLYKHLINiehpsmciigytyrypflhescgikvvnknvqPLYKHLIniehpsmciigipvescgikvvnknvqpLYKHlinidhpsmciigipgdTVVFYMFDLqdkirpgrgnprpsaceadalptnltRLTYIISsrnysnpvypdfkgkdvcqipimhsheyrtpepfagkravvvgsgpsgldithdisteaTTVSAYLRFdnktitkrkkfdkgrnynhpiypefkgkdmcqipilhsrdyrtpepfagkqavvvgsgqsgldITLDIATRASTVFLshhservtslclpnnvvlkpdvaeltptgvrfqdgsyeqVDIILCCtgytnhypflhescgikvvnknvqplykhtiniehptmFILGVSFTIEEFIKVCpnivdrhgpggltatkrlteagngftcttfeqadniggtwlytehigcdqyglpvhssMYKSLKTNLPKDLMELcgyghkgnadksyigakdvlenynhpiypefkgkdmcqipilhsrdyrtpepfagkqavvvgsgqsgldITLDIATTGKQAVvvgsgqsgldITLDIATRASTVFLshhservtslclpnnvvlkpdvaeltptgvrfqdgsyeQVDIILCCtgysnhypflhescgikvvnknvqplykhtiniehptmfilgvprhtLLFNLFDLQVRLFQQLMQGhitlpskeeMLADTKQEVLAHLnegqnpntfhiiGHRSENFLNSIISMmrdesplppvLLKVYFDSYGQLTEDFIGFrnnkyqifndqayvrtgpvt
mvqdktsptlhigvigggagglTATKRLTEPGSGFtcttfeqtdnvgGTWVYTEQTGRDQYGLPVHSSMYKSLKTNLPKEIMELSGYHHKGHPDKSYIAANDVLEYLNDFADNFNLRNLCLVNKNVQPLYKHLINIEHPSMCIIGIPRDTVGFYLFDLQVRFFLQLMQGHVTLPSKAEMLADTEQDVRGRLREgqnpnafhimgqRSEKYLNSLCSMMRDESPVPPVLLKIYFESFARCSEDFTEFRKDKYKIINEkafvrdpgaangpsGLDITHDISTEATTVFLSHHSehvkklrfpnnvvkkpdiaeltptgvrfqdgsyeQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPVESCGIKVVNKNVQPLYKHLINIDHPSMCIIGIPGDTVVFYMFDLQDKIRpgrgnprpsaceadalptnLTRLTYIISSRNYSNPVYPDFKGKDVCQIPIMHSHEYRTPEPFAGKRAVVVGSGPSGLDIthdisteattvsaylrfdnktitkrkkfdkgrnynhpiypefkgkdmCQIPILHSRDYRTPEPFAGKQAVVVGSGQSGLDITLDIATRASTVFLSHHservtslclpnnVVLKPDVAELTPTGVRFQDGSYEQVDIILCCTGYTNHYPFLHESCGIKVVNKNVQPLYKHTINIEHPTMFILGVSFTIEEFIKVCPNIVDRHGPGGLTATKRLTEAGNGFTCTTFEQADNIGGTWLYTEHIGCDQYGLPVHSSMYKSLKTNLPKDLMELCGYGHKGNADKSYIGAKDVLENYNHPIYPEFKGKDMCQIPILHSRDYRTPEPFAGKQAVVVGSGQSGLDITLDIATTGKQAVVVGSGQSGLDITLDIATRASTVFLSHHservtslclpnnVVLKPDVAELTPTGVRFQDGSYEQVDIILCCTGYSNHYPFLHESCGIKVVNKNVQPLYKHTINIEHPTMFILGVPRHTLLFNLFDLQVRLFQQLMQGHITLPSKEEMLADTKQEVLAHLNEGQNPNTFHIIGHRSENFLNSIISMMRDESPLPPVLLKVYFDSYGQLTEDFIGFRNNKyqifndqayvrtgpvt
MVQDKTSPTLHigvigggaggLTATKRLTEPGSGFTCTTFEQTDNVGGTWVYTEQTGRDQYGLPVHSSMYKSLKTNLPKEIMELSGYHHKGHPDKSYIAANDVLEYLNDFADNFNLRNLCLVNKNVQPLYKHLINIEHPSMCIIGIPRDTVGFYLFDLQVRFFLQLMQGHVTLPSKAEMLADTEQDVRGRLREGQNPNAFHIMGQRSEKYLNSLCSMMRDESPVPPVLLKIYFESFARCSEDFTEFRKDKYKIINEKAFVRDPGAANGPSGLDITHDISTEATTVFLSHHSEHVKKLRFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPVESCGIKVVNKNVQPLYKHLINIDHPSMCIIGIPGDTVVFYMFDLQDKIRPGRGNPRPSACEADALPTNLTRLTYIISSRNYSNPVYPDFKGKDVCQIPIMHSHEYRTPEPFAGKRAVVVGSGPSGLDITHDISTEATTVSAYLRFDNKTITKRKKFDKGRNYNHPIYPEFKGKDMCQIPILHSRDYRTPEPFAGKQAVVVGSGQSGLDITLDIATRASTVFLSHHSERVTSLCLPNNVVLKPDVAELTPTGVRFQDGSYEQVDIILCCTGYTNHYPFLHESCGIKVVNKNVQPLYKHTINIEHPTMFILGVSFTIEEFIKVCPNIVDRHGPGGLTATKRLTEAGNGFTCTTFEQADNIGGTWLYTEHIGCDQYGLPVHSSMYKSLKTNLPKDLMELCGYGHKGNADKSYIGAKDVLENYNHPIYPEFKGKDMCQIPILHSRDYRTPEPFAGKQAVVVGSGQSGLDITLDIATTGKQAVVVGSGQSGLDITLDIATRASTVFLSHHSERVTSLCLPNNVVLKPDVAELTPTGVRFQDGSYEQVDIILCCTGYSNHYPFLHESCGIKVVNKNVQPLYKHTINIEHPTMFILGVPRHTLLFNLFDLQVRLFQQLMQGHITLPSKEEMLADTKQEVLAHLNEGQNPNTFHIIGHRSENFLNSIISMMRDESPLPPVLLKVYFDSYGQLTEDFIGFRNNKYQIFNDQAYVRTGPVT
*********LHIGVIGGGAGGLTATKRLTEPGSGFTCTTFEQTDNVGGTWVYTEQTGRDQYGLPVHSSMYKSLKTNLPKEIMELSGYHHKGHPDKSYIAANDVLEYLNDFADNFNLRNLCLVNKNVQPLYKHLINIEHPSMCIIGIPRDTVGFYLFDLQVRFFLQLMQGHVTL************************************YLNSLCSMM****PVPPVLLKIYFESFARCSEDFTEFRKDKYKIINEKAFVRDPGAAN**SGLDITHDISTEATTVFLSHHSEHVKKLRFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPVESCGIKVVNKNVQPLYKHLINIDHPSMCIIGIPGDTVVFYMFDLQDKI*************ADALPTNLTRLTYIISSRNYSNPVYPDFKGKDVCQIPIMHSHEYRTPEPFAGKRAVVVGSGPSGLDITHDISTEATTVSAYLRFDNKTITKRKKFDKGRNYNHPIYPEFKGKDMCQIPILHSRDYRTPEPFAGKQAVVVGSGQSGLDITLDIATRASTVFLSHHSERVTSLCLPNNVVLKPDVAELTPTGVRFQDGSYEQVDIILCCTGYTNHYPFLHESCGIKVVNKNVQPLYKHTINIEHPTMFILGVSFTIEEFIKVCPNIVDRHGPGGLTATKRLTEAGNGFTCTTFEQADNIGGTWLYTEHIGCDQYGLPVHSSMYKSLKTNLPKDLMELCGYGHKGNADKSYIGAKDVLENYNHPIYPEFKGKDMCQIPILHSRDYRTPEPFAGKQAVVVGSGQSGLDITLDIATTGKQAVVVGSGQSGLDITLDIATRASTVFLSHHSERVTSLCLPNNVVLKPDVAELTPTGVRFQDGSYEQVDIILCCTGYSNHYPFLHESCGIKVVNKNVQPLYKHTINIEHPTMFILGVPRHTLLFNLFDLQVRLFQQLMQGHITLP************VLAHLNEGQNPNTFHIIGHRSENFLNSIISMMRDESPLPPVLLKVYFDSYGQLTEDFIGFRNNKYQIFNDQAYVR*****
************GVIGGGAGGLTATKRLTEPGSGFTCTTFEQTDNVGGTWVYTEQTGRDQYGLPVHSSMYKSLKTNLPKEIMELSGYHHKGHPDKSYIAANDVLEYLNDFADNFNLRNLCLVNKNVQPLYKHLINIEHPSMCIIGIPRDTVGFYLFDLQVRFFLQLMQGHVTLPSKAEMLADTEQDVRGRLREGQNPNAFHIMGQRSEKYLNSLCSMMRDESPVPPVLLKIYFESFARCSEDFTEFRKDKYKIINEKAFVRDPGAANGPSGLDITHDISTEATTVFLSHHSEHVKKLRFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPVESCGIKVVNKNVQPLYKHLINIDHPSMCIIGIPGDTVVFYMFDLQDKIRPGRGNPRPSACEADALPTNLTRLTYIISSRNYSNPVYPDFKGKDVCQIPIMHSHEYRTPEPFAGKRAVVVGSGPSGLDITHDISTEATTVSAYLRFDNKTITKRKKFDKGRNYNHPIYPEFKGKDMCQIPILHSRDYRTPEPFAGKQAVVVGSGQSGLDITLDIATRASTVFLSHHSERVTSLCLPNNVVLKPDVAELTPTGVRFQDGSYEQVDIILCCTGYTNHYPFLHESCGIKVVNKNVQPLYKHTINIEHPTMFILGVSFTIEEFIKVCPNIVDRHGPGGLTATKRLTEAGNGFTCTTFEQADNIGGTWLYTEHIGCDQYGLPVHSSMYKSLKTNLPKDLMELCGYGHKGNADKSYIGAKDVLENYNHPIYPEFKGKDMCQIPILHSRDYRTPEPFAGKQAVVVGSGQSGLDITLDIATTGKQAVVVGSGQSGLDITLDIATRASTVFLSHHSERVTSLCLPNNVVLKPDVAELTPTGVRFQDGSYEQVDIILCCTGYSNHYPFLHESCGIKVVNKNVQPLYKHTINIEHPTMFILGVPRHTLLFNLFDLQVRLFQQLMQGHITLPSKEEMLADTKQEVLAHLN*GQNPNTFHIIGHRSENFLNSIISMMRDESPLPPVLLKVYFDSYGQLTEDFIGFRNNKYQIFNDQAYVRTGPV*
MVQDKTSPTLHIGVIGGGAGGLTATKRLTEPGSGFTCTTFEQTDNVGGTWVYTEQTGRDQYGLPVHSSMYKSLKTNLPKEIMELSGYHHKGHPDKSYIAANDVLEYLNDFADNFNLRNLCLVNKNVQPLYKHLINIEHPSMCIIGIPRDTVGFYLFDLQVRFFLQLMQGHVTLPSKAEMLADTEQDVRGRLREGQNPNAFHIMGQRSEKYLNSLCSMMRDESPVPPVLLKIYFESFARCSEDFTEFRKDKYKIINEKAFVRDPGAANGPSGLDITHDISTEATTVFLSHHSEHVKKLRFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPVESCGIKVVNKNVQPLYKHLINIDHPSMCIIGIPGDTVVFYMFDLQDKIRPGRGNPRPSACEADALPTNLTRLTYIISSRNYSNPVYPDFKGKDVCQIPIMHSHEYRTPEPFAGKRAVVVGSGPSGLDITHDISTEATTVSAYLRFDNKTITKRKKFDKGRNYNHPIYPEFKGKDMCQIPILHSRDYRTPEPFAGKQAVVVGSGQSGLDITLDIATRASTVFLSHHSERVTSLCLPNNVVLKPDVAELTPTGVRFQDGSYEQVDIILCCTGYTNHYPFLHESCGIKVVNKNVQPLYKHTINIEHPTMFILGVSFTIEEFIKVCPNIVDRHGPGGLTATKRLTEAGNGFTCTTFEQADNIGGTWLYTEHIGCDQYGLPVHSSMYKSLKTNLPKDLMELCGYGHKGNADKSYIGAKDVLENYNHPIYPEFKGKDMCQIPILHSRDYRTPEPFAGKQAVVVGSGQSGLDITLDIATTGKQAVVVGSGQSGLDITLDIATRASTVFLSHHSERVTSLCLPNNVVLKPDVAELTPTGVRFQDGSYEQVDIILCCTGYSNHYPFLHESCGIKVVNKNVQPLYKHTINIEHPTMFILGVPRHTLLFNLFDLQVRLFQQLMQGHITLPSKEEMLADTKQEVLAHLNEGQNPNTFHIIGHRSENFLNSIISMMRDESPLPPVLLKVYFDSYGQLTEDFIGFRNNKYQIFNDQAYVRTGPVT
*******PTLHIGVIGGGAGGLTATKRLTEPGSGFTCTTFEQTDNVGGTWVYTEQTGRDQYGLPVHSSMYKSLKTNLPKEIMELSGYHHKGHPDKSYIAANDVLEYLNDFADNFNLRNLCLVNKNVQPLYKHLINIEHPSMCIIGIPRDTVGFYLFDLQVRFFLQLMQGHVTLPSKAEMLADTEQDVRGRLREGQNPNAFHIMGQRSEKYLNSLCSMMRDESPVPPVLLKIYFESFARCSEDFTEFRKDKYKIINEKAFVRDPGAANGPSGLDITHDISTEATTVFLSHHSEHVKKLRFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPVESCGIKVVNKNVQPLYKHLINIDHPSMCIIGIPGDTVVFYMFDLQDKIRPGRGNPRPSACEADALPTNLTRLTYIISSRNYSNPVYPDFKGKDVCQIPIMHSHEYRTPEPFAGKRAVVVGSGPSGLDITHDISTEATTVSAYLRFDNKTITKRKKFDKGRNYNHPIYPEFKGKDMCQIPILHSRDYRTPEPFAGKQAVVVGSGQSGLDITLDIATRASTVFLSHHSERVTSLCLPNNVVLKPDVAELTPTGVRFQDGSYEQVDIILCCTGYTNHYPFLHESCGIKVVNKNVQPLYKHTINIEHPTMFILGVSFTIEEFIKVCPNIVDRHGPGGLTATKRLTEAGNGFTCTTFEQADNIGGTWLYTEHIGCDQYGLPVHSSMYKSLKTNLPKDLMELCGYGHKGNADKSYIGAKDVLENYNHPIYPEFKGKDMCQIPILHSRDYRTPEPFAGKQAVVVGSGQSGLDITLDIATTGKQAVVVGSGQSGLDITLDIATRASTVFLSHHSERVTSLCLPNNVVLKPDVAELTPTGVRFQDGSYEQVDIILCCTGYSNHYPFLHESCGIKVVNKNVQPLYKHTINIEHPTMFILGVPRHTLLFNLFDLQVRLFQQLMQGHITLPSKEEMLADTKQEVLAHLNEGQNPNTFHIIGHRSENFLNSIISMMRDESPLPPVLLKVYFDSYGQLTEDFIGFRNNKYQIFNDQAYVRTGPVT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVQDKTSPTLHIGVIGGGAGGLTATKRLTEPGSGFTCTTFEQTDNVGGTWVYTEQTGRDQYGLPVHSSMYKSLKTNLPKEIMELSGYHHKGHPDKSYIAANDVLEYLNDFADNFNLRNLCLVNKNVQPLYKHLINIEHPSMCIIGIPRDTVGFYLFDLQVRFFLQLMQGHVTLPSKAEMLADTEQDVRGRLREGQNPNAFHIMGQRSEKYLNSLCSMMRDESPVPPVLLKIYFESFARCSEDFTEFRKDKYKIINEKAFVRDPGAANGPSGLDITHDISTEATTVFLSHHSEHVKKLRFPNNVVKKPDIAELTPTGVRFQDGSYEQVDIILYCTGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGYTYRYPFLHESCGIKVVNKNVQPLYKHLINIEHPSMCIIGIPVESCGIKVVNKNVQPLYKHLINIDHPSMCIIGIPGDTVVFYMFDLQDKIRPGRGNPRPSACEADALPTNLTRLTYIISSRNYSNPVYPDFKGKDVCQIPIMHSHEYRTPEPFAGKRAVVVGSGPSGLDITHDISTEATTVSAYLRFDNKTITKRKKFDKGRNYNHPIYPEFKGKDMCQIPILHSRDYRTPEPFAGKQAVVVGSGQSGLDITLDIATRASTVFLSHHSERVTSLCLPNNVVLKPDVAELTPTGVRFQDGSYEQVDIILCCTGYTNHYPFLHESCGIKVVNKNVQPLYKHTINIEHPTMFILGVSFTIEEFIKVCPNIVDRHGPGGLTATKRLTEAGNGFTCTTFEQADNIGGTWLYTEHIGCDQYGLPVHSSMYKSLKTNLPKDLMELCGYGHKGNADKSYIGAKDVLENYNHPIYPEFKGKDMCQIPILHSRDYRTPEPFAGKQAVVVGSGQSGLDITLDIATTGKQAVVVGSGQSGLDITLDIATRASTVFLSHHSERVTSLCLPNNVVLKPDVAELTPTGVRFQDGSYEQVDIILCCTGYSNHYPFLHESCGIKVVNKNVQPLYKHTINIEHPTMFILGVPRHTLLFNLFDLQVRLFQQLMQGHITLPSKEEMLADTKQEVLAHLNEGQNPNTFHIIGHRSENFLNSIISMMRDESPLPPVLLKVYFDSYGQLTEDFIGFRNNKYQIFNDQAYVRTGPVT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1129 2.2.26 [Sep-21-2011]
Q8MP06456 Senecionine N-oxygenase O N/A N/A 0.326 0.809 0.284 2e-35
Q9FF12460 Flavin-containing monooxy yes N/A 0.255 0.626 0.273 8e-31
Q9FWW6468 Flavin-containing monooxy no N/A 0.262 0.632 0.286 2e-25
Q9SXE1462 Flavin-containing monooxy no N/A 0.289 0.707 0.259 2e-24
Q9SS04459 Flavin-containing monooxy no N/A 0.271 0.668 0.255 2e-24
Q9FLK4461 Flavin-containing monooxy no N/A 0.189 0.464 0.311 6e-24
A8MRX0459 Flavin-containing monooxy no N/A 0.274 0.675 0.283 2e-23
Q9FWW9465 Flavin-containing monooxy no N/A 0.252 0.612 0.269 4e-23
Q94BV5452 Flavin-containing monooxy no N/A 0.245 0.612 0.276 1e-22
Q93Y23461 Flavin-containing monooxy no N/A 0.275 0.674 0.268 1e-22
>sp|Q8MP06|SNO1_TYRJA Senecionine N-oxygenase OS=Tyria jacobaeae GN=sno1 PE=1 SV=1 Back     alignment and function desciption
 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 119/418 (28%), Positives = 188/418 (44%), Gaps = 49/418 (11%)

Query: 748  GPGGLTATKRLTEAGNGFTCTTFEQADNIGGTWLYTEHIGCDQYGLPVHSSMYKSLKTNL 807
            G  GL   + L + G  +T   FE   NIGGTW Y   +G D+ G+P++SS YK+L+ N 
Sbjct: 34   GYSGLATARYLQDYGLNYTI--FEATPNIGGTWRYDPRVGTDEDGIPIYSSNYKNLRVNS 91

Query: 808  PKDLMELCGYGHK--------GNA----DKSYIGAKDVLEN----------------YNH 839
            P DLM   GY  +        GN      KS++    ++EN                +N 
Sbjct: 92   PVDLMTYHGYEFQEGTRSFISGNCFYKYMKSFVRHFGLMENIQVRSLVTWVQRTEDKWNL 151

Query: 840  PIYPEFKGKDM---CQIPILHSRDYRTPE-PFAGKQAVVVGSGQSGLDITLDIATTGKQA 895
                    K+    C   ++ S ++ TP+ P    Q    G      D     +  G++ 
Sbjct: 152  TYMKTDTRKNYTEECDFVVVASGEFSTPKIPHIKGQEEYKGKTMHSHDYKEAESFRGQRV 211

Query: 896  VVVGSGQSGLDITLDIATRASTVFLSHHSERVTSLC----LPNNVVLKPDVAELTPTGVR 951
            +V+G+G SGLD+ + ++   S +  S H  +   +      P N + KP+V   T  G  
Sbjct: 212  LVIGAGPSGLDVVMQLSNITSKLVHSQHILKSWHIFNQPDFPGNFISKPNVKHFTANGAV 271

Query: 952  FQDGSYEQVDIILCCTGYSNHYPFLHE-SCGIKVVNKNVQPLYKHTINIEHPTMFILGVP 1010
            F+D + E+ D+++ CTG+  ++PFL   S GI      V PLY+  +NI  PTM  +G+ 
Sbjct: 272  FEDDTVEEFDMVIYCTGFYYNHPFLSTLSSGITATENYVMPLYQQVVNINQPTMTFVGIC 331

Query: 1011 RHTLLFNLFDLQVRLFQQLMQGHITLPSKEEMLADTKQEVLAHLNEGQNPNT-FHIIGHR 1069
            +      L D Q     +L  GH  LPS+++ML    + V   L E Q   T  + +G  
Sbjct: 332  K-PFFAKLLDQQAHYSAKLAAGHFKLPSQDKMLRHWLEHV-QMLREAQFKITDVNSVGPN 389

Query: 1070 SENFLNSIISMMRDESP---LPPVLLKVYFDSYGQLTEDFIGFRNNKYQIFNDQAYVR 1124
             + +  +    +  E+    LPPV   V+  S   L ED   +R   Y+I +D  + +
Sbjct: 390  VDEYFKA----LHKEAGVPLLPPVYASVFVFSGKTLLEDLQNYREYDYRIISDTQFKK 443
NADPH-dependent monooxygenase that detoxifies senecionine and similar plant alkaloids that are ingested by the larvae. Is active towards a narrow range of related substrates with highest activity towards senecionine, followed by seneciphylline, retrorsine, monocrotaline, senecivernine, axillarine and axillaridine.
Tyria jacobaeae (taxid: 179666)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 1EC: 0EC: 1
>sp|Q9FF12|GSXL9_ARATH Flavin-containing monooxygenase FMO GS-OX-like 9 OS=Arabidopsis thaliana GN=At5g07800 PE=2 SV=1 Back     alignment and function description
>sp|Q9FWW6|GSXL1_ARATH Flavin-containing monooxygenase FMO GS-OX-like 1 OS=Arabidopsis thaliana GN=At1g12160 PE=2 SV=1 Back     alignment and function description
>sp|Q9SXE1|GSOX3_ARATH Flavin-containing monooxygenase FMO GS-OX3 OS=Arabidopsis thaliana GN=FMOGS-OX3 PE=2 SV=1 Back     alignment and function description
>sp|Q9SS04|GSOX1_ARATH Flavin-containing monooxygenase FMO GS-OX1 OS=Arabidopsis thaliana GN=FMOGS-OX1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLK4|GSXL8_ARATH Flavin-containing monooxygenase FMO GS-OX-like 8 OS=Arabidopsis thaliana GN=At5g61290 PE=2 SV=1 Back     alignment and function description
>sp|A8MRX0|GSOX5_ARATH Flavin-containing monooxygenase FMO GS-OX5 OS=Arabidopsis thaliana GN=FMOGS-OX5 PE=2 SV=2 Back     alignment and function description
>sp|Q9FWW9|GSXL2_ARATH Flavin-containing monooxygenase FMO GS-OX-like 2 OS=Arabidopsis thaliana GN=At1g12200 PE=2 SV=1 Back     alignment and function description
>sp|Q94BV5|GSXL4_ARATH Flavin-containing monooxygenase FMO GS-OX-like 4 OS=Arabidopsis thaliana GN=At1g62600 PE=2 SV=1 Back     alignment and function description
>sp|Q93Y23|GSOX4_ARATH Flavin-containing monooxygenase FMO GS-OX4 OS=Arabidopsis thaliana GN=FMOGS-OX4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1129
193659748444 PREDICTED: flavin-containing monooxygena 0.315 0.801 0.382 2e-78
193659750448 PREDICTED: flavin-containing monooxygena 0.330 0.832 0.407 1e-76
380027061419 PREDICTED: dimethylaniline monooxygenase 0.312 0.842 0.336 2e-63
66500583419 PREDICTED: flavin-containing monooxygena 0.312 0.842 0.329 4e-63
383864815419 PREDICTED: flavin-containing monooxygena 0.312 0.842 0.334 5e-63
156537946423 PREDICTED: flavin-containing monooxygena 0.314 0.839 0.328 1e-61
296427835432 flavin-dependent monooxygenase FMO3A [Bo 0.291 0.761 0.338 2e-61
297206721432 flavin-dependent monooxygenase FMO3 prec 0.290 0.759 0.343 3e-60
312371814416 hypothetical protein AND_21611 [Anophele 0.322 0.875 0.345 4e-59
340709203419 PREDICTED: flavin-containing monooxygena 0.332 0.894 0.332 4e-58
>gi|193659748|ref|XP_001946449.1| PREDICTED: flavin-containing monooxygenase FMO GS-OX3-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  300 bits (769), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 167/437 (38%), Positives = 234/437 (53%), Gaps = 81/437 (18%)

Query: 748  GPGGLTATKRLTEAGNGFTCTTFEQADNIGGTWLYTEHIGCDQYGLPVHSSMYKSLKTNL 807
            G  GL A K  T  G+ F C  FEQ DN+GGTW+YT+ +G D+YGLPVHSSMYKSL+TNL
Sbjct: 17   GGAGLAAIKHFTAEGSLFKCVAFEQTDNVGGTWVYTDRVGKDKYGLPVHSSMYKSLRTNL 76

Query: 808  PK-----------------------------------DLMELCGYGH--------KGNAD 824
            PK                                   DLM+   + H        +GN  
Sbjct: 77   PKEIMELQGFPHKGPEDKSYVAANEMLKYLEDYADHFDLMKHIKFHHHVKEISPLEGNRW 136

Query: 825  K--------------SYIGAKDVLENYNHPIYPEFKGKDMCQIPILHSRDYRTPEPFAGK 870
            +               + G    + NY++P  PE  G +  +   +HS DYR    F   
Sbjct: 137  RVTVIDLQENNVEILEFDGVIICIGNYSNPAIPEVPGIEKFRGIKMHSHDYRDSSVF--- 193

Query: 871  QAVVVGSGQSGLDITLDIATTGKQAVVVGSGQSGLDITLDIATRASTVFLSHHSERVTSL 930
                                  K   V+G G SGLDI+ DIA  A  V+LSHH++RV ++
Sbjct: 194  --------------------KDKSIAVIGCGPSGLDISFDIAKVAEKVYLSHHNQRVKNM 233

Query: 931  CLPNNVVLKPDVAELTPTGVRFQDGSYEQVDIILCCTGYSNHYPFLHESCGIKVVNKNVQ 990
              P+N+V K D+ E+   G+ FQDGSYEQVD IL CTGY+  YPFL   CGI+V N +V+
Sbjct: 234  KFPSNMVQKTDIKEVVENGIVFQDGSYEQVDSILYCTGYNYKYPFLSPECGIRVENNHVK 293

Query: 991  PLYKHTINIEHPTMFILGVPRHTLLFNLFDLQVRLFQQLMQGHITLPSKEEMLADTKQEV 1050
            PL+KH +NIEHPTM+ +G+P +T  F + DLQV+  +  ++G + LPSKEEM+ DT+ +V
Sbjct: 294  PLFKHVLNIEHPTMYFIGIPTNTAGFCMIDLQVQFAKTFLEGRMKLPSKEEMIEDTRLDV 353

Query: 1051 LAHLNEGQNPNTFHIIGHRSENFLNSIISMMRDESPLPPVLLKVYFDSYGQLTEDFIGFR 1110
               L  G  P   H++G RS+++ +S+ S+   ES + PV+L++YFD   +   DF  FR
Sbjct: 354  ELRLASGLRPKELHMMGRRSKDYYDSLASLSGLES-VSPVVLQIYFDGIDRFMCDFSHFR 412

Query: 1111 NNKYQIFNDQAYVRTGP 1127
             +KY++ +   Y+   P
Sbjct: 413  EDKYKLLDKDHYMVKFP 429

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|193659750|ref|XP_001944207.1| PREDICTED: flavin-containing monooxygenase FMO GS-OX4-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|380027061|ref|XP_003697254.1| PREDICTED: dimethylaniline monooxygenase [N-oxide-forming] 2-like [Apis florea] Back     alignment and taxonomy information
>gi|66500583|ref|XP_394164.2| PREDICTED: flavin-containing monooxygenase FMO GS-OX-like 3-like [Apis mellifera] Back     alignment and taxonomy information
>gi|383864815|ref|XP_003707873.1| PREDICTED: flavin-containing monooxygenase FMO GS-OX-like 3-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|156537946|ref|XP_001608165.1| PREDICTED: flavin-containing monooxygenase FMO GS-OX3-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|296427835|gb|ADH16749.1| flavin-dependent monooxygenase FMO3A [Bombyx mori] Back     alignment and taxonomy information
>gi|297206721|ref|NP_001171913.1| flavin-dependent monooxygenase FMO3 precursor [Bombyx mori] gi|296427837|gb|ADH16750.1| flavin-dependent monooxygenase FMO3B [Bombyx mori] Back     alignment and taxonomy information
>gi|312371814|gb|EFR19906.1| hypothetical protein AND_21611 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|340709203|ref|XP_003393201.1| PREDICTED: flavin-containing monooxygenase FMO GS-OX-like 3-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1129
FB|FBgn0033079429 Fmo-2 "Flavin-containing monoo 0.205 0.540 0.358 3.4e-65
FB|FBgn0034943416 Fmo-1 "Flavin-containing monoo 0.205 0.557 0.330 1.6e-51
ZFIN|ZDB-GENE-031010-24449 zgc:77439 "zgc:77439" [Danio r 0.201 0.505 0.299 6.8e-46
WB|WBGene00007254405 C01H6.4 [Caenorhabditis elegan 0.200 0.558 0.310 2.4e-37
UNIPROTKB|Q8MP06456 sno1 "Senecionine N-oxygenase" 0.238 0.589 0.283 6e-37
TAIR|locus:2201971459 FMO GS-OX5 "flavin-monooxygena 0.161 0.396 0.342 1.3e-30
TAIR|locus:2163193461 AT5G61290 "AT5G61290" [Arabido 0.187 0.459 0.326 4.5e-30
TIGR_CMR|SPO_1551450 SPO_1551 "flavin-containing mo 0.193 0.484 0.281 1.4e-29
TAIR|locus:2203911464 NOGC1 "AT1G62580" [Arabidopsis 0.169 0.411 0.313 1.1e-28
TAIR|locus:2203891462 FMO GS-OX3 "AT1G62560" [Arabid 0.158 0.387 0.294 1.2e-28
FB|FBgn0033079 Fmo-2 "Flavin-containing monooxygenase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 405 (147.6 bits), Expect = 3.4e-65, Sum P(3) = 3.4e-65
 Identities = 84/234 (35%), Positives = 131/234 (55%)

Query:   894 QAVVVGSGQSGLDITLDIATRASTVFLSHHSERVTSLCLPNNVVLKPDVAELTPTGVRFQ 953
             + +++G+G SG+DIT  +   A  VFLSHH     +     NV  KPDV   T  G  F 
Sbjct:   193 RVLIIGAGPSGMDITNHVRLAAKQVFLSHHLSTTPNTAFMGNVTQKPDVKRFTKDGAVFT 252

Query:   954 DGSYEQVDIILCCTGYSNHYPFLHESCGIKVVNKNVQPLYKHTINIEHPTMFILGVPRHT 1013
             DGS E  D ++ CTGY   +P L    G++V++  VQPL+KH INI HPTM  +G+P + 
Sbjct:   253 DGSTESFDHVMFCTGYKYTFPCLSTDVGVQVIDNFVQPLWKHCININHPTMAFVGLPFNV 312

Query:  1014 LLFNLFDLQVRLFQQLMQGHITLPSKEEMLADTKQEVLAHLNEG-QNPNTFHIIGHRSEN 1072
             +  ++FD+QVR   +   G    PS+E+M+AD +QE+      G +N    H +G R   
Sbjct:   313 IPTHIFDMQVRFTLKFFTGQRKFPSREQMIADLEQEIGERWGCGVRNQKKAHQMGERQFV 372

Query:  1073 FLNSIISMMRDESPLPPVLLKVYFDSYGQLTEDFIGFRNNKYQIFNDQAYVRTG 1126
             + N + S+   E+ + PV+ K+  D   +   +   +R+NKY I +D+ +++ G
Sbjct:   373 YYNELASIAGIEN-IKPVIHKLMKDCGKKYIFELDTYRSNKYTILDDENFLKNG 425
GO:0004499 "N,N-dimethylaniline monooxygenase activity" evidence=ISS;NAS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0050661 "NADP binding" evidence=IEA
GO:0004497 "monooxygenase activity" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0043231 "intracellular membrane-bounded organelle" evidence=IDA
FB|FBgn0034943 Fmo-1 "Flavin-containing monooxygenase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031010-24 zgc:77439 "zgc:77439" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00007254 C01H6.4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MP06 sno1 "Senecionine N-oxygenase" [Tyria jacobaeae (taxid:179666)] Back     alignment and assigned GO terms
TAIR|locus:2201971 FMO GS-OX5 "flavin-monooxygenase glucosinolate S-oxygenase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163193 AT5G61290 "AT5G61290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1551 SPO_1551 "flavin-containing monooxygenase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TAIR|locus:2203911 NOGC1 "AT1G62580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203891 FMO GS-OX3 "AT1G62560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.14.13LOW CONFIDENCE prediction!
3rd Layer1.14.13.8LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1129
PLN02172461 PLN02172, PLN02172, flavin-containing monooxygenas 3e-28
pfam00743532 pfam00743, FMO-like, Flavin-binding monooxygenase- 2e-21
PLN02172461 PLN02172, PLN02172, flavin-containing monooxygenas 5e-17
PLN02172461 PLN02172, PLN02172, flavin-containing monooxygenas 3e-15
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in 3e-15
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in 4e-12
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in 2e-11
pfam00743532 pfam00743, FMO-like, Flavin-binding monooxygenase- 2e-10
PLN02172461 PLN02172, PLN02172, flavin-containing monooxygenas 3e-10
pfam00743532 pfam00743, FMO-like, Flavin-binding monooxygenase- 3e-10
pfam00743532 pfam00743, FMO-like, Flavin-binding monooxygenase- 2e-09
pfam00743532 pfam00743, FMO-like, Flavin-binding monooxygenase- 8e-08
PLN02172461 PLN02172, PLN02172, flavin-containing monooxygenas 4e-07
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in 1e-05
pfam00743532 pfam00743, FMO-like, Flavin-binding monooxygenase- 2e-05
TIGR04046400 TIGR04046, MSMEG_0569_nitr, flavin-dependent oxido 6e-05
PLN02172461 PLN02172, PLN02172, flavin-containing monooxygenas 1e-04
pfam13434335 pfam13434, K_oxygenase, L-lysine 6-monooxygenase ( 5e-04
TIGR04046400 TIGR04046, MSMEG_0569_nitr, flavin-dependent oxido 7e-04
pfam13434335 pfam13434, K_oxygenase, L-lysine 6-monooxygenase ( 7e-04
pfam13434335 pfam13434, K_oxygenase, L-lysine 6-monooxygenase ( 7e-04
TIGR04018316 TIGR04018, Bthiol_YpdA, putative bacillithiol syst 0.001
COG1232444 COG1232, HemY, Protoporphyrinogen oxidase [Coenzym 0.002
pfam1345066 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- 0.002
pfam00743 532 pfam00743, FMO-like, Flavin-binding monooxygenase- 0.003
TIGR03169364 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disu 0.004
>gnl|CDD|215116 PLN02172, PLN02172, flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information 
 Score =  119 bits (299), Expect = 3e-28
 Identities = 112/402 (27%), Positives = 170/402 (42%), Gaps = 75/402 (18%)

Query: 748  GPGGLTATKRLTEAGNGFTCTTFEQADNIGGTWLYTEHIGCDQYGLP-----VHSSMYKS 802
            G  GL A + L   G+  T   FE+   +GG W+YT     D   L      VHSS+Y+S
Sbjct: 19   GAAGLVAARELRREGH--TVVVFEREKQVGGLWVYTPKSESDPLSLDPTRSIVHSSVYES 76

Query: 803  LKTNLPKDLMELCGY-----GHKGNAD-KSYIGAKDVLENYNHPIYPEFKGKDMCQIPIL 856
            L+TNLP++ M    +         + D + Y   ++VL  Y      EFK ++M +    
Sbjct: 77   LRTNLPRECMGYRDFPFVPRFDDESRDSRRYPSHREVLA-YLQDFAREFKIEEMVRFETE 135

Query: 857  HSRDYRTPEPFAGK-----------------QAVVVGSGQ---------SGLDITLDIAT 890
              R     EP  GK                  AVVV +G           G+      + 
Sbjct: 136  VVR----VEPVDGKWRVQSKNSGGFSKDEIFDAVVVCNGHYTEPNVAHIPGIK-----SW 186

Query: 891  TGKQ----------------AVVVGSGQSGLDITLDIATRASTVFL-SHHSERVTSLCLP 933
             GKQ                 VV+G+  SG DI+ DIA  A  V + S  SE  T   LP
Sbjct: 187  PGKQIHSHNYRVPDPFKNEVVVVIGNFASGADISRDIAKVAKEVHIASRASESDTYEKLP 246

Query: 934  ---NNVVLKPDVAELTPTG-VRFQDGSYEQVDIILCCTGYSNHYPFLHESCGIKVVNKNV 989
               NN+ +  ++      G + F++G     D I+ CTGY  H+PFL  +  +++    V
Sbjct: 247  VPQNNLWMHSEIDTAHEDGSIVFKNGKVVYADTIVHCTGYKYHFPFLETNGYMRIDENRV 306

Query: 990  QPLYKHTINIE-HPTMFILGVPRHTLLFNLFDLQVRLFQQLMQGHITLPSKEEMLADTKQ 1048
            +PLYKH       P +  +G+P   + F +F++Q +    ++ G +TLPS+++M+ D   
Sbjct: 307  EPLYKHVFPPALAPGLSFIGLPAMGIQFVMFEIQSKWVAAVLSGRVTLPSEDKMMEDINA 366

Query: 1049 EVLAHLNEGQNPNTFHIIGHRSENFLNSIISMMRDESPLPPV 1090
               +    G      H +G     +LN I     +E   P V
Sbjct: 367  WYASLEALGIPKRYTHKLGKIQSEYLNWIA----EECGCPLV 404

Length = 461
>gnl|CDD|109787 pfam00743, FMO-like, Flavin-binding monooxygenase-like Back     alignment and domain information
>gnl|CDD|215116 PLN02172, PLN02172, flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>gnl|CDD|215116 PLN02172, PLN02172, flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|109787 pfam00743, FMO-like, Flavin-binding monooxygenase-like Back     alignment and domain information
>gnl|CDD|215116 PLN02172, PLN02172, flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>gnl|CDD|109787 pfam00743, FMO-like, Flavin-binding monooxygenase-like Back     alignment and domain information
>gnl|CDD|109787 pfam00743, FMO-like, Flavin-binding monooxygenase-like Back     alignment and domain information
>gnl|CDD|109787 pfam00743, FMO-like, Flavin-binding monooxygenase-like Back     alignment and domain information
>gnl|CDD|215116 PLN02172, PLN02172, flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|109787 pfam00743, FMO-like, Flavin-binding monooxygenase-like Back     alignment and domain information
>gnl|CDD|234447 TIGR04046, MSMEG_0569_nitr, flavin-dependent oxidoreductase, MSMEG_0569 family Back     alignment and domain information
>gnl|CDD|215116 PLN02172, PLN02172, flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>gnl|CDD|222125 pfam13434, K_oxygenase, L-lysine 6-monooxygenase (NADPH-requiring) Back     alignment and domain information
>gnl|CDD|234447 TIGR04046, MSMEG_0569_nitr, flavin-dependent oxidoreductase, MSMEG_0569 family Back     alignment and domain information
>gnl|CDD|222125 pfam13434, K_oxygenase, L-lysine 6-monooxygenase (NADPH-requiring) Back     alignment and domain information
>gnl|CDD|222125 pfam13434, K_oxygenase, L-lysine 6-monooxygenase (NADPH-requiring) Back     alignment and domain information
>gnl|CDD|188533 TIGR04018, Bthiol_YpdA, putative bacillithiol system oxidoreductase, YpdA family Back     alignment and domain information
>gnl|CDD|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain Back     alignment and domain information
>gnl|CDD|109787 pfam00743, FMO-like, Flavin-binding monooxygenase-like Back     alignment and domain information
>gnl|CDD|234134 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1129
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 100.0
PLN02172461 flavin-containing monooxygenase FMO GS-OX 100.0
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 100.0
PLN02172461 flavin-containing monooxygenase FMO GS-OX 100.0
KOG1399|consensus448 100.0
KOG1399|consensus448 100.0
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 99.94
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 99.93
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.92
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 99.91
PLN02507499 glutathione reductase 99.89
KOG0405|consensus478 99.89
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.89
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 99.89
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.88
PRK13512438 coenzyme A disulfide reductase; Provisional 99.88
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.87
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.87
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 99.87
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 99.87
PRK06116450 glutathione reductase; Validated 99.87
PTZ00052499 thioredoxin reductase; Provisional 99.87
PRK06370463 mercuric reductase; Validated 99.86
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.86
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 99.86
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 99.86
PLN02546558 glutathione reductase 99.86
PRK12831464 putative oxidoreductase; Provisional 99.85
PRK09564444 coenzyme A disulfide reductase; Reviewed 99.85
PRK14727479 putative mercuric reductase; Provisional 99.85
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 99.85
PRK07846451 mycothione reductase; Reviewed 99.85
PRK10262321 thioredoxin reductase; Provisional 99.85
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 99.85
PRK14694468 putative mercuric reductase; Provisional 99.85
TIGR02053463 MerA mercuric reductase. This model represents the 99.85
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.85
PTZ00318424 NADH dehydrogenase-like protein; Provisional 99.84
PTZ00058561 glutathione reductase; Provisional 99.84
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 99.84
PRK13748561 putative mercuric reductase; Provisional 99.84
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 99.84
PRK06292460 dihydrolipoamide dehydrogenase; Validated 99.84
PLN02507499 glutathione reductase 99.83
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 99.83
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.83
PRK098531019 putative selenate reductase subunit YgfK; Provisio 99.83
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 99.83
TIGR02374785 nitri_red_nirB nitrite reductase [NAD(P)H], large 99.82
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 99.82
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 99.82
PRK12779944 putative bifunctional glutamate synthase subunit b 99.82
PTZ00153659 lipoamide dehydrogenase; Provisional 99.82
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 99.82
PRK07845466 flavoprotein disulfide reductase; Reviewed 99.82
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 99.82
PRK14989847 nitrite reductase subunit NirD; Provisional 99.82
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 99.81
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 99.81
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 99.81
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.81
KOG0405|consensus478 99.81
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.81
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 99.81
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.81
PRK14727479 putative mercuric reductase; Provisional 99.81
PRK06116450 glutathione reductase; Validated 99.81
PRK05976472 dihydrolipoamide dehydrogenase; Validated 99.8
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 99.8
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 99.8
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 99.79
PRK06327475 dihydrolipoamide dehydrogenase; Validated 99.79
PRK06370463 mercuric reductase; Validated 99.79
PRK14694468 putative mercuric reductase; Provisional 99.79
PRK12814652 putative NADPH-dependent glutamate synthase small 99.79
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.79
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 99.79
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.78
KOG1335|consensus506 99.78
PLN02546558 glutathione reductase 99.78
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 99.78
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.78
PTZ00052499 thioredoxin reductase; Provisional 99.78
TIGR02053463 MerA mercuric reductase. This model represents the 99.78
KOG1336|consensus478 99.78
KOG0404|consensus322 99.78
PRK07846451 mycothione reductase; Reviewed 99.77
PTZ00153659 lipoamide dehydrogenase; Provisional 99.77
PRK10262321 thioredoxin reductase; Provisional 99.77
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 99.77
PRK13748561 putative mercuric reductase; Provisional 99.77
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 99.76
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 99.76
KOG4716|consensus503 99.76
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 99.76
PRK06292460 dihydrolipoamide dehydrogenase; Validated 99.76
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 99.76
PRK12770352 putative glutamate synthase subunit beta; Provisio 99.76
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 99.76
PRK13512438 coenzyme A disulfide reductase; Provisional 99.75
PTZ00058561 glutathione reductase; Provisional 99.75
PRK07845466 flavoprotein disulfide reductase; Reviewed 99.74
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 99.74
PRK12831464 putative oxidoreductase; Provisional 99.74
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.73
PRK09564444 coenzyme A disulfide reductase; Reviewed 99.73
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 99.73
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 99.73
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 99.73
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.72
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 99.72
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 99.72
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 99.72
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 99.72
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 99.72
PRK14989 847 nitrite reductase subunit NirD; Provisional 99.71
KOG2495|consensus491 99.71
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.71
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 99.71
KOG1335|consensus506 99.71
PRK06327475 dihydrolipoamide dehydrogenase; Validated 99.7
PRK05976472 dihydrolipoamide dehydrogenase; Validated 99.7
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 99.7
PRK12779 944 putative bifunctional glutamate synthase subunit b 99.7
PLN02852491 ferredoxin-NADP+ reductase 99.7
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 99.69
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 99.69
COG1251793 NirB NAD(P)H-nitrite reductase [Energy production 99.69
PTZ00318424 NADH dehydrogenase-like protein; Provisional 99.69
PRK098531019 putative selenate reductase subunit YgfK; Provisio 99.68
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 99.68
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 99.68
PRK12771564 putative glutamate synthase (NADPH) small subunit; 99.67
TIGR01372985 soxA sarcosine oxidase, alpha subunit family, hete 99.66
PRK13984604 putative oxidoreductase; Provisional 99.66
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 99.65
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 99.64
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 99.64
PRK12814652 putative NADPH-dependent glutamate synthase small 99.63
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 99.63
PRK12770352 putative glutamate synthase subunit beta; Provisio 99.62
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.61
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.59
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 99.59
KOG4716|consensus503 99.57
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 99.57
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 99.56
KOG1336|consensus478 99.55
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.55
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 99.53
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.51
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.5
PRK13984604 putative oxidoreductase; Provisional 99.49
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 99.48
KOG0399|consensus2142 99.47
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.47
KOG2495|consensus491 99.46
PRK12771564 putative glutamate synthase (NADPH) small subunit; 99.45
KOG0404|consensus322 99.44
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.43
KOG1800|consensus468 99.4
PRK065671028 putative bifunctional glutamate synthase subunit b 99.37
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.36
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 99.35
PLN02852491 ferredoxin-NADP+ reductase 99.33
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 99.28
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 99.27
PTZ00188506 adrenodoxin reductase; Provisional 99.27
KOG0399|consensus2142 99.17
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.02
COG2081408 Predicted flavoproteins [General function predicti 98.99
PRK06567 1028 putative bifunctional glutamate synthase subunit b 98.95
KOG1346|consensus659 98.93
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.9
PRK09897534 hypothetical protein; Provisional 98.88
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 98.82
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 98.81
COG4529474 Uncharacterized protein conserved in bacteria [Fun 98.69
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.67
KOG1800|consensus468 98.67
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.65
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.64
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.53
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.48
PRK06847375 hypothetical protein; Provisional 98.43
KOG2755|consensus334 98.43
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.42
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.38
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.35
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.32
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.31
PRK10157428 putative oxidoreductase FixC; Provisional 98.29
KOG1346|consensus659 98.28
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.25
PRK11445351 putative oxidoreductase; Provisional 98.25
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.23
PRK06184502 hypothetical protein; Provisional 98.23
PTZ00188506 adrenodoxin reductase; Provisional 98.2
PRK10015429 oxidoreductase; Provisional 98.2
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.19
PRK06185407 hypothetical protein; Provisional 98.19
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.18
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.17
PRK06753373 hypothetical protein; Provisional 98.16
PRK06126545 hypothetical protein; Provisional 98.16
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.14
PRK07208479 hypothetical protein; Provisional 98.12
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.12
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.1
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.1
PLN02661357 Putative thiazole synthesis 98.1
PRK08132547 FAD-dependent oxidoreductase; Provisional 98.1
PRK08244493 hypothetical protein; Provisional 98.09
PRK06834488 hypothetical protein; Provisional 98.09
KOG0029|consensus501 98.07
PRK07045388 putative monooxygenase; Reviewed 98.07
PRK08163396 salicylate hydroxylase; Provisional 98.06
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.06
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.04
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.03
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.03
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.01
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 98.0
PRK06475400 salicylate hydroxylase; Provisional 97.99
PRK08013400 oxidoreductase; Provisional 97.99
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 97.99
PRK09126392 hypothetical protein; Provisional 97.98
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 97.95
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.94
PRK07588391 hypothetical protein; Provisional 97.94
PLN02463447 lycopene beta cyclase 97.94
PRK07538413 hypothetical protein; Provisional 97.93
COG3349485 Uncharacterized conserved protein [Function unknow 97.92
PLN02697529 lycopene epsilon cyclase 97.91
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 97.9
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 97.89
PRK07236386 hypothetical protein; Provisional 97.89
PRK08274466 tricarballylate dehydrogenase; Validated 97.88
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.87
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.87
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 97.86
PRK07190487 hypothetical protein; Provisional 97.86
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.86
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 97.85
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.85
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 97.85
PRK06481506 fumarate reductase flavoprotein subunit; Validated 97.84
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.83
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 97.82
COG1233487 Phytoene dehydrogenase and related proteins [Secon 97.81
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.8
KOG2755|consensus334 97.78
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 97.77
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.77
PRK12416463 protoporphyrinogen oxidase; Provisional 97.77
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 97.76
PRK06996398 hypothetical protein; Provisional 97.75
PRK08294634 phenol 2-monooxygenase; Provisional 97.75
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 97.75
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 97.72
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 97.71
PRK07233434 hypothetical protein; Provisional 97.7
COG2081408 Predicted flavoproteins [General function predicti 97.69
COG2907447 Predicted NAD/FAD-binding protein [General functio 97.69
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 97.67
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.66
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.66
PRK05192618 tRNA uridine 5-carboxymethylaminomethyl modificati 97.66
PLN02568539 polyamine oxidase 97.65
PRK07121492 hypothetical protein; Validated 97.63
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 97.62
KOG0685|consensus498 97.62
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 97.61
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.61
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.6
PLN02268435 probable polyamine oxidase 97.6
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 97.59
PF01134392 GIDA: Glucose inhibited division protein A; InterP 97.59
PRK13977576 myosin-cross-reactive antigen; Provisional 97.59
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.58
KOG2415|consensus621 97.57
COG0579429 Predicted dehydrogenase [General function predicti 97.57
PLN02576496 protoporphyrinogen oxidase 97.55
PRK08275554 putative oxidoreductase; Provisional 97.55
PRK06175433 L-aspartate oxidase; Provisional 97.53
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 97.53
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 97.52
KOG3851|consensus446 97.5
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 97.49
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 97.49
PRK05868372 hypothetical protein; Validated 97.48
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 97.46
TIGR00136617 gidA glucose-inhibited division protein A. GidA, t 97.45
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.45
PLN02985514 squalene monooxygenase 97.44
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 97.44
PRK08401466 L-aspartate oxidase; Provisional 97.42
PRK07804541 L-aspartate oxidase; Provisional 97.42
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 97.42
PLN02529738 lysine-specific histone demethylase 1 97.4
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 97.39
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 97.38
PRK13339497 malate:quinone oxidoreductase; Reviewed 97.35
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 97.34
PLN02676487 polyamine oxidase 97.34
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.33
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 97.33
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 97.32
KOG1276|consensus491 97.32
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 97.31
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 97.31
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 97.3
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 97.3
KOG2404|consensus477 97.28
TIGR02730493 carot_isom carotene isomerase. Members of this fam 97.27
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 97.22
COG1231450 Monoamine oxidase [Amino acid transport and metabo 97.17
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 97.17
PLN02487569 zeta-carotene desaturase 97.16
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 97.16
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 97.14
PLN02328808 lysine-specific histone demethylase 1 homolog 97.1
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 96.93
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 96.91
PLN029761713 amine oxidase 96.91
PLN02612567 phytoene desaturase 96.89
KOG2820|consensus399 96.89
PLN03000881 amine oxidase 96.86
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 96.82
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 96.82
KOG0029|consensus501 96.81
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 96.74
PRK12839572 hypothetical protein; Provisional 96.7
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 96.67
PF01134 392 GIDA: Glucose inhibited division protein A; InterP 96.66
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 96.65
PRK11728393 hydroxyglutarate oxidase; Provisional 96.65
PRK12842574 putative succinate dehydrogenase; Reviewed 96.65
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 96.64
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 96.63
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.58
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 96.58
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 96.58
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 96.58
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 96.57
COG4529474 Uncharacterized protein conserved in bacteria [Fun 96.57
PRK05257494 malate:quinone oxidoreductase; Validated 96.52
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 96.47
PTZ00367567 squalene epoxidase; Provisional 96.47
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.44
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.43
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.42
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 96.35
KOG2614|consensus420 96.32
PRK11259376 solA N-methyltryptophan oxidase; Provisional 96.32
COG0445621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 96.3
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 96.29
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 96.28
PRK09231582 fumarate reductase flavoprotein subunit; Validated 96.25
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 96.25
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 96.24
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 96.22
PTZ00383497 malate:quinone oxidoreductase; Provisional 96.18
KOG2960|consensus328 96.17
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 96.16
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 96.08
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 96.04
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.0
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 96.0
PRK07208479 hypothetical protein; Provisional 95.98
PRK11883451 protoporphyrinogen oxidase; Reviewed 95.96
COG1233487 Phytoene dehydrogenase and related proteins [Secon 95.96
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 95.88
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 95.85
PLN02268435 probable polyamine oxidase 95.84
PLN02463 447 lycopene beta cyclase 95.82
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 95.81
PRK07233434 hypothetical protein; Provisional 95.78
PRK07236 386 hypothetical protein; Provisional 95.78
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 95.77
PTZ003061167 NADH-dependent fumarate reductase; Provisional 95.75
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 95.75
PRK05868 372 hypothetical protein; Validated 95.74
PRK09077536 L-aspartate oxidase; Provisional 95.73
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 95.73
PLN02815594 L-aspartate oxidase 95.71
KOG0685|consensus498 95.69
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 95.65
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 95.63
PRK06847 375 hypothetical protein; Provisional 95.6
COG3349485 Uncharacterized conserved protein [Function unknow 95.59
PLN02464627 glycerol-3-phosphate dehydrogenase 95.51
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 95.49
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 95.49
PLN02676487 polyamine oxidase 95.47
PRK07512513 L-aspartate oxidase; Provisional 95.46
PRK08626657 fumarate reductase flavoprotein subunit; Provision 95.45
PRK07395553 L-aspartate oxidase; Provisional 95.45
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 95.43
KOG1298|consensus509 95.36
KOG3851|consensus 446 95.35
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 95.35
PLN02576496 protoporphyrinogen oxidase 95.32
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 95.29
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 95.28
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 95.27
PRK07588 391 hypothetical protein; Provisional 95.26
PRK08071510 L-aspartate oxidase; Provisional 95.24
COG3573552 Predicted oxidoreductase [General function predict 95.23
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 95.16
KOG4254|consensus561 95.11
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 95.1
PRK02106560 choline dehydrogenase; Validated 95.09
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 95.08
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 94.93
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 94.9
KOG1276|consensus491 94.9
PRK12416463 protoporphyrinogen oxidase; Provisional 94.84
KOG2665|consensus453 94.83
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 94.81
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 94.81
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.7
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 94.58
KOG2311|consensus 679 94.54
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 94.49
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 94.43
COG2907447 Predicted NAD/FAD-binding protein [General functio 94.41
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 94.36
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 94.31
PLN02568 539 polyamine oxidase 94.23
PLN02529 738 lysine-specific histone demethylase 1 94.16
KOG2415|consensus 621 94.16
PRK13977 576 myosin-cross-reactive antigen; Provisional 94.11
COG1231450 Monoamine oxidase [Amino acid transport and metabo 94.05
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 93.9
KOG2960|consensus328 93.77
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 93.76
PRK10015429 oxidoreductase; Provisional 93.7
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 93.69
PRK06753373 hypothetical protein; Provisional 93.66
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 93.64
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 93.63
PRK10157428 putative oxidoreductase FixC; Provisional 93.63
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 93.62
PLN02661357 Putative thiazole synthesis 93.6
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 93.6
PRK09126392 hypothetical protein; Provisional 93.55
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 93.37
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 93.35
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 93.34
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 93.34
PLN02328 808 lysine-specific histone demethylase 1 homolog 93.26
TIGR01984 382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 93.09
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 93.08
PRK08163396 salicylate hydroxylase; Provisional 93.06
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 93.06
TIGR00275400 flavoprotein, HI0933 family. The model when search 93.02
KOG2853|consensus509 92.93
PLN02487 569 zeta-carotene desaturase 92.9
PRK06184 502 hypothetical protein; Provisional 92.76
PRK06475400 salicylate hydroxylase; Provisional 92.72
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 92.7
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 92.68
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 92.65
COG2303542 BetA Choline dehydrogenase and related flavoprotei 92.65
PRK07045388 putative monooxygenase; Reviewed 92.63
PLN02976 1713 amine oxidase 92.59
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 92.57
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 92.51
PRK08013400 oxidoreductase; Provisional 92.44
PLN03000 881 amine oxidase 92.42
PRK06481506 fumarate reductase flavoprotein subunit; Validated 92.41
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 92.37
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 92.32
PRK07538413 hypothetical protein; Provisional 92.29
PRK11728393 hydroxyglutarate oxidase; Provisional 92.25
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 92.23
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 92.18
PRK06719157 precorrin-2 dehydrogenase; Validated 92.17
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 92.16
KOG2852|consensus380 92.1
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 92.06
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 91.95
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 91.89
PRK07121492 hypothetical protein; Validated 91.72
PLN02612567 phytoene desaturase 91.66
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 91.61
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 91.6
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 91.59
PRK05335 436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 91.58
COG0579429 Predicted dehydrogenase [General function predicti 91.58
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 91.5
PRK08244 493 hypothetical protein; Provisional 91.48
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 91.45
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 91.38
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 91.35
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 91.34
PRK12842 574 putative succinate dehydrogenase; Reviewed 91.11
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 91.04
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 91.02
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information 
Probab=100.00  E-value=3.1e-56  Score=523.53  Aligned_cols=371  Identities=31%  Similarity=0.512  Sum_probs=227.4

Q ss_pred             CccccccCCchhhHHHHHHhhCCCcceEEEcccCCcCcccccCCCCCCCCCCCCccccccCccccccccccccccCCCCC
Q psy12350        741 PNIVDRHGPGGLTATKRLTEAGNGFTCTTFEQADNIGGTWLYTEHIGCDQYGLPVHSSMYKSLKTNLPKDLMELCGYGHK  820 (1129)
Q Consensus       741 ~~~iiG~G~~gl~~a~~l~~~g~~~~v~v~E~~~~~GG~w~~~~~~g~~~~g~p~~~~~y~~~~~~~~~~~~~~~~~~~~  820 (1129)
                      .|+|||||++||++|+.|+++|  ++++||||++++||+|+++.++..      -.+++|+++.+|++++++.|+|||+|
T Consensus         3 rVaVIGaG~sGL~a~k~l~e~g--~~~~~fE~~~~iGG~W~~~~~~~~------g~~~~y~sl~~n~sk~~~~fsdfp~p   74 (531)
T PF00743_consen    3 RVAVIGAGPSGLAAAKNLLEEG--LEVTCFEKSDDIGGLWRYTENPED------GRSSVYDSLHTNTSKEMMAFSDFPFP   74 (531)
T ss_dssp             EEEEE--SHHHHHHHHHHHHTT---EEEEEESSSSSSGGGCHSTTCCC------SEGGGSTT-B-SS-GGGSCCTTS-HC
T ss_pred             EEEEECccHHHHHHHHHHHHCC--CCCeEEecCCCCCccCeeCCcCCC------CccccccceEEeeCchHhcCCCcCCC
Confidence            4789999999999999999999  999999999999999998765432      14679999999999999999999999


Q ss_pred             CCCCCCCCChhhhhh-----------------------------------------------------------ccCCCC
Q psy12350        821 GNADKSYIGAKDVLE-----------------------------------------------------------NYNHPI  841 (1129)
Q Consensus       821 ~~~~~~~~~~~~v~~-----------------------------------------------------------~~~~P~  841 (1129)
                      ++ .+.|+++.++++                                                           +++.|+
T Consensus        75 ~~-~p~f~~~~~v~~Yl~~Ya~~f~L~~~I~fnt~V~~v~~~~d~~~~~~W~V~~~~~g~~~~~~fD~VvvatG~~~~P~  153 (531)
T PF00743_consen   75 ED-YPDFPSHSEVLEYLESYAEHFGLRKHIRFNTEVVSVERDPDFSATGKWEVTTENDGKEETEEFDAVVVATGHFSKPN  153 (531)
T ss_dssp             CC-CSSSEBHHHHHHHHHHHHHHTTGGGGEETSEEEEEEEEETTTT-ETEEEEEETTTTEEEEEEECEEEEEE-SSSCES
T ss_pred             CC-CCCCCCHHHHHHHHHHHHhhhCCcceEEEccEEeEeeeccccCCCceEEEEeecCCeEEEEEeCeEEEcCCCcCCCC
Confidence            87 889999998887                                                           788999


Q ss_pred             CCC--CCCCCCCCCcEEeeccCCCCCCCCCCeEEEEcCCccHHHHHHHHHhcCCEEEEEecCCC-Cc--------cchhh
Q psy12350        842 YPE--FKGKDMCQIPILHSRDYRTPEPFAGKQAVVVGSGQSGLDITLDIATTGKQAVVVGSGQS-GL--------DITLD  910 (1129)
Q Consensus       842 ~P~--i~G~~~f~g~~~hs~~~~~~~~~~gk~VvVVG~G~Sg~eiA~~la~~~~~V~vv~~~~~-~~--------~~~~~  910 (1129)
                      +|.  +||++.|+|+++||++|++++.++||||+|||+|+||+|||.+|++.+++|++..|... .+        +.+..
T Consensus       154 ~P~~~~~G~e~F~G~i~HS~~yr~~~~f~gKrVlVVG~g~Sg~DIa~el~~~a~~v~~s~R~~~wv~pr~~~~G~P~D~~  233 (531)
T PF00743_consen  154 IPEPSFPGLEKFKGEIIHSKDYRDPEPFKGKRVLVVGGGNSGADIAVELSRVAKKVYLSTRRGAWVLPRYWDNGYPFDMV  233 (531)
T ss_dssp             B-----CTGGGHCSEEEEGGG--TGGGGTTSEEEEESSSHHHHHHHHHHTTTSCCEEEECC-------------------
T ss_pred             CChhhhhhhhcCCeeEEccccCcChhhcCCCEEEEEeCCHhHHHHHHHHHHhcCCeEEEEeccccccccccccccccccc
Confidence            995  99999999999999999999999999999999999999999999999999999866432 11        11100


Q ss_pred             ------------hhccccEEEE----ecC-------C---------cccccc-----CCCCCeEEcCCeeEEeCCcEEec
Q psy12350        911 ------------IATRASTVFL----SHH-------S---------ERVTSL-----CLPNNVVLKPDVAELTPTGVRFQ  953 (1129)
Q Consensus       911 ------------~~~~~~~~~~----~~~-------~---------~~~~~~-----~~~~~V~~~~~i~~v~~~~V~~~  953 (1129)
                                  +.....+.+.    ...       +         .+.+++     ...++|+++++|+++++++|+|+
T Consensus       234 ~~~R~~~~l~~~lp~~~~~~~~~~~l~~~~~~~~~gl~p~~~~~~~~~~ind~l~~~i~~G~i~vk~~I~~~~~~~v~F~  313 (531)
T PF00743_consen  234 FSTRFSSFLQKNLPESLSNWLLEKKLNKRFDHENYGLKPKHRFFSQHPTINDELPNRIRSGRIKVKPDIKRFTENSVIFE  313 (531)
T ss_dssp             -----------------------------------------------------------------EE-EEEE-SSEEEET
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence                        0000000000    000       0         011111     22357788888999999999999


Q ss_pred             CCcEe-eccEEEEccCccCcCCCCCCCCCeeecCCcccccccceeecCC--CCcEEEcccccc-chhHHHHHHHHHHHHH
Q psy12350        954 DGSYE-QVDIILCCTGYSNHYPFLHESCGIKVVNKNVQPLYKHTINIEH--PTMFILGVPRHT-LLFNLFDLQVRLFQQL 1029 (1129)
Q Consensus       954 dG~~~-~~D~VI~aTG~~~~~~fl~~~~g~~~~~~~~~~ly~~~~~~~~--p~l~~iG~~~~~-~~~~~~e~qa~~~a~~ 1029 (1129)
                      ||+++ ++|+||+||||+.++|||++++ +...++. ..||+++|+++.  |+|+|||.+... +.++++|+||||+|++
T Consensus       314 DGs~~e~vD~II~~TGY~~~fpFL~~~~-~~~~~~~-~~LYk~vfp~~~~~ptLafIG~~~~~g~~fp~~ElQArw~a~v  391 (531)
T PF00743_consen  314 DGSTEEDVDVIIFCTGYKFSFPFLDESL-IKVDDNR-VRLYKHVFPPNLDHPTLAFIGLVQPFGSIFPIFELQARWAARV  391 (531)
T ss_dssp             TSEEEEE-SEEEE---EE---TTB-TTT-T-S-SSS-SSEETTTEETETTSTTEEESS-SBSSS-HHHHHHHHHHHHHHH
T ss_pred             cccccccccccccccccccccccccccc-ccccccc-ccccccccccccccccccccccccccccccccccccccccccc
Confidence            99986 7999999999999999999754 3444443 479999999864  899999998754 6789999999999999


Q ss_pred             HcCCCCCCCHHHHHHHHHHHHHHHHhcCCCCCCceeccCCcHHHHHHHHHhcCCCCCCcHHHHHHHHchhhhhhhcCCCC
Q psy12350       1030 MQGHITLPSKEEMLADTKQEVLAHLNEGQNPNTFHIIGHRSENFLNSIISMMRDESPLPPVLLKVYFDSYGQLTEDFIGF 1109 (1129)
Q Consensus      1030 l~g~~~lp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~d~l~~~~g~~~~~p~~~~~~~~~~~~~~~~~~~~y 1109 (1129)
                      |+|+.+||++++|+++++++.+++.++ +.....|.+..++..|+|+||+++|+.   |...+.++++++.++..+|+|+
T Consensus       392 ~sG~~~LPs~~~M~~~i~~~~~~~~~~-~~~~~~~~~~~d~~~y~deLA~~iG~~---P~~~~l~~~dp~l~~~~~~gp~  467 (531)
T PF00743_consen  392 FSGRVKLPSKEEMMEEIEEEQEWRAKR-FGFSPRHTIQVDYIDYMDELAREIGCK---PNFWKLFLTDPKLARKLYFGPC  467 (531)
T ss_dssp             HTTSS----HHHHHHHHHHHHHHHHT---SHHHHHHHHHHHHHHHHTTS-------------------------------
T ss_pred             ccccccccccccccccccccccccccc-ccccccccccccccccccccccccccc---cccccccccccccccccccccc
Confidence            999999999999999999887766554 222234556678999999999999999   7777888899999999999999


Q ss_pred             CCCceeecCCCceeeec
Q psy12350       1110 RNNKYQIFNDQAYVRTG 1126 (1129)
Q Consensus      1110 ~~~~Yr~~~~~~~~~~~ 1126 (1129)
                      .|++||+.||++|+++-
T Consensus       468 ~p~~YRL~Gpg~w~gar  484 (531)
T PF00743_consen  468 TPYQYRLFGPGKWPGAR  484 (531)
T ss_dssp             -----------------
T ss_pred             ccccccccccccccccc
Confidence            99999999999999863

Using an NADPH cofactor and FAD prosthetic group, these microsomal proteins catalyse the oxygenation of nucleophilic nitrogen, sulphur, phosphorous and selenium atoms in a range of structurally diverse compounds. FMOs have been implicated in the metabolism of a number of pharmaceuticals, pesticides and toxicants. In man, lack of hepatic FMO-catalysed trimethylamine metabolism results in trimethylaminuria (fish odour syndrome). Five mammalian forms of FMO are now known and have been designated FMO1-FMO5 [, , , , ]. This is a recent nomenclature based on comparison of amino acid sequences, and has been introduced in an attempt to eliminate confusion inherent in multiple, laboratory-specific designations and tissue-based classifications []. Following the determination of the complete nucleotide sequence of Saccharomyces cerevisiae (Baker's yeast) [], a novel gene was found to encode a protein with similarity to mammalian monooygenases.; GO: 0004499 flavin-containing monooxygenase activity, 0050660 flavin adenine dinucleotide binding, 0050661 NADP binding, 0055114 oxidation-reduction process; PDB: 2GVC_E 1VQW_B 2GV8_B 2XVI_B 2XVH_B 2XLS_A 2XLR_A 2XLU_D 2XLP_B 2XVE_A ....
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>KOG1346|consensus Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>KOG2755|consensus Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>KOG1346|consensus Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>KOG2755|consensus Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>KOG3851|consensus Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>KOG3851|consensus Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1129
2xvi_A464 Crystal Structure Of The Mutant Bacterial Flavin Co 4e-23
2xve_A464 Crystal Structure Of Bacterial Flavin-Containing Mo 6e-23
2xlr_A461 Joint-Functions Of Protein Residues And Nadp(H) In 6e-23
2xls_A461 Joint-Functions Of Protein Residues And Nadp(H) In 6e-23
2vq7_A461 Bacterial Flavin-Containing Monooxygenase In Comple 7e-23
2xlp_A461 Joint-Functions Of Protein Residues And Nadp(H) In 7e-23
2xvf_A464 Crystal Structure Of Bacterial Flavin-Containing Mo 1e-20
2gv8_A447 Crystal Structure Of Flavin-Containing Monooxygenas 2e-12
1vqw_A457 Crystal Structure Of A Protein With Similarity To F 3e-12
4a9w_A357 Flavin-Containing Monooxygenase From Stenotrophomon 8e-09
4a9w_A357 Flavin-Containing Monooxygenase From Stenotrophomon 6e-08
>pdb|2XVI|A Chain A, Crystal Structure Of The Mutant Bacterial Flavin Containing Monooxygenase (Y207s) Length = 464 Back     alignment and structure 
Iteration: 1

 Score =  107 bits (266), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 125/282 (44%), Gaps = 30/282 (10%)
Query: 836  NYNHPIYPEFKGKDMCQIPILHSRDYRTPEPFAGKQAVVVGSGQSGLDITLDIATTGKQA 895
            +++ P  PEF+G +     ILH+ D+R    F  K  ++VGS  S  DI       G Q 
Sbjct: 164  HFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSSSAEDI-------GSQC 216
Query: 896  VVVGSGQSGLDITLDIATRASTVFLSHHSERVTSLCLPNNVVLKPDVAELTPTGVRFQDG 955
               G+ +                 +S +         P N   +P++  +      F DG
Sbjct: 217  YKYGAKK----------------LISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADG 260
Query: 956  SYEQVDIILCCTGYSNHYPFLHESCGIKVVNKNVQP--LYKHTINIEHPTMFILGVPRHT 1013
            S E+VD I+ CTGY +H+PFL++   + V N  + P  LYK  +  ++P  F +G+    
Sbjct: 261  SSEKVDAIILCTGYIHHFPFLNDDLRL-VTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQW 319
Query: 1014 LLFNLFDLQVRLFQQLMQGHITLPSKEEMLADTKQEVLAHLNEGQNPNTFHIIGHRSENF 1073
              FN+FD Q    + ++ G + LPSKEEM AD+       L        +   G    ++
Sbjct: 320  YSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQG----DY 375
Query: 1074 LNSIISMMRDESPLPPVLLKVYFDSYGQLTEDFIGFRNNKYQ 1115
            + ++I M    S   P   K + +      E+ + FR++ Y+
Sbjct: 376  IQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYR 417
>pdb|2XVE|A Chain A, Crystal Structure Of Bacterial Flavin-Containing Monooxygenase Length = 464 Back     alignment and structure
>pdb|2XLR|A Chain A, Joint-Functions Of Protein Residues And Nadp(H) In Oxygen-Activation By Flavin-Containing Monooxygenase: Asn78asp Mutant Length = 461 Back     alignment and structure
>pdb|2XLS|A Chain A, Joint-Functions Of Protein Residues And Nadp(H) In Oxygen-Activation By Flavin-Containing Monooxygenase: Asn78lys Mutant Length = 461 Back     alignment and structure
>pdb|2VQ7|A Chain A, Bacterial Flavin-Containing Monooxygenase In Complex With Nadp: Native Data Length = 461 Back     alignment and structure
>pdb|2XLP|A Chain A, Joint-Functions Of Protein Residues And Nadp(H) In Oxygen- Activation By Flavin-Containing Monooxygenase: Asn78ser Mutant Length = 461 Back     alignment and structure
>pdb|2XVF|A Chain A, Crystal Structure Of Bacterial Flavin-Containing Monooxygenase Length = 464 Back     alignment and structure
>pdb|2GV8|A Chain A, Crystal Structure Of Flavin-Containing Monooxygenase (Fmo) From S.Pombe And Nadph Cofactor Complex Length = 447 Back     alignment and structure
>pdb|1VQW|A Chain A, Crystal Structure Of A Protein With Similarity To Flavin- Containing Monooxygenases And To Mammalian Dimethylalanine Monooxygenases Length = 457 Back     alignment and structure
>pdb|4A9W|A Chain A, Flavin-Containing Monooxygenase From Stenotrophomonas Maltophilia Length = 357 Back     alignment and structure
>pdb|4A9W|A Chain A, Flavin-Containing Monooxygenase From Stenotrophomonas Maltophilia Length = 357 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1129
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 4e-63
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 1e-33
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 2e-28
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 2e-22
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 7e-22
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 1e-12
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 2e-53
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 7e-31
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 2e-22
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 6e-20
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 1e-18
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 6e-15
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 1e-33
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 2e-26
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 6e-14
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 6e-09
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 2e-13
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 3e-13
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 1e-09
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 1e-06
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 7e-06
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 2e-06
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 2e-06
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 8e-04
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 6e-06
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 9e-04
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 7e-06
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 1e-05
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 2e-05
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 2e-05
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 3e-05
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 7e-05
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Length = 464 Back     alignment and structure
 Score =  221 bits (564), Expect = 4e-63
 Identities = 94/424 (22%), Positives = 155/424 (36%), Gaps = 55/424 (12%)

Query: 748  GPGGLTATKRLTEAG----NGFTCTTFEQADNIGGTWLYTEHIGCDQYGLPVHSSMYKSL 803
            GP G+   +    A            FE+  + GG W YT   G D+ G PVHSSMY+ L
Sbjct: 11   GPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYL 70

Query: 804  KTNLPKDLMELCGYG---HKGNADKSYIGAKDVLENYNHPIYPEFKGKDMCQIPILHSRD 860
             +N PK+ +E   Y    H G    SY   + + + Y      +   +   +        
Sbjct: 71   WSNGPKECLEFADYTFDEHFGKPIASYPPREVLWD-YIKGRVEKAGVRKYIRFNTAVRHV 129

Query: 861  YRTPEPFAGKQ-------------------AVVVGSGQSGLDITLDIA------------ 889
                +    +                     VV  +G        +              
Sbjct: 130  EFNED---SQTFTVTVQDHTTDTIYSEEFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHA 186

Query: 890  --------TTGKQAVVVGSGQSGLDITLDIATRASTVFLSHHSERVTSLCLPNNVVLKPD 941
                       K  ++VGS  S  DI        +   +S +         P N   +P+
Sbjct: 187  HDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPN 246

Query: 942  VAELTPTGVRFQDGSYEQVDIILCCTGYSNHYPFLHESCGIKVVNKN-VQPLYKHTINIE 1000
            +  +      F DGS E+VD I+ CTGY +H+PFL++   +   N+     LYK  +  +
Sbjct: 247  LVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWED 306

Query: 1001 HPTMFILGVPRHTLLFNLFDLQVRLFQQLMQGHITLPSKEEMLADTKQEVLAHLNEGQNP 1060
            +P  F +G+      FN+FD Q    + ++ G + LPSKEEM AD+         +    
Sbjct: 307  NPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWR----EKELTL 362

Query: 1061 NTFHIIGHRSENFLNSIISMMRDESPLPPVLLKVYFDSYGQLTEDFIGFRNNKYQIFNDQ 1120
             T   +     +++ ++I M    S   P   K + +      E+ + FR++ Y+     
Sbjct: 363  VTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTG 422

Query: 1121 AYVR 1124
                
Sbjct: 423  TMAP 426
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Length = 464 Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Length = 464 Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Length = 464 Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Length = 464 Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Length = 464 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Length = 463 Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Length = 463 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Length = 477 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Length = 540 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Length = 549 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1129
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 100.0
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 100.0
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 100.0
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 100.0
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.97
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.97
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.96
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.96
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.96
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.95
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.95
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.94
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.92
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.91
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.91
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 99.91
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 99.9
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 99.89
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.89
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.88
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 99.88
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.88
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 99.88
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.88
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.88
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.88
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 99.88
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.87
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 99.87
3r9u_A315 Thioredoxin reductase; structural genomics, center 99.87
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.87
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 99.87
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.87
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 99.87
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 99.87
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.87
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 99.87
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.86
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 99.86
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 99.86
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 99.86
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 99.86
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 99.86
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.86
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 99.86
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 99.85
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 99.85
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.85
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 99.85
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.85
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 99.85
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.85
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.85
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.85
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 99.85
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.85
1fec_A490 Trypanothione reductase; redox-active center, oxid 99.85
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.85
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.84
4dna_A463 Probable glutathione reductase; structural genomic 99.84
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 99.84
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.84
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 99.84
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.84
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 99.84
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 99.84
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.84
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.84
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 99.84
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.83
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 99.83
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.83
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 99.83
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 99.83
1ojt_A482 Surface protein; redox-active center, glycolysis, 99.83
4fk1_A304 Putative thioredoxin reductase; structural genomic 99.83
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.83
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 99.83
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.82
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.82
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 99.82
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 99.82
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.82
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.82
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.82
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.82
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 99.82
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.82
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.82
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.81
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 99.81
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.81
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 99.81
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.81
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.8
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 99.8
3r9u_A315 Thioredoxin reductase; structural genomics, center 99.8
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.8
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.8
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.8
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 99.8
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 99.79
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.79
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.78
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 99.78
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.78
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.78
4dna_A463 Probable glutathione reductase; structural genomic 99.78
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.78
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 99.78
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.78
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 99.78
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.78
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 99.78
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.78
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 99.78
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 99.77
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 99.77
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 99.77
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 99.77
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.77
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 99.77
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.77
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 99.77
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 99.77
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.77
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.77
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.77
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 99.77
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 99.77
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.77
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 99.77
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 99.76
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 99.76
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 99.76
1fec_A490 Trypanothione reductase; redox-active center, oxid 99.76
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 99.76
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.76
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 99.76
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 99.76
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.76
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.76
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 99.75
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 99.75
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 99.75
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 99.75
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 99.75
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.75
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 99.75
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.75
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.75
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.74
2gag_A965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.74
1ojt_A482 Surface protein; redox-active center, glycolysis, 99.74
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.74
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 99.73
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 99.73
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 99.73
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 99.72
4fk1_A304 Putative thioredoxin reductase; structural genomic 99.72
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 99.72
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.71
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 99.71
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.71
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 99.7
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 99.7
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.7
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.68
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 99.68
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 99.67
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 99.67
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 99.66
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 99.65
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 99.65
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 99.63
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 99.63
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.63
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 99.61
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.61
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 99.58
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.56
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.54
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 99.46
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 99.41
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 99.32
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 99.32
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.06
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.96
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.81
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.79
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.71
2ywl_A180 Thioredoxin reductase related protein; uncharacter 98.6
2bry_A497 NEDD9 interacting protein with calponin homology a 98.59
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.55
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.5
3ces_A651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.49
2cul_A232 Glucose-inhibited division protein A-related PROT 98.48
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.47
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.46
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.46
2cul_A232 Glucose-inhibited division protein A-related PROT 98.46
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.41
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.39
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.38
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.34
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.34
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.34
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.31
3dme_A369 Conserved exported protein; structural genomics, P 98.31
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.31
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 98.29
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.28
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.28
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.28
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.27
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.27
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 98.26
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.25
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.25
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.25
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.25
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 98.24
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.24
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.22
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.21
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.19
3atr_A453 Conserved archaeal protein; saturating double bond 98.18
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.18
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.16
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.09
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.09
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.08
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.07
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 98.06
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.05
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.05
3cp8_A641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.04
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.03
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.01
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.0
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 97.97
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 97.97
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 97.87
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.86
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 97.85
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 97.84
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.82
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 97.81
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.79
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 97.79
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.75
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 97.72
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.69
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 97.68
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 97.67
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 97.66
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 97.66
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 97.66
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.64
1pj5_A830 N,N-dimethylglycine oxidase; channelling, FAD bind 97.64
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.64
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 97.61
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.61
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 97.59
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 97.59
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 97.58
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 97.58
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.57
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.52
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 97.51
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.5
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.49
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 97.49
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.49
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 97.47
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.45
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.44
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.39
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.39
4hb9_A412 Similarities with probable monooxygenase; flavin, 97.38
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.31
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.3
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 97.22
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 97.22
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 97.18
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 97.15
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 97.14
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.13
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.11
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 97.09
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 96.92
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 96.87
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 96.82
4gut_A776 Lysine-specific histone demethylase 1B; histone de 96.78
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 96.66
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 96.62
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 96.6
4hb9_A 412 Similarities with probable monooxygenase; flavin, 96.51
2bry_A 497 NEDD9 interacting protein with calponin homology a 96.37
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 96.37
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 96.33
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 96.32
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 96.27
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 96.24
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 96.16
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 96.1
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 95.98
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 95.93
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 95.89
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 95.89
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 95.88
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 95.85
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 95.84
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 95.77
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 95.74
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 95.69
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 95.64
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 95.6
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 95.54
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 95.47
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 95.46
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 95.4
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 95.39
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 95.36
1vg0_A650 RAB proteins geranylgeranyltransferase component A 95.36
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 95.36
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 95.3
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 95.3
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 95.29
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 95.29
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 95.28
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 95.19
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 95.13
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 95.09
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 95.04
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 94.94
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 94.93
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 94.89
2gqf_A401 Hypothetical protein HI0933; structural genomics, 94.82
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 94.78
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 94.71
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 94.71
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 94.67
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 94.65
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 94.64
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 94.61
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 94.57
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 94.49
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 94.23
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 94.23
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 94.17
3dme_A369 Conserved exported protein; structural genomics, P 93.96
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 93.81
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 93.73
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 93.66
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 93.64
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 93.57
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 93.54
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 93.34
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 93.32
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 93.07
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 92.94
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 92.87
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 92.87
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 92.82
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 92.68
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 92.62
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 92.62
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 92.59
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 92.47
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 92.47
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 92.35
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 92.26
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 92.22
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 92.16
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 92.09
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 92.04
1lss_A140 TRK system potassium uptake protein TRKA homolog; 91.97
4gut_A776 Lysine-specific histone demethylase 1B; histone de 91.97
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 91.89
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 91.84
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 91.74
3atr_A453 Conserved archaeal protein; saturating double bond 91.68
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 91.67
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 91.61
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 91.58
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 91.58
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 91.34
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 91.21
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 91.14
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 91.07
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 91.07
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 91.05
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 91.04
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 91.03
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 91.0
1id1_A153 Putative potassium channel protein; RCK domain, E. 90.93
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 90.82
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 90.8
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 90.75
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 90.45
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 90.39
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 90.34
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 90.25
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 90.24
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 90.13
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 90.02
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 89.56
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 89.55
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 89.35
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 89.33
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 89.3
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 89.26
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 89.26
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 89.02
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 89.0
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 88.79
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 88.79
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 88.78
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 88.55
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 88.53
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 88.11
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 88.09
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 87.92
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 87.88
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 87.65
3c85_A183 Putative glutathione-regulated potassium-efflux S 87.61
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 87.59
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 87.32
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 87.3
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 87.0
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 86.89
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 86.73
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 86.63
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 86.6
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 86.33
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 86.32
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 86.16
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 85.71
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 85.66
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 85.47
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 85.4
3qha_A296 Putative oxidoreductase; seattle structural genomi 85.24
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 85.24
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 85.19
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 84.89
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 84.75
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 84.66
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 84.62
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 84.53
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 84.44
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 84.36
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 84.08
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 83.96
4g65_A461 TRK system potassium uptake protein TRKA; structur 83.86
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 83.83
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 83.7
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 83.64
3l6d_A306 Putative oxidoreductase; structural genomics, prot 83.28
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 83.07
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 82.86
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 82.81
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 82.68
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 82.45
1id1_A153 Putative potassium channel protein; RCK domain, E. 82.41
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 82.39
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 82.22
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 82.21
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 82.18
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 82.13
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 81.98
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 81.92
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 81.78
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 81.71
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 81.27
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 81.25
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 80.97
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 80.86
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 80.73
3tl2_A315 Malate dehydrogenase; center for structural genomi 80.67
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 80.66
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 80.64
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 80.62
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 80.51
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 80.51
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 80.5
1lss_A140 TRK system potassium uptake protein TRKA homolog; 80.47
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 80.45
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 80.27
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 80.14
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 80.1
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
Probab=100.00  E-value=8.4e-45  Score=430.01  Aligned_cols=354  Identities=27%  Similarity=0.455  Sum_probs=302.0

Q ss_pred             CccccccCCchhhHHHHHHh---hCCCcc---eEEEcccCCcCcccccCCCCCCCCCCCCccccccCccccccccccccc
Q psy12350        741 PNIVDRHGPGGLTATKRLTE---AGNGFT---CTTFEQADNIGGTWLYTEHIGCDQYGLPVHSSMYKSLKTNLPKDLMEL  814 (1129)
Q Consensus       741 ~~~iiG~G~~gl~~a~~l~~---~g~~~~---v~v~E~~~~~GG~w~~~~~~g~~~~g~p~~~~~y~~~~~~~~~~~~~~  814 (1129)
                      +++|||+|++|+++|+.|++   .|  ++   |+|||+++.+||+|.+...+||.++|+|.++.+|+.+.+|.++..+.|
T Consensus         4 ~V~IIGaG~aGl~aA~~L~~~~~~G--~~~~~V~v~E~~~~~GG~w~~~~~~g~~~~g~~~~~~~y~~l~~~~~~~~~~~   81 (464)
T 2xve_A            4 RIAILGAGPSGMAQLRAFQSAQEKG--AEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEF   81 (464)
T ss_dssp             EEEEECCSHHHHHHHHHHHHHHHTT--CCCCEEEEECSSSSSCGGGSCCSCCSBCTTSSBCCCCCCTTCBCSSCGGGTCB
T ss_pred             cEEEECccHHHHHHHHHHHhhhhcC--CCCCcEEEEEcCCCCCCEeecCCCCCccccCCCCcCccccchhhcCChhhccc
Confidence            68999999999999999999   88  88   999999999999999998899988899999999999999999999888


Q ss_pred             cCCCCCCC---CCCCCCChhhh--------------------------------------------------------hh
Q psy12350        815 CGYGHKGN---ADKSYIGAKDV--------------------------------------------------------LE  835 (1129)
Q Consensus       815 ~~~~~~~~---~~~~~~~~~~v--------------------------------------------------------~~  835 (1129)
                      ++++++..   +...|+++.++                                                        +.
T Consensus        82 ~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~gv~~~i~~~~~V~~v~~~~~~~~~~V~~~~~~~g~~~~~~~d~VVvA  161 (464)
T 2xve_A           82 ADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSEEFDYVVCC  161 (464)
T ss_dssp             TTBCHHHHHSSCCCSSCBHHHHHHHHHHHHHHHTCGGGEECSEEEEEEEEETTTTEEEEEEEETTTTEEEEEEESEEEEC
T ss_pred             CCCCCCcccCCCCCCCCCHHHHHHHHHHHHHHcCCcceEEeCCEEEEEEEcCCCCcEEEEEEEcCCCceEEEEcCEEEEC
Confidence            88765321   00111111100                                                        01


Q ss_pred             cc--CCCCCCCCCCCCCCCCcEEeeccCCCCCCCCCCeEEEEcCCccHHHHHHHHHhcCCEEEEEecCCCCccchhhhhc
Q psy12350        836 NY--NHPIYPEFKGKDMCQIPILHSRDYRTPEPFAGKQAVVVGSGQSGLDITLDIATTGKQAVVVGSGQSGLDITLDIAT  913 (1129)
Q Consensus       836 ~~--~~P~~P~i~G~~~f~g~~~hs~~~~~~~~~~gk~VvVVG~G~Sg~eiA~~la~~~~~V~vv~~~~~~~~~~~~~~~  913 (1129)
                      +|  +.|++|++||++.|.|.++|+++|+++..+.+|+|+|||+|.||+|+|.+|++.|++|+++.+.+..+..      
T Consensus       162 tG~~s~p~~p~ipG~~~~~g~~~hs~~~~~~~~~~~k~VvVVG~G~sg~eiA~~l~~~g~~V~li~~~~~~~~~------  235 (464)
T 2xve_A          162 TGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGY------  235 (464)
T ss_dssp             CCSSSSBCCCCCBTTTTCCSEEEEGGGCCCGGGGTTSEEEEECCSTTHHHHHHHHHHTTCSEEEEECSSCCCCC------
T ss_pred             CCCCCCCccCCCCCcccCCceEEehhhhCCHhHcCCCEEEEEcCCCCHHHHHHHHHHhCCeEEEEEECCCCCCC------
Confidence            56  8999999999999999999999999988889999999999999999999999999999999875432211      


Q ss_pred             cccEEEEecCCccccccCCCCCeEEcCCeeEEeCCcEEecCCcEeeccEEEEccCccCcCCCCCCCCCeeecCC-ccccc
Q psy12350        914 RASTVFLSHHSERVTSLCLPNNVVLKPDVAELTPTGVRFQDGSYEQVDIILCCTGYSNHYPFLHESCGIKVVNK-NVQPL  992 (1129)
Q Consensus       914 ~~~~~~~~~~~~~~~~~~~~~~V~~~~~i~~v~~~~V~~~dG~~~~~D~VI~aTG~~~~~~fl~~~~g~~~~~~-~~~~l  992 (1129)
                                       .++.+|++++.|+++++++|+|.||+++++|.||+||||+++++||.+++|+.++++ ++.++
T Consensus       236 -----------------~~~~~V~~~~~V~~i~~~~V~~~dG~~i~~D~Vi~atG~~p~~~~l~~~~gl~~~~~~~v~~~  298 (464)
T 2xve_A          236 -----------------KWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNL  298 (464)
T ss_dssp             -----------------CCCTTEEECSCEEEECSSEEEETTSCEEECSEEEECCCBCCCCTTBCTTTCCCCCSSSCCSSE
T ss_pred             -----------------CCCCceEEcCCeEEEeCCEEEECCCCEEeCCEEEECCCCCCCCCCcCcccccccCCCcccccc
Confidence                             123478888889999999999999999999999999999999999987678888776 55579


Q ss_pred             ccceeecCCCCcEEEccccccchhHHHHHHHHHHHHHHcCCCCCCCHHHHHHHHHHHHHHHHhcCC--CCCCceeccCCc
Q psy12350        993 YKHTINIEHPTMFILGVPRHTLLFNLFDLQVRLFQQLMQGHITLPSKEEMLADTKQEVLAHLNEGQ--NPNTFHIIGHRS 1070 (1129)
Q Consensus       993 y~~~~~~~~p~l~~iG~~~~~~~~~~~e~qa~~~a~~l~g~~~lp~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~ 1070 (1129)
                      |++++.++.|||||+|++.....++.++.||+|+|++|.|+..||+.++|+++++++.+ + ..++  ..+++|.    +
T Consensus       299 ~~~~~~t~~p~i~aiGd~~~~~~~~~a~~qa~~~a~~l~G~~~lP~~~~m~~~~~~~~~-~-~~~~~~~~~~~~~----~  372 (464)
T 2xve_A          299 YKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWRE-K-ELTLVTAEEMYTY----Q  372 (464)
T ss_dssp             ETTTEESSSTTEEECSCSCCSSCHHHHHHHHHHHHHHHTTSSCCCCHHHHHHHHHHHHH-H-HHTCCSHHHHHHH----H
T ss_pred             cceEecCCCCCEEEEeCcccccchHHHHHHHHHHHHHHcCCCCCcCHHHHHHHHHHHHH-H-hhccCCCCCcccc----H
Confidence            99999999999999999987778999999999999999999999999999999988766 3 3333  2344442    5


Q ss_pred             HHHHHHHHHhcCCCCCC-cHHHHHHHHchhhhhhhcCCCCCCCceeecCCCceeeec
Q psy12350       1071 ENFLNSIISMMRDESPL-PPVLLKVYFDSYGQLTEDFIGFRNNKYQIFNDQAYVRTG 1126 (1129)
Q Consensus      1071 ~~y~d~l~~~~g~~~~~-p~~~~~~~~~~~~~~~~~~~~y~~~~Yr~~~~~~~~~~~ 1126 (1129)
                      ..|+|+|++++|++ ++ ++++.++|..+...+.+++..||+.+|+++.++.|....
T Consensus       373 ~~Y~~~l~~~~g~~-~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~  428 (464)
T 2xve_A          373 GDYIQNLIDMTDYP-SFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKH  428 (464)
T ss_dssp             HHHHHHHHTTSSSC-CCCHHHHHHHHHHHHHHHHHCTTTGGGCCCBCTTTCCBCCCC
T ss_pred             HHHHHHHHHHcCCC-CCChHHHHHHHHHHHHHHHhchhhhcccceeEecCceeeccC
Confidence            78999999999999 55 788999999999999999999999999999999988764
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1129
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 8e-18
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 6e-14
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 9e-13
d2gv8a2107 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase 5e-17
d2gv8a2107 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase 6e-13
d2gv8a2107 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase 4e-09
d2gv8a2107 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase 4e-07
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 5e-10
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 2e-05
d1w4xa2235 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {T 2e-09
d1w4xa2235 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {T 2e-07
d1w4xa2235 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {T 2e-07
d1w4xa2235 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {T 6e-05
d1w4xa2235 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {T 5e-04
d1w4xa2235 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {T 5e-04
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 2e-07
d1cjca2230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 7e-06
d1cjca2230 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase 1e-04
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 5e-05
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 7e-05
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 2e-04
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 5e-04
d2bi7a1314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 7e-04
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 7e-04
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 0.001
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 0.002
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Flavin-dependent monoxygenase SPBP16F5.08c
species: Schizosaccharomyces pombe [TaxId: 4896]

 Score = 83.9 bits (206), Expect = 8e-18
 Identities = 64/389 (16%), Positives = 110/389 (28%), Gaps = 87/389 (22%)

Query: 748  GPGGLTATKRLTEAGNGFTCTTFEQADNIGGTWLYTEHIGC------------------D 789
            GP GL   K L         T FE+  + GG W YT  +                     
Sbjct: 13   GPSGLVTAKALLAEKAFDQVTLFERRGSPGGVWNYTSTLSNKLPVPSTNPILTTEPIVGP 72

Query: 790  QYGLPVHSSMYKSLKTNLPKDLMELCGYGHKGNADKSYIGAKDVLENYNHPIYPEFKGKD 849
                   S +Y+ L+TN P +LM  C           +     + E              
Sbjct: 73   AALPVYPSPLYRDLQTNTPIELMGYCDQ-SFKPQTLQFPHRHTIQEYQRIY-------AQ 124

Query: 850  MCQIPILHSRDYRTPEPFAGKQAVVVGSGQSGLDITLDIATTGKQAVVVGSGQSGLDITL 909
                 I  + D    E   G   V     ++G  I+         AV + +G   +  T 
Sbjct: 125  PLLPFIKLATDVLDIEKKDGSWVVTYKGTKAGSPIS----KDIFDAVSICNGHYEVPYTG 180

Query: 910  DIATRASTVFLSHHSERVTSLCLPNNVVLKPDVAELTPTGVRFQDGSYEQVDIILCCTGY 969
             + +                          P +A+L     +  D               
Sbjct: 181  YLYSVP-----------------------FPSLAKLKSPETKLIDDGS------------ 205

Query: 970  SNHYPFLHESCGIKVVNKNVQPLYKHTINIEHPTMFILGVPRHTLLFNLFDLQVRLFQQL 1029
                              +V  +Y+H   I  PT+  +G+  H + F     Q     ++
Sbjct: 206  ------------------HVHNVYQHIFYIPDPTLAFVGLALHVVPFPTSQAQAAFLARV 247

Query: 1030 MQGHITLPSKEEMLADTKQEVLAHLNEGQNPNTFHIIGHRSENFLNSIISMMRDESPLPP 1089
              G + LPSKEE L    + +      G N     +   +   ++N +    +  +P+  
Sbjct: 248  WSGRLKLPSKEEQLKWQDELM--FSLSGANNMYHSLDYPKDATYINKLHDWCKQATPVLE 305

Query: 1090 VLL--KVYFDSYGQLTEDFIGFRNNKYQI 1116
                   + +    + E+    R   + I
Sbjct: 306  EEFPSPYWGEKERSIRENMWSIRAKFFGI 334
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 107 Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 107 Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 107 Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 107 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 235 Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 235 Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 235 Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 235 Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 235 Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 235 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1129
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.94
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.84
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.76
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 99.75
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 99.67
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.66
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.6
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.58
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.52
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.49
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.35
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.32
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.27
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.26
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.21
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.21
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.18
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.16
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.16
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.14
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.09
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 99.07
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.06
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.04
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.0
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.98
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.98
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 98.96
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.96
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.96
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 98.95
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.94
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.94
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.93
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.9
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.9
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 98.89
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.87
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.86
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.85
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.84
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.83
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.83
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.82
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.82
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.81
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.79
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.78
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.77
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.77
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.77
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.77
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.76
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.75
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 98.74
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.74
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.73
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.71
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.7
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.69
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.67
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.66
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.66
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.64
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.63
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.62
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 98.61
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.59
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.59
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.58
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.57
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.57
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 98.56
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.56
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.56
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.56
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.52
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.5
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.5
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.49
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.46
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 98.45
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.44
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.44
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.42
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.41
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.4
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.39
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.38
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.36
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.33
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.33
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.33
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.32
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.32
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 98.32
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.31
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.31
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.3
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.3
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.3
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.28
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.26
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.25
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.24
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.21
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.21
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.2
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.19
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.19
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.18
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.18
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.17
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.11
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.11
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.09
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.06
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.03
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.02
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.02
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.0
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.99
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.98
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.98
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 97.98
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 97.92
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.89
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.88
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 97.84
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.8
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 97.8
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.79
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.71
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.69
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.62
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.59
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.55
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.51
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 97.47
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 97.39
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 97.29
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 97.28
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.23
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 97.21
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.2
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 97.19
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 97.18
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 97.15
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.14
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 97.08
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.06
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.05
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.05
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.01
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 96.99
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 96.98
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.96
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 96.95
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 96.82
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.76
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 96.66
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 96.56
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 96.49
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 96.45
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 96.38
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 96.21
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.16
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 95.87
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 95.81
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 95.75
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 95.66
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.63
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 95.57
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 95.54
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.51
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 95.4
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 95.35
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.24
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.19
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 95.14
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.09
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 95.08
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.07
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 94.89
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 94.75
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 94.7
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 94.68
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 94.62
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.59
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 94.4
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 94.28
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 94.21
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.14
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 93.88
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 93.88
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 93.62
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 93.44
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 93.28
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 93.06
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 92.78
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 92.65
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 92.58
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 92.37
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 92.31
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 92.23
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 92.05
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 91.97
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 91.6
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 91.42
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 91.42
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 91.36
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 91.2
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 91.03
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 90.52
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 90.5
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 90.37
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 89.61
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 89.58
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 89.57
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 89.42
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 89.06
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 88.69
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 88.08
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 87.95
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 87.92
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 87.88
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 87.61
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 87.1
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 87.06
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 86.75
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 86.38
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 86.18
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 86.11
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 85.61
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 85.36
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 85.23
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 84.93
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 84.58
d1gpea1 391 Glucose oxidase {Penicillium amagasakiense [TaxId: 84.35
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 84.25
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 84.01
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 83.95
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 83.63
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 83.52
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 83.42
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 83.06
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 83.01
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 82.91
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 82.91
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 82.63
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 82.58
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 82.54
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 81.76
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 81.59
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 81.57
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 81.37
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 81.1
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 80.7
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 80.46
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 80.43
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 80.19
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 80.05
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Flavin-dependent monoxygenase SPBP16F5.08c
species: Schizosaccharomyces pombe [TaxId: 4896]

Probab=99.94  E-value=8.8e-27  Score=261.87  Aligned_cols=162  Identities=22%  Similarity=0.334  Sum_probs=134.3

Q ss_pred             CcceEEEEcCChHHHHHHHHhhcCCCCceEEEEcccCCcCceEecCCCCCCCC-----------------CC-CCccCcc
Q psy12350          8 PTLHIGVIGGGAGGLTATKRLTEPGSGFTCTTFEQTDNVGGTWVYTEQTGRDQ-----------------YG-LPVHSSM   69 (1129)
Q Consensus         8 ~~~~V~IIGaG~aGl~aA~~l~~~~~~~~v~v~E~~~~~GG~w~~~~~~~~~~-----------------~~-~~~~~~~   69 (1129)
                      ..++|||||||+|||+||+.|++++.+++|+||||++.+||+|.+....++..                 .+ ....+.+
T Consensus         3 ~~KrVaIIGaG~sGl~~A~~L~~~~~~~~v~vfEk~~~iGG~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~   82 (335)
T d2gv8a1           3 TIRKIAIIGAGPSGLVTAKALLAEKAFDQVTLFERRGSPGGVWNYTSTLSNKLPVPSTNPILTTEPIVGPAALPVYPSPL   82 (335)
T ss_dssp             SCCEEEEECCSHHHHHHHHHHHTTTCCSEEEEECSSSSSSTTCSCCSCCCSCCCSSBCCTTCCCCCBCCSSSCCBCCCCC
T ss_pred             CCCeEEEECcCHHHHHHHHHHHHhCCCCCEEEEECCCCCCCcccccCCCCcccCCccccccccccccccccccccccccc
Confidence            34799999999999999999999877789999999999999999876555410                 00 1235789


Q ss_pred             cccccccCCccccccCCCCCCCCCCCCCCCHHHHHHHHHHHHHhcCCcceeEeceeeeeeccccccCCCCceEEeccccC
Q psy12350         70 YKSLKTNLPKEIMELSGYHHKGHPDKSYIAANDVLEYLNDFADNFNLRNLCLVNKNVQPLYKHLINIEHPSMCIIGIPRD  149 (1129)
Q Consensus        70 y~~l~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~yl~~~~~~~~~~~~i~~~~~V~~v~~~~~~~~~~~~~~~~~~~~  149 (1129)
                      |..+++++++.++.|++++++.. .+.|+++.++.+|++.|++.++  .+|+|||+|++|+..   .+.|.|++++...+
T Consensus        83 y~~l~~~~~~~~~~~~~~~~~~~-~~~f~~~~~~~~yl~~~~~~~~--~~I~~~t~V~~v~~~---~~~w~Vt~~~~~~~  156 (335)
T d2gv8a1          83 YRDLQTNTPIELMGYCDQSFKPQ-TLQFPHRHTIQEYQRIYAQPLL--PFIKLATDVLDIEKK---DGSWVVTYKGTKAG  156 (335)
T ss_dssp             CTTCBCSSCHHHHSCTTCCCCTT-CCSSCBHHHHHHHHHHHHGGGG--GGEECSEEEEEEEEE---TTEEEEEEEESSTT
T ss_pred             chhhhcCCcHhhhhhhhhcCCcc-cccCCchHHHHHHHHHHHHHhh--hcccCceEEEEEEec---CCEEEEEEEecCCC
Confidence            99999999999999999998865 5679999999999999999874  489999999999874   36788888776544


Q ss_pred             c-cceEEecceeeeEEEEecccCCCCCccccc
Q psy12350        150 T-VGFYLFDLQVRFFLQLMQGHVTLPSKAEML  180 (1129)
Q Consensus       150 ~-~~~~~~d~~~~~~lvvAtG~~~~p~~p~i~  180 (1129)
                      + .....||     +||+|||+++.|++|.++
T Consensus       157 ~~~~~~~~d-----~VI~AtG~~s~p~~~~~~  183 (335)
T d2gv8a1         157 SPISKDIFD-----AVSICNGHYEVPYTGYLY  183 (335)
T ss_dssp             CCEEEEEES-----EEEECCCSSSSBCCCBCC
T ss_pred             CeEEEEEee-----EEEEcccccccceecccc
Confidence            3 3345699     999999999999998763
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure