Psyllid ID: psy12365

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320----

MDKLIFTLEEPHGPGDVYVCWQRRTGELLATTGRDSSVSIYNKHGKLIDKITLPGLCIVMDWDSEGDLLGIISSNSSAVNVWNTYTKKRTIVDSGLRDPLTCLVWCKQCSMLQLSVSIYNKHGKLIDKITLPGLCIVMDWDSEGDLLGIISSNSSAVNVWTLLTYTLGERISWSDDGQLLAVTTSGGSVKIYLSKLPKLVVANNGKIAILSSLNQVSVYLRSIERKGTPWTNFIIETEIEPSWREYHGLVVANNGKIAILSSLNQVSVYLRSIERKGTPWTNFIIETEIEPSFLNMGPCHVAVGMNNRVWVYGLNPSVNNKSHTLVYKPQLLGDKEHLGTITSLLLNANYSSALVNSRIQLHYLGDNQKTIPDAFIKNRNYFAHTLVYKPQLLGDKEYLGTITSLLLNANYSSALVNSRIQLHYLGDNQKTIPDAFVDKESKLFPESGEKYTIMTQAMSEEFLFFATSEYELKIFSLSEWKFVSGYKHSDKIKSIYPDIYGICLVLIEMNNTGFLYHTAMDYLLPIPEFPPATEEVLWDTVPVDRNVFVCCSKTSVVTYLFMPNYYEGPKIELVGATTIQSGQSPVLLTKGLLTLVTSSNKPLDLTLETHKTTMHNPKQTLDISLHKVLKLLNWKEAWNICAVLNQSETWRSFAEACLQNLEFSWAIRAYQSLDEAGMVWCLESLVEEEEDTSILCGHVAALLGNHDTAQQRYLTSDIPTMALTLRRDLRQWREALALATSLGSNQTPIISCDYAQQLEMTGQHAQALSFYQKSMELATPDIQDPECQRKCKEGIARTSIRVGDFRLGIRLAAESNSSVLKNECADILQQFNKLNDAVTLYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEEDEPNPVELKRLAIHFEEDKDMFRAAQYYYHAKEYGRAMKLLLVTARQDKDSDENLWLGVSIVSDSHDEKLVETFKTLLEGKLDGVKRNPKFLYRVLMNTGDYVAASSCALDVARDEAARGSYRNCHETLYSTIQELKKHKLQVGNDLMAGLMIIHSYLLARYHVRNANHSLAAPLLIRVAENISFFPLHATSILTSTVIECKKANLQESALKFATLLLRPEYRSNLEDKYRKQIELIVRKAPRKDIASPEEAHVLPCPYCDTMVPDMMLHCASCARIIPFCIASGKHITRNELTKCLECNFPAIHRHLVLIVDQEGFCPLCRTDLRGRPLPTDIHINEFVFNE

ccccEEEcccccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEcccccEEEEEEcccccEEEEEEEcccEEEEEEccccEEEEEcccccccEEEEEEcccccEEEEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEEEcccccEEEEEEcccEEEEEEEcccEEEEcccccEEEEEEEcccEEEEEEcccccccccccEEEccccccccccEEEEEEccccEEEEEcccccEEEEEcccccccccEEEEEEccccEEEEEEcccEEEEEEccEEEEEEEccccccccEEEEEEcccccccEEccEEEEEEEcccEEEEEEEcEEEEEEEcccccEEccccccccEEEEEEcccccEEEccccccccEEEEEccccEEEEEEEcEEEEEEEcccccccccccccccEEEEcccccccEEEEcccccEEEEEEEcccEEEEEEccccEEEEEEEcccccEEEEEcccccEEEEEEEcccEEEEEEccccccccccccccccEEEcccccccccEEEEEcccEEEEEEEccccccccEEEEEccEEEccccccEEEEccEEEEEEcccccEEEEEEccccccccccHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHcHHHHHHHHHHHHccccHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHccccccHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEccccccccEEEccccccccHHHHHHHHHccccccccccccccccccccccccccccccc

ccEEEEEEccccccccEEEEEEcccccEEEEEccccEEEEEEccccEEEEEcccccEEEEEccccccEEEEEEccccEEEEEEcccccEEEEccccccccEEEEEcccccEEEEEEEEEEccccccEEEEEcccccHHHHccccccEEEEEEcccccEEEEEEccccccccEEcccccEEEEEEcccEEEEEEEccccccccccccEEEEcccccEEEEEEccccEEEEEEcccEEEEEEEcHHHHHHHHHHcccHHHHcccHHHHHHHHHHHHHcccccEEEEEcccccccEEEEEccccccccccEEEEccHcccccccEEEEEEccccHHccccccEEEEEEEEEEEEEEccccccEEEEEEEcccEEEEEEEccEEEEEEEcccccccccccHHcccHHEEEEcccEEEEEEccEEEEEEEEcccccccccccccccccccccccccEEEEEcccccEEEEEEcccEEEEEEEcccccEEEEEccccEEEEEccccccEEEEEEcccEEEEEEcccccEEEcccccccccEEEEcccccccEEEEEEcccEEEEEccccccccccEEEEEccccccccccEEEEEccEEEEEEccccEEEEEEEEccEccccccccHHHHHHHHHHHHcHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHcHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcHHHHHHccHHHHHHHHHHHHccccccccccccccccccccccccccccEEccccccccccEEEEEccHEEccccccccccccHHHHHHHHHHHHcccccccccccccHHHHccccccHHHHccc

mdkliftleephgpgdvyvcWQRRTGELlattgrdssVSIYNkhgklidkitlpglcivmdwdsegdllgiissNSSAVNVWNTytkkrtivdsglrdpltclvwckqcsmlQLSVSIYNkhgklidkitlpglcivmdwdsegdllgiissnsSAVNVWTLLTYTLgeriswsddgqlLAVTTsggsvkiylsklpklvvanngkIAILSSLNQVSVYLRSIerkgtpwtnfIIETeiepswreyhglvvannGKIAILSSLNQVSVYLRSIerkgtpwtnfiieteiepsflnmgpchvavGMNNRVWVyglnpsvnnkshtlvykpqllgdkehLGTITSLLLNANYSSALVNSRIQLhylgdnqktipdafiknRNYFAHTlvykpqllgdkeYLGTITSLLLNANYSSALVNSRIQLhylgdnqktipdafvdkesklfpesgekYTIMTQAMSEEFLFFATSEYELKIFSLSewkfvsgykhsdkiksiypDIYGICLVLIEMNNTGFLYHTAMDyllpipefppateevlwdtvpvdrnvfvccsktsvvtylfmpnyyegpkielvgattiqsgqspvllTKGLLTLVtssnkpldltlethkttmhnpkqtLDISLHKVLKLLNWKEAWNICAVLNQSETWRSFAEACLQNLEFSWAIRAYQSLDEAGMVWCLESLVEEEEDTSILCGHVAALLGnhdtaqqryltsdiptMALTLRRDLRQWREALALATslgsnqtpiisCDYAQQLEMTGQHAQALSFYQKSMelatpdiqdpecqrkckegiartsirvgdFRLGIRLAAESNSSVLKNECADILQQFNKLNDAVTLYESAGNYEKAATCYIQLKNWTkigqllphikSATTFIQYAKAKEAMGSYResvgayeraedydnVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKflleedepnpvELKRLAIHFEEDKDMFRAAQYYYHAKEYGRAMKLLLVTARqdkdsdenlwLGVSIVSDSHDEKLVETFKTLLEgkldgvkrnpKFLYRVLMNTGDYVAASSCALDVARdeaargsyrnCHETLYSTIQELKKHKLQVGNDLMAGLMIIHSYLLARYHVRnanhslaaPLLIRVAEnisffplhatSILTSTVIECKKANLQESALKFATLLLRPEYRSNLEDKYRKQIELIVRkaprkdiaspeeahvlpcpycdtmvpdmmlhCASCARIIpfciasgkhitrneltkclecnfpaiHRHLVLIVDqegfcplcrtdlrgrplptdihinefvfne

MDKLIFtleephgpgdvYVCWQRRTGELLattgrdssvsiyNKHGKLIDKITLPGLCIVMDWDSEGDLLGIIssnssavnvwntytkkrtivdsglrdPLTCLVWCKQCSMLQLSVSIYNKHGKLIDKITLPGLCIVMDWDSEGDLLGIissnssavNVWTLLTYTLGERISWSDDGQLLAVTTSGGSVKIYLSKLPKLVVANNGKIAILSSLNQVSVYLRSierkgtpwtnFIIETEIEPSWREYHGLVVANNGKIAILSSLNQVSVYLRSIerkgtpwtnFIIETEIEPSFLNMGPCHVAVGMNNRVWVYGLNPSVNNKSHTLVYKPQLLGDKEHLGTITSLLLNANYSSALVNSRIQLHYLGDNQKTIPDAFIKNRNYFAHTLVYKPQLLGDKEYLGTITSLLLNANYSSALVNSRIQLHYLGDNQKTIPDAFVDKESKLFPESGEKYTIMTQAMSEEFLFFATSEYELKIFSLSEWKFVSGYKHSDKIKSIYPDIYGICLVLIEMNNTGFLYHTAMDYLLPIPEFPPATEEVLWDTVPVDRNVFVCCSKTSVVTYLFMPNYYEGPKIELVGATTIQSGQSPVLLTKGLLTLVTSSNKPLDLTLETHKTTMHNPKQTLDISLHKVLKLLNWKEAWNICAVLNQSETWRSFAEACLQNLEFSWAIRAYQSLDEAGMVWCLESLVEEEEDTSILCGHVAALLGNHDTAQQRYLTSDIPTMALTLRRDLRQWREALALatslgsnqtpIISCDYAQQLEMTGQHAQALSFYQKSMELATPDIQDPECQRKCKegiartsirvgdfrLGIRLAAESNSSVLKNECADILQQFNKLNDAVTLYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLDHLNDIRHAvdivkakkctEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEEDEPNPVELKRLAIHFEEDKDMFRAAQYYYHAKEYGRAMKLLLVTARQDKDSDENLWLGVsivsdshdeKLVETFKTllegkldgvkrnpKFLYRVLMNTGDYVAASSCALDVARDEAARGSYRNCHETLYSTIQELKKHKLQVGNDLMAGLMIIHSYLLARYHVRNANHSLAAPLLIRVAENISFFPLHATSILTSTVIECKKANLQESALKFATlllrpeyrsnledkyRKQIELIVRKaprkdiaspeeahvlpcPYCDTMVPDMMLHCASCARIIPFCIASGKHITRNELTKCLECNFPAIHRHLVLIVDQEGFCPLCRTDLRGRPLPTDIHINEFVFNE

MDKLIFTLEEPHGPGDVYVCWQRRTGELLATTGRDSSVSIYNKHGKLIDKITLPGLCIVMDWDSEGDLLGIISSNSSAVNVWNTYTKKRTIVDSGLRDPLTCLVWCKQCSMLQLSVSIYNKHGKLIDKITLPGLCIVMDWDSEGDLLGIISSNSSAVNVWTLLTYTLGERISWSDDGQLLAVTTSGGSVKIYLSKLPKLVVANNGKIAILSSLNQVSVYLRSIERKGTPWTNFIIETEIEPSWREYHGLVVANNGKIAILSSLNQVSVYLRSIERKGTPWTNFIIETEIEPSFLNMGPCHVAVGMNNRVWVYGLNPSVNNKSHTLVYKPQLLGDKEHLGTITslllnanyssalvnsRIQLHYLGDNQKTIPDAFIKNRNYFAHTLVYKPQLLGDKEYLGTITslllnanyssalvnsRIQLHYLGDNQKTIPDAFVDKESKLFPESGEKYTIMTQAMSEEFLFFATSEYELKIFSLSEWKFVSGYKHSDKIKSIYPDIYGICLVLIEMNNTGFLYHTAMDYLLPIPEFPPATEEVLWDTVPVDRNVFVCCSKTSVVTYLFMPNYYEGPKIELVGATTIQSGQSPvlltkglltlvtSSNKPLDLTLETHKTTMHNPKQTLDISLHKVLKLLNWKEAWNICAVLNQSETWRSFAEACLQNLEFSWAIRAYQSLDEAGMVWCLESLVEEEEDTSILCGHVAALLGNHDTAQQRYLTSDIPTMALTLRRDLRQWREALALATSLGSNQTPIISCDYAQQLEMTGQHAQALSFYQKSMELATPDIQDPECQRKCKEGIARTSIRVGDFRLGIRLAAESNSSVLKNECADILQQFNKLNDAVTLYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEEDEPNPVELKRLAIHFEEDKDMFRAAQYYYHAKEYGRAMKLLLVTARQDKDSDENLWLGVSIVSDSHDEKLVETFKTLLEGKLDGVKRNPKFLYRVLMNTGDYVAASSCALDVARDEAARGSYRNCHETLYSTIQELKKHKLQVGNDLMAGLMIIHSYLLARYHVRNANHSLAAPLLIRVAENISFFPLHATSILTSTVIECKKANLQESALKFATLLLRPEYRSNLEDKYRKQIELIVRKAPRKDIASPEEAHVLPCPYCDTMVPDMMLHCASCARIIPFCIASGKHITRNELTKCLECNFPAIHRHLVLIVDQEGFCPLCRTDLRGRPLPTDIHINEFVFNE

****IFTLEEPHGPGDVYVCWQRRTGELLATTGRDSSVSIYNKHGKLIDKITLPGLCIVMDWDSEGDLLGIISSNSSAVNVWNTYTKKRTIVDSGLRDPLTCLVWCKQCSMLQLSVSIYNKHGKLIDKITLPGLCIVMDWDSEGDLLGIISSNSSAVNVWTLLTYTLGERISWSDDGQLLAVTTSGGSVKIYLSKLPKLVVANNGKIAILSSLNQVSVYLRSIERKGTPWTNFIIETEIEPSWREYHGLVVANNGKIAILSSLNQVSVYLRSIERKGTPWTNFIIETEIEPSFLNMGPCHVAVGMNNRVWVYGLNPSVNNKSHTLVYKPQLLGDKEHLGTITSLLLNANYSSALVNSRIQLHYLGDNQKTIPDAFIKNRNYFAHTLVYKPQLLGDKEYLGTITSLLLNANYSSALVNSRIQLHYLGDNQKTIPDAFVDKESKLFPESGEKYTIMTQAMSEEFLFFATSEYELKIFSLSEWKFVSGYKHSDKIKSIYPDIYGICLVLIEMNNTGFLYHTAMDYLLPIPEFPPATEEVLWDTVPVDRNVFVCCSKTSVVTYLFMPNYYEGPKIELVGATTIQSGQSPVLLTKGLLTLVTSSNKPLDLTLETHKTTMHNPKQTLDISLHKVLKLLNWKEAWNICAVLNQSETWRSFAEACLQNLEFSWAIRAYQSLDEAGMVWCLE**********ILCGHVAALLGNHDTAQQRYLTSDIPTMALTLRRDLRQWREALALATSLGSNQTPIISCDYAQQLEMTGQHAQALSFYQKSM*L*********CQRKCKEGIARTSIRVGDFRLGIRLAAESNSSVLKNECADILQQFNKLNDAVTLYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEEDEPNPVELKRLAIHFEEDKDMFRAAQYYYHAKEYGRAMKLLLVTARQDKDSDENLWLGVSIVSDSHDEKLVETFKTLLEGKLDGVKRNPKFLYRVLMNTGDYVAASSCALDVARDEAARGSYRNCHETLYSTIQELKKHKLQVGNDLMAGLMIIHSYLLARYHVRNANHSLAAPLLIRVAENISFFPLHATSILTSTVIECKKANLQESALKFATLLLRPEYRSNLEDKYRKQIELIVRKAPRKDIASPEEAHVLPCPYCDTMVPDMMLHCASCARIIPFCIASGKHITRNELTKCLECNFPAIHRHLVLIVDQEGFCPLCRTDLRGRPLPTDIHINEFVF**

*DKLIFTLEEPHGPGDVYVCWQRRTGELLATTGRDSSVSIYNKHGKLIDKITLPGLCIVMDWDSEGDLLGIISSNSSAVNVWNTYTKKRTIVDSGLRDPLTCLVWCKQCSMLQLSVSIYNKHGKLIDKITLPGLCIVMDWDSEGDLLGIISSNSSAVNVWTLLTYTLGERISWSDDGQLLAVTTSGGSVKIYLSKLPKLVVANNGKIAILSSLNQVSVYLRSIERKGTPWTNFIIETEIEPSWREYHGLVVANNGKIAILSSLNQVSVYLRSIERKGTPWTNFIIETEIEPSFLNMGPCHVAVGMNNRVWVYGLNPSVNNKSHTLVYKPQLLGDKEHLGTITSLLLNANYSSALVNSRIQLHYLGDNQKTIPDAFIKNRNYFAHTLVYKPQLLGDKEYLGTITSLLLNANYSSALVNSRIQLHYLGDNQKTIPDAFVDKESKLFPESGEKYTIMTQAMSEEFLFFATSEYELKIFSLSEWKFVSGYKHSDKIKSIYPDIYGICLVLIEMNNTGFLYHTAMDYLLPIPEFPPATEEVLWDTVPVDRNVFVCCSKTSVVTYLFMPNYYEGPKIELVGATTIQSGQSPVLLTKGLLTLVTSSNKPLDLTLETHKTTMHNPKQTLDISLHKVLKLLNWKEAWNICAVLNQSETWRSFAEACLQNLEFSWAIRAYQSLDEAGMVWCLESL*E**EDTSILCGHVAALLGNHDTAQQRYLTSDIPTMALTLRRDLRQWREALALATSLGSNQTPIISCDYAQQLEMTGQHAQALSFYQKSMELATPDIQDPECQRKCKEGIARTSIRVGDFRLGIRLA***N*SVLKNECADILQQFNKLNDAVTLYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEEDEPNPVELKRLAIHFEEDKDMFRAAQYYYHAKEYGRAMKLLLVTARQDKDSDENLWLGVSIVSDSHDEKLVETFKTLLEGKLDGVKRNPKFLYRVLMNTGDYVAASSCALDVARDEAARGSYRNCHETLYSTIQELKKHK****NDLMAGLMIIHSYLLARYHVRNANHSLAAPLLIRVAENISFFPLHATSILTSTVIECKKANLQESALKFATLLLRP*Y***L**KYRKQIELIV*****************PCPYCDTMVPDMMLHCASCARIIPFCIASGKHITRNELTKCLECNFPAIHRHLVLIVDQEGFCPLCRTDLRGRPLPTDIHINEFV***

MDKLIFTLEEPHGPGDVYVCWQRRTGELLATTGRDSSVSIYNKHGKLIDKITLPGLCIVMDWDSEGDLLGIISSNSSAVNVWNTYTKKRTIVDSGLRDPLTCLVWCKQCSMLQLSVSIYNKHGKLIDKITLPGLCIVMDWDSEGDLLGIISSNSSAVNVWTLLTYTLGERISWSDDGQLLAVTTSGGSVKIYLSKLPKLVVANNGKIAILSSLNQVSVYLRSIERKGTPWTNFIIETEIEPSWREYHGLVVANNGKIAILSSLNQVSVYLRSIERKGTPWTNFIIETEIEPSFLNMGPCHVAVGMNNRVWVYGLNPSVNNKSHTLVYKPQLLGDKEHLGTITSLLLNANYSSALVNSRIQLHYLGDNQKTIPDAFIKNRNYFAHTLVYKPQLLGDKEYLGTITSLLLNANYSSALVNSRIQLHYLGDNQKTIP*AFVDKESKLFPESGEKYTIMTQAMSEEFLFFATSEYELKIFSLSEWKFVSGYKHSDKIKSIYPDIYGICLVLIEMNNTGFLYHTAMDYLLPIPEFPPATEEVLWDTVPVDRNVFVCCSKTSVVTYLFMPNYYEGPKIELVGATTIQSGQSPVLLTKGLLTLVTSSNKPLDLTLETHKTTMHNPKQTLDISLHKVLKLLNWKEAWNICAVLNQSETWRSFAEACLQNLEFSWAIRAYQSLDEAGMVWCLESLVEEEEDTSILCGHVAALLGNHDTAQQRYLTSDIPTMALTLRRDLRQWREALALATSLGSNQTPIISCDYAQQLEMTGQHAQALSFYQKSMELATPDIQDPECQRKCKEGIARTSIRVGDFRLGIRLAAESNSSVLKNECADILQQFNKLNDAVTLYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEEDEPNPVELKRLAIHFEEDKDMFRAAQYYYHAKEYGRAMKLLLVTARQDKDSDENLWLGVSIVSDSHDEKLVETFKTLLEGKLDGVKRNPKFLYRVLMNTGDYVAASSCALDVARDEAARGSYRNCHETLYSTIQELKKHKLQVGNDLMAGLMIIHSYLLARYHVRNANHSLAAPLLIRVAENISFFPLHATSILTSTVIECKKANLQESALKFATLLLRPEYRSNLEDKYRKQIELIVRKA***********HVLPCPYCDTMVPDMMLHCASCARIIPFCIASGKHITRNELTKCLECNFPAIHRHLVLIVDQEGFCPLCRTDLRGRPLPTDIHINEFVFN*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1324	2.2.26 [Sep-21-2011]
Q8NEZ3		1342	WD repeat-containing prot	yes	N/A	0.692	0.683	0.387	0.0
Q3UGF1		1341	WD repeat-containing prot	yes	N/A	0.700	0.692	0.380	0.0
Q9W040		1772	Intraflagellar transport	no	N/A	0.174	0.130	0.262	2e-07
Q22830		1737	Intraflagellar transport	no	N/A	0.228	0.173	0.225	0.0004
Q96RY7		1462	Intraflagellar transport	no	N/A	0.318	0.288	0.211	0.0009

>sp\|Q8NEZ3\|WDR19_HUMAN WD repeat-containing protein 19 OS=Homo sapiens GN=WDR19 PE=1 SV=2	Back alignment and function desciption

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/942 (38%), Positives = 561/942 (59%), Gaps = 25/942 (2%)

Query: 376  IKNRNYFAHTLVYKPQLLGDKEYLGTITSLLLNANYSSALVNSRIQLHYLGDNQKTIPDA 435
            + NR +F        + L D EYLGT+ S+ L+++Y++AL   ++QLH +   +  I DA
Sbjct: 404  MNNRAWFYVLGENAVKKLKDMEYLGTVASICLHSDYAAALFEGKVQLHLI---ESEILDA 460

Query: 436  FVDKESKLFPESGEKYTIMTQAMSEEFLFFATSEYELKIFSLSEWKFVSGYKHSDKIKSI 495
              ++E++LFP   +K  I+  A++ +FL + T    ++ F + +W+FV+ Y+H   +K I
Sbjct: 461  QEERETRLFPAVDDKCRILCHALTSDFLIYGTDTGVVQYFYIEDWQFVNDYRHPVSVKKI 520

Query: 496  YPDIYGICLVLIEMNNTGFLYHTAMDYLLPIPEFPPATEEVLWDTVPVDRNVFVCCSKTS 555
            +PD  G  LV I+  + GF+Y    D    IP+F P  + VLW+  P+D+ VF+      
Sbjct: 521  FPDPNGTRLVFIDEKSDGFVYCPVNDATYEIPDFSPTIKGVLWENWPMDKGVFIAYDDDK 580

Query: 556  VVTYLFMPNYYEGPKIELVGATTIQSGQSPVLLTKGLLTLVTSSNKPLDLTLETHKTTMH 615
            V TY+F  +  +G K+ L G+T +     P+LL  G LT  T S K  ++ L TH   + 
Sbjct: 581  VYTYVFHKDTIQGAKVILAGSTKVPFAHKPLLLYNGELTCQTQSGKVNNIYLSTH-GFLS 639

Query: 616  NPKQT----LDISLHKVLKLLNWKEAWNICAVLNQSETWRSFAEACLQNLEFSWAIRAYQ 671
            N K T    L   L + L L  + +AW +C +LN    W   A ACL ++E  +AIR Y+
Sbjct: 640  NLKDTGPDELRPMLAQNLMLKRFSDAWEMCRILNDEAAWNELARACLHHMEVEFAIRVYR 699

Query: 672  SLDEAGMVWCLESLVEEEEDTSILCGHVAALLGNHDTAQQRYLTSDIPTMALTLRRDLRQ 731
             +   G+V  LE  ++  ED ++L GH+A    +++ AQ  YL S  P  AL +RRDL+ 
Sbjct: 700  RIGNVGIVMSLEQ-IKGIEDYNLLAGHLAMFTNDYNLAQDLYLASSCPIAALEMRRDLQH 758

Query: 732  WREALALATSLGSNQTPIISCDYAQQLEMTGQHAQALSFYQKSMELATPDIQDPECQRKC 791
            W  AL LA  L  +Q P IS +YA QLE  G +  AL+ Y+K +   T D  + E    C
Sbjct: 759  WDSALQLAKHLAPDQIPFISKEYAIQLEFAGDYVNALAHYEKGI---TGD--NKEHDEAC 813

Query: 792  KEGIARTSIRVGDFRLGIRLAAESNSSVLKNECADILQQFNKLNDAVTLYESAGNYEKAA 851
              G+A+ SIR+GD R G+  A +  S VLK +C  IL+   + ++A  LYE    Y+KAA
Sbjct: 814  LAGVAQMSIRMGDIRRGVNQALKHPSRVLKRDCGAILENMKQFSEAAQLYEKGLYYDKAA 873

Query: 852  TCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLD 911
            + YI+ KNW K+G LLPH+ S    +QYAKAKEA G Y+E+V AYE A+ + +V+R+ LD
Sbjct: 874  SVYIRSKNWAKVGDLLPHVSSPKIHLQYAKAKEADGRYKEAVVAYENAKQWQSVIRIYLD 933

Query: 912  HLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKL 971
            HLN+   AV+IV+  +  +GAK +A +  + GD+G+AI FL++SKC  +AF L+QQH K+
Sbjct: 934  HLNNPEKAVNIVRETQSLDGAKMVARFFLQLGDYGSAIQFLVMSKCNNEAFTLAQQHNKM 993

Query: 972  HEFGKFLLEEDEPNPVELKRLAIHFEEDKDMFRAAQYYYHAKEYGRAMKLLLVTARQDKD 1031
              +   +  ED  N  + + +A++FE +K   +A +++    +Y RA+K  L    +   
Sbjct: 994  EIYADIIGSEDTTNE-DYQSIALYFEGEKRYLQAGKFFLLCGQYSRALKHFL----KCPS 1048

Query: 1032 SDENLWLGVSI--VSDSHDEKLVETFKTLLEGKLDGVKRNPKFLYRVLMNTGDYVAASSC 1089
            S++N+ + ++I  V  + DE L       L G+ DG+ ++ K+L+R+ M    Y  A+  
Sbjct: 1049 SEDNVAIEMAIETVGQAKDELLTNQLIDHLLGENDGMPKDAKYLFRLYMALKQYREAAQT 1108

Query: 1090 ALDVARDEAARGSYRNCHETLYSTIQELKKHKLQVGNDLMAGLMIIHSYLLARYHVRNAN 1149
            A+ +AR+E + G+YRN H+ L+S   ELK  K+++ +++   LMI+HSY+L + HV+N +
Sbjct: 1109 AIIIAREEQSAGNYRNAHDVLFSMYAELKSQKIKIPSEMATNLMILHSYILVKIHVKNGD 1168

Query: 1150 HSLAAPLLIRVAENISFFPLHATSILTSTVIECKKANLQESALKFATLLLRPEYRSNLED 1209
            H   A +LIRVA NIS FP H   ILTSTVIEC +A L+ SA  FA +L+RPEYRS ++ 
Sbjct: 1169 HMKGARMLIRVANNISKFPSHIVPILTSTVIECHRAGLKNSAFSFAAMLMRPEYRSKIDA 1228

Query: 1210 KYRKQIELIVRKAPRKDIASPEEAHVLPCPYCDTMVPDMMLHCASCARIIPFCIASGKHI 1269
            KY+K+IE +VR   R DI+  EEA   PCP+C  ++P+  L C  C   IP+CIA+G+H+
Sbjct: 1229 KYKKKIEGMVR---RPDISEIEEA-TTPCPFCKFLLPECELLCPGCKNSIPYCIATGRHM 1284

Query: 1270 TRNELTKCLECNFPAIHRHLVLIVDQEGFCPLCRTDLRGRPL 1311
             +++ T C  C+FPA++  L ++++ E  CP+C   L    L
Sbjct: 1285 LKDDWTVCPHCDFPALYSELKIMLNTESTCPMCSERLNAAQL 1326

May be involved in cilia function and/or assembly.
Homo sapiens (taxid: 9606)

>sp\|Q3UGF1\|WDR19_MOUSE WD repeat-containing protein 19 OS=Mus musculus GN=Wdr19 PE=1 SV=1	Back alignment and function description

>sp\|Q9W040\|OSM1_DROME Intraflagellar transport protein osm-1 OS=Drosophila melanogaster GN=osm-1 PE=3 SV=2	Back alignment and function description

>sp\|Q22830\|OSM1_CAEEL Intraflagellar transport protein osm-1 OS=Caenorhabditis elegans GN=osm-1 PE=2 SV=4	Back alignment and function description

>sp\|Q96RY7\|IF140_HUMAN Intraflagellar transport protein 140 homolog OS=Homo sapiens GN=IFT140 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1324
91080719		1363	PREDICTED: similar to WD repeat domain 1	0.959	0.931	0.341	0.0
307172988		1241	WD repeat-containing protein 19 [Campono	0.859	0.917	0.332	0.0
260805913		1351	hypothetical protein BRAFLDRAFT_286065 [	0.753	0.738	0.350	0.0
328702884		1362	PREDICTED: WD repeat-containing protein	0.775	0.754	0.353	0.0
281342307		1344	hypothetical protein PANDA_014668 [Ailur	0.753	0.742	0.356	0.0
431897158		1287	WD repeat-containing protein 19 [Pteropu	0.756	0.778	0.354	0.0
307199281		1364	WD repeat-containing protein 19 [Harpegn	0.691	0.671	0.386	0.0
198434162		1342	PREDICTED: similar to WD repeat domain 1	0.75	0.739	0.359	0.0
350415643		1397	PREDICTED: WD repeat-containing protein	0.701	0.664	0.382	0.0
440904764		1345	WD repeat-containing protein 19, partial	0.754	0.742	0.353	0.0

>gi\|91080719\|ref\|XP_975372.1\| PREDICTED: similar to WD repeat domain 19 [Tribolium castaneum] gi\|270005465\|gb\|EFA01913.1\| hypothetical protein TcasGA2_TC007523 [Tribolium castaneum]	Back alignment and taxonomy information

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/1389 (34%), Positives = 743/1389 (53%), Gaps = 119/1389 (8%)

Query: 2    DKLIFTLEEPHGPGDVYVCWQRRTGELLATTGRDSSVSIYNKHGKLIDKITLPGLCIVMD 61
            +KL+F LE+PHG GD+Y  WQ  +G  LATTG D  V+I++++G++ D+I LP LC    
Sbjct: 4    EKLLFRLEQPHGTGDIYTTWQNGSGMYLATTGIDCMVNIFDRYGQIQDRIRLPSLCTGFG 63

Query: 62   WDSEGDLLGIISSNSSAVNVWNTYTKKRTIVDSGLRDPLTCLVWCKQCSMLQL-----SV 116
            WDS+GDLL +I   S  + +W+  T+K+  +D  L+D ++C++W K   ML +     ++
Sbjct: 64   WDSDGDLLAVICQ-SPQLTLWDANTQKKIQIDVRLKDQMSCVIWAKTAPMLAVGTVKGNI 122

Query: 117  SIYNKH--------GKLIDKITLPGLCIVMDWDSE------------------GDLLGII 150
            SIYN +        GK   KIT         W++E                  GD L +I
Sbjct: 123  SIYNHNTSKRTPVIGKHAKKITCGA------WNTENLLALGSEDKTISISNVDGDTLRVI 176

Query: 151  S--SNSSAVNVWTL-----------LTYTLGERISW------SDDGQLLAVTTSGGSVKI 191
            +  +  S +N   +           ++  +G+R  +       D+   LA     GS+  
Sbjct: 177  NLRAEPSEINFSEMKLDERMGGENTVSVIVGKRTLYLYNLLDPDNPIELAFQQHYGSIVT 236

Query: 192  Y--LSKLPKLVVANNGK-IAILSSLNQVSVYLRSIERKGTPWTNFIIETEIEPSWREYHG 248
            Y        L+  N G  IAI + + +V   L  +       T+  I  +I  +      
Sbjct: 237  YKWFGDGYILIGFNAGYFIAISTHIKEVGQELFQVRNHKNTLTDITINDKIGKA-----A 291

Query: 249  LVVANNGKIAILSSLNQVSVYLRSIERKGTPWTNFIIETEI-----EPSFLNMGPCHVAV 303
                NN KI  LS+L + S  L   +  G    ++ ++ ++         LN+   HV +
Sbjct: 292  SCGDNNVKIHDLSNLQETSSVLTLSQEAGLERISWSVDGQLFSVCTRGGSLNVYLSHVPL 351

Query: 304  GMNNRVWVYGLNPSV------NNKSHTLVYKPQLLGDKEHLGTITSLLLNANYS-SALVN 356
              +       +  S+      N  S    YKP  +     L T  S +    Y  +A +N
Sbjct: 352  LTSVSTPRIAILSSLTEISLYNYSSEKTKYKPIPIT----LETEPSFIAVGPYHIAAGLN 407

Query: 357  SRIQLHYLGDNQKTIPDAFIKNRNYFAHTLVYKPQLLGDKEYLGTITSLLLNANYSSALV 416
            +R+  + L   Q  + DA               P +L D++YLG +TS+ LN  Y+S L 
Sbjct: 408  NRVWFYDLTRPQPGVDDA---------------PLMLKDRQYLGGVTSIKLNPEYASVLF 452

Query: 417  NSRIQLHYLGDNQKTIPDAFVDKESKLFPESGEKYTIMT-QAMSEEFLFFATSEYELKIF 475
              ++QLH +   Q  +     D+E+ +FP +      +T   ++ +FL + T    +  F
Sbjct: 453  EGKLQLHMI--EQPEV--CHEDRETIMFPNANSPNLFITCHFLTTDFLIYGTDMGNIVYF 508

Query: 476  SLSEWKFVSGYKHSDKIKSIYPDIYGICLVLIEMNNTGFLYHTAMDYLLPIPEFPPATEE 535
             + EW     YKH   I +++ D  G  LV +++   G++Y+  ++ ++ IP  P     
Sbjct: 509  HVEEWALAHEYKHEVGIVNVFADPAGTRLVFVDIKGQGYVYNAVINEVVLIPNLPNKVLG 568

Query: 536  VLWDTVPVDRNVFVCCSKTSVVTYLFMPNYYEGPKIELVGATTIQSGQSPVLLTKGLLTL 595
            V WD+   DRN+F+   +  + TY+++     G  ++ VG T++ + Q P+L+  G +  
Sbjct: 569  VTWDSNINDRNIFIVYDQHDIFTYVYVRYSINGSSVQKVGQTSLVTKQIPLLMYSGEVIS 628

Query: 596  VTSSNKPLDLTLETHKTT---MHNPKQTL-DISLHKVLKLLNWKEAWNICAVLNQSETWR 651
             T   +   L L TH +    ++   QT+ + + +K + L  +  AW  C  L   E WR
Sbjct: 629  ATPGGQITQLILNTHDSPQIGVNEHDQTIQETNFNKQIALYRFSAAWTTCETLKSEELWR 688

Query: 652  SFAEACLQNLEFSWAIRAYQSLDEAGMVWCLESLVEEEEDTSILCGHVAALLGNHDTAQQ 711
              A   +++LE   AIR ++ LD+  MVW LES +   ED  +LCG+VA  L + D AQ 
Sbjct: 689  KLAVEAMKHLEIDLAIRVFKLLDDVSMVWSLES-IAGVEDHKLLCGYVAMFLNDFDLAQD 747

Query: 712  RYLTSDIPTMALTLRRDLRQWREALALATSLGSNQTPIISCDYAQQLEMTGQHAQALSFY 771
             ++ S  P  AL +RRDL QW +AL LA  +   Q  +IS +YAQQLE TG +++A   Y
Sbjct: 748  WFMGSSYPVAALEMRRDLLQWDQALQLAKKMAPEQIALISREYAQQLEFTGNYSEAHIHY 807

Query: 772  QKSMELATPDIQDPECQRKCKEGIARTSIRVGDFRLGIRLAAESNSSVLKNECADILQQF 831
            +K ++    +   PE    CK GIART++   + R GI +A E ++  L  ECA+IL++ 
Sbjct: 808  EKGLQ----EDLSPEHTFICKAGIARTALHCNNTRHGISIALELDNKQLLKECAEILEKN 863

Query: 832  NKLNDAVTLYESAGNYEKAATCYIQLKNWTKIGQLLPHIKSATTFIQYAKAKEAMGSYRE 891
              LN+A  L+E   NY++AA  YI+L+NW KIG+LLP I S    +QYA AKE  G Y E
Sbjct: 864  KHLNEAANLFEKCQNYDRAALNYIKLRNWQKIGELLPKITSNKIHLQYAVAKENEGKYEE 923

Query: 892  SVGAYERAEDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGAKRIADYCNKHGDFGAAIHF 951
            +V AY  A+DYD+V+R+ L+HLN+   AV++V+  K TEGAK +A +  K  D+ +AI F
Sbjct: 924  AVRAYYTAKDYDSVIRLQLEHLNNPEIAVELVQETKSTEGAKLVAKFFQKLNDYTSAIKF 983

Query: 952  LILSKCYQDAFNLSQQHKKLHEFGKFLLE---EDEPNPVELKRLAIHFEEDKDMFRAAQY 1008
            L++SKC ++AF+L+++H K+  +G+ LL     DE  P +   +A HFE +++   A  Y
Sbjct: 984  LVMSKCNEEAFDLARKHGKMQLYGEILLNTLAPDELRPHDFNSIATHFENERNNLLAGIY 1043

Query: 1009 YYHAKEYGRAMKLLLVTARQDKDSDENLWLGVSIVSDSHDEKLVETFKTLLEGKLDGVKR 1068
            ++HAKEY +AMK LL  A+ +   +E +   + +V+ S +E L       L G+ DG+ +
Sbjct: 1044 WFHAKEYAKAMKHLLKAAKSNSKENEAITAAIDVVASSKNEALSSQLIEFLLGESDGLPK 1103

Query: 1069 NPKFLYRVLMNTGDYVAASSCALDVARDEAARGSYRNCHETLYSTIQELKKHKLQVGNDL 1128
            +PK+L+R+ M    Y  AS  AL +A +E   G+YRN H+ L++  QELK++ ++V N++
Sbjct: 1104 DPKYLFRLYMARKQYKEASKSALIIANEEQINGNYRNAHDVLFAMYQELKQNGIKVPNEM 1163

Query: 1129 MAGLMIIHSYLLARYHVRNANHSLAAPLLIRVAENISFFPLHATSILTSTVIECKKANLQ 1188
             A LM++HSY+L R HV+  +H   A +LIRVA NIS FP H   ILTSTVIEC +A L+
Sbjct: 1164 QANLMLLHSYILVRLHVKRGDHLKGARMLIRVANNISKFPSHKVPILTSTVIECHRAGLK 1223

Query: 1189 ESALKFATLLLRPEYRSNLEDKYRKQIELIVRKAPRKDIAS-----PEEAHVLPCPYCDT 1243
             +A K+AT+L+ PEYR N++ KY K+IE +VRK P+   A      P E  + PCPYC+ 
Sbjct: 1224 HAAFKYATMLMNPEYRKNVDAKYAKKIEAVVRKPPKSGKAGDGGGDPVEP-LTPCPYCEN 1282

Query: 1244 MVPDMMLHCASCARIIPFCIASGKHITRNELTKCLECNFPAIHRHLVLIVDQEGFCPLCR 1303
            ++P+   +C  C   IPFC+ +G+HI   +LT C EC+FPA+    + I+D E  CP+C 
Sbjct: 1283 LLPETETNCNGCKNNIPFCVVTGRHIVTTDLTACPECDFPALRSQFIEILDSEDSCPMCS 1342

Query: 1304 TDLRGRPLP 1312
              +  R LP
Sbjct: 1343 EKVDSRRLP 1351

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|307172988\|gb\|EFN64130.1\| WD repeat-containing protein 19 [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|260805913\|ref\|XP_002597830.1\| hypothetical protein BRAFLDRAFT_286065 [Branchiostoma floridae] gi\|229283098\|gb\|EEN53842.1\| hypothetical protein BRAFLDRAFT_286065 [Branchiostoma floridae]	Back alignment and taxonomy information

>gi\|328702884\|ref\|XP_001944319.2\| PREDICTED: WD repeat-containing protein 19-like [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|281342307\|gb\|EFB17891.1\| hypothetical protein PANDA_014668 [Ailuropoda melanoleuca]	Back alignment and taxonomy information

>gi\|431897158\|gb\|ELK06420.1\| WD repeat-containing protein 19 [Pteropus alecto]	Back alignment and taxonomy information

>gi\|307199281\|gb\|EFN79934.1\| WD repeat-containing protein 19 [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|198434162\|ref\|XP_002124215.1\| PREDICTED: similar to WD repeat domain 19 [Ciona intestinalis]	Back alignment and taxonomy information

>gi\|350415643\|ref\|XP_003490704.1\| PREDICTED: WD repeat-containing protein 19-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|440904764\|gb\|ELR55229.1\| WD repeat-containing protein 19, partial [Bos grunniens mutus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1324
UNIPROTKB\|F1Q2A8		1338	WDR19 "Uncharacterized protein	0.673	0.666	0.371	3.2e-211
UNIPROTKB\|E1B7Q4		1342	WDR19 "Uncharacterized protein	0.673	0.664	0.377	1.1e-210
UNIPROTKB\|Q8NEZ3		1342	WDR19 "WD repeat-containing pr	0.679	0.670	0.379	1.8e-210
UNIPROTKB\|E1C1Y1		1342	WDR19 "Uncharacterized protein	0.686	0.677	0.366	5.9e-210
RGD\|1306997		1340	Wdr19 "WD repeat domain 19" [R	0.679	0.671	0.376	9.7e-210
MGI\|MGI:2443231		1341	Wdr19 "WD repeat domain 19" [M	0.690	0.681	0.372	2.6e-209
UNIPROTKB\|I3LLZ8		1330	WDR19 "Uncharacterized protein	0.687	0.684	0.359	2.1e-196
UNIPROTKB\|B4DGR6		1182	WDR19 "WD repeat-containing pr	0.679	0.761	0.379	1.8e-189
FB\|FBgn0034452		1366	Oseg6 "Oseg6" [Drosophila mela	0.633	0.614	0.363	2.3e-189
WB\|WBGene00001118		1383	dyf-2 [Caenorhabditis elegans	0.675	0.646	0.334	9.5e-166

UNIPROTKB\|F1Q2A8 WDR19 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

 Score = 1681 (596.8 bits), Expect = 3.2e-211, Sum P(3) = 3.2e-211
 Identities = 340/915 (37%), Positives = 534/915 (58%)

Query:   393 LGDKEYLGTITXXXXXXXXXXXXXXXRIQLHYLGDNQKTIPDAFVDKESKLFPESGEKYT 452
             L D EYLGT+                ++QLH +   +  I DA  ++E++LFP   +K  
Sbjct:   418 LKDVEYLGTVASVCLHSDYAAALFEGKVQLHLI---ESEILDAQEERETRLFPAVDDKCR 474

Query:   453 IMTQAMSEEFLFFATSEYELKIFSLSEWKFVSGYKHSDKIKSIYPDIYGICLVLIEMNNT 512
             I+  A++ +FL + T    ++ F + +W+FV+ Y+H   +K I+PD  G  LV I+  + 
Sbjct:   475 ILCHALTGDFLIYGTDTGVIQYFYIEDWQFVNDYRHPVSVKKIFPDPNGTRLVFIDEKSD 534

Query:   513 GFLYHTAMDYLLPIPEFPPATEEVLWDTVPVDRNVFVCCSKTSVVTYLFMPNYYEGPKIE 572
             GF+Y    D    IP+F P  + VLW+  P+D+ VF+      V TY+F  +  +G K+ 
Sbjct:   535 GFVYCPVNDATYEIPDFSPTIKGVLWENWPMDKGVFIAYDDDKVYTYVFHKDTIQGSKVI 594

Query:   573 LVGATTIQSGQSPXXXXXXXXXXXXSSNKPLDLTLETHK--TTMHN--PKQTLDISLHKV 628
             L G T +     P             S K  ++ L TH+   ++ +  P +   + L + 
Sbjct:   595 LAGGTKVPFSHKPLLLYNGELTCQTQSGKINNMYLSTHRFLDSLKDVGPNELRQM-LTQT 653

Query:   629 LKLLNWKEAWNICAVLNQSETWRSFAEACLQNLEFSWAIRAYQSLDEAGMVWCLESLVEE 688
             L L  + +AW +C +LN    W   A ACL ++E  +AIR Y+++   G+V  LE  ++ 
Sbjct:   654 LMLKRFSDAWEMCKILNDHTAWNELARACLHHMEVEFAIRVYRTIGNVGIVMSLEQ-IKG 712

Query:   689 EEDTSILCGHVAALLGNHDTAQQRYLTSDIPTMALTLRRDLRQWREALALATSLGSNQTP 748
              ED ++L GH+A    + + AQ  YL S  P  AL +RRDL+ W  AL LA  L  +Q P
Sbjct:   713 IEDYNLLAGHLAMFTNDFNLAQDLYLASSCPVAALEMRRDLQHWDSALQLAKRLAPDQIP 772

Query:   749 IISCDYAQQLEMTGQHAQALSFYQKSMELATPDIQDPECQRKCKEGIARTSIRVGDFRLG 808
              IS +YA QLE TG +  AL+ Y+K +   T D ++ +    C  G+A+ SIR+GD R G
Sbjct:   773 FISKEYAIQLEFTGDYVNALAHYEKGI---TGDHKEHD--ELCLAGVAQMSIRMGDIRRG 827

Query:   809 IRLAAESNSSVLKNECADILQQFNKLNDAVTLYESAGNYEKAATCYIQLKNWTKIGQLLP 868
             +  A +  S VLK +C  IL+   + ++A  LYE    ++KAA+ YI+ KNW K+G+LLP
Sbjct:   828 VNQALKHPSRVLKRDCGAILENMKQFSEAAQLYEKGLYFDKAASVYIRCKNWAKVGELLP 887

Query:   869 HIKSATTFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLDHLNDIRHAVDIVKAKKC 928
              + S    +QYAKAKEA G Y+E+V AYE A+ +++V+R+ LDHLN+   AV IV+  + 
Sbjct:   888 RVASPKIHLQYAKAKEADGRYKEAVVAYENAKQWNSVIRIYLDHLNNPEKAVSIVRETQS 947

Query:   929 TEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEEDEPNPVE 988
              +GAK +A +  + GD+G+AI FL++SKC  +AF L+QQH K+  +   +  ED  N  +
Sbjct:   948 LDGAKMVARFFLQLGDYGSAIQFLVMSKCNNEAFTLAQQHNKMEIYADIIGSEDTTNE-D 1006

Query:   989 LKRLAIHFEEDKDMFRAAQYYYHAKEYGRAMK-LLLVTARQDKDSDENLWLGVSIVSDSH 1047
              + +A++FE +K  F+A +++    +Y RA+K  L   + +D  + E   + +  V  + 
Sbjct:  1007 YQSIALYFEGEKRHFQAGKFFLLCGQYSRALKHFLKCPSSEDNAAIE---MAIETVGQAK 1063

Query:  1048 DEKLVETFKTLLEGKLDGVKRNPKFLYRVLMNTGDYVAASSCALDVARDEAARGSYRNCH 1107
             DE L       L G+ DG+ ++ K+L+R+ M       A+  A+ +AR+E + G+YRN H
Sbjct:  1064 DELLTNQLIDHLMGESDGMPKDAKYLFRLYMALKQSREAARTAIIIAREEQSAGNYRNAH 1123

Query:  1108 ETLYSTIQELKKHKLQVGNDLMAGLMIIHSYLLARYHVRNANHSLAAPLLIRVAENISFF 1167
             + L+S   ELK  K+++ +++   LMI+HSY+L + HV+N +H   A +LIRVA NIS F
Sbjct:  1124 DVLFSMYAELKSQKIKIPSEMATNLMILHSYILVKIHVKNGDHMKGARMLIRVANNISKF 1183

Query:  1168 PLHATSILTSTVIECKKANLQESALKFATLLLRPEYRSNLEDKYRKQIELIVRKAPRKDI 1227
             P H   ILTSTVIEC +A L+ SA  FA +L+RPEYR+ ++ KY+K+IE +VR   R D 
Sbjct:  1184 PSHIVPILTSTVIECHRAGLKNSAFSFAAMLMRPEYRNKIDPKYKKKIEAMVR---RPDT 1240

Query:  1228 ASPEEAHVLPCPYCDTMVPDMMLHCASCARIIPFCIASGKHITRNELTKCLECNFPAIHR 1287
             +  EEA   PCP+C+ ++P+  L C  C   IP+CIA+G+H+ +++ T C  C+FPA++ 
Sbjct:  1241 SETEEA-TTPCPFCEFLLPECELLCPGCKNNIPYCIATGRHMLKDDWTVCPHCDFPALYS 1299

Query:  1288 HLVLIVDQEGFCPLC 1302
                ++++ E  CP+C
Sbjct:  1300 EFKILLNTESTCPMC 1314

GO:0061055 "myotome development" evidence=IEA

GO:0060831 "smoothened signaling pathway involved in dorsal/ventral neural tube patterning" evidence=IEA

GO:0060830 "ciliary receptor clustering involved in smoothened signaling pathway" evidence=IEA

GO:0055123 "digestive system development" evidence=IEA

GO:0050877 "neurological system process" evidence=IEA

GO:0048701 "embryonic cranial skeleton morphogenesis" evidence=IEA

GO:0042471 "ear morphogenesis" evidence=IEA

GO:0042384 "cilium assembly" evidence=IEA

GO:0032391 "photoreceptor connecting cilium" evidence=IEA

GO:0031514 "motile cilium" evidence=IEA

GO:0031076 "embryonic camera-type eye development" evidence=IEA

GO:0030326 "embryonic limb morphogenesis" evidence=IEA

GO:0001701 "in utero embryonic development" evidence=IEA

UNIPROTKB\|E1B7Q4 WDR19 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8NEZ3 WDR19 "WD repeat-containing protein 19" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E1C1Y1 WDR19 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

RGD\|1306997 Wdr19 "WD repeat domain 19" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

MGI\|MGI:2443231 Wdr19 "WD repeat domain 19" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|I3LLZ8 WDR19 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|B4DGR6 WDR19 "WD repeat-containing protein 19" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

FB\|FBgn0034452 Oseg6 "Oseg6" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

WB\|WBGene00001118 dyf-2 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q8NEZ3	WDR19_HUMAN	No assigned EC number	0.3874	0.6925	0.6833	yes	N/A
Q3UGF1	WDR19_MOUSE	No assigned EC number	0.3803	0.7009	0.6920	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		1324
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	3e-06
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	4e-05
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	4e-05
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	4e-04

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

 Score = 51.2 bits (121), Expect = 3e-06
 Identities = 52/224 (23%), Positives = 96/224 (42%), Gaps = 25/224 (11%)

Query: 2   DKLIFTLEEPHGPGDVYVCWQRRTGE--LLATTGRDSSVSIYNKHGKLIDKITLPGL--- 56
           +KLI +LE  H      +      G   LLA++  D +V +++         TL G    
Sbjct: 98  EKLIKSLEGLHDSSVSKLALSSPDGNSILLASSSLDGTVKLWDLSTPGKLIRTLEGHSES 157

Query: 57  CIVMDWDSEGDLLGIISSNSSAVNVWNTYTKKRTIVDSGLRDPLTCLVWCKQCSML---- 112
              + +  +G LL   SS    + +W+  T K     +G  DP++ L +     +L    
Sbjct: 158 VTSLAFSPDGKLLASGSSLDGTIKLWDLRTGKPLSTLAGHTDPVSSLAFSPDGGLLIASG 217

Query: 113 --QLSVSIYNKHGKLIDKITLPGL--CIVMDWDSEGDLLGIISSNSSAVNVWTL-----L 163
               ++ +++     + + TL G    +V  +  +G LL    S+   + +W L     L
Sbjct: 218 SSDGTIRLWDLSTGKLLRSTLSGHSDSVVSSFSPDGSLL-ASGSSDGTIRLWDLRSSSSL 276

Query: 164 TYTLG------ERISWSDDGQLLAVTTSGGSVKIYLSKLPKLVV 201
             TL         +++S DG+LLA  +S G+V+++  +  KL+ 
Sbjct: 277 LRTLSGHSSSVLSVAFSPDGKLLASGSSDGTVRLWDLETGKLLS 320

Length = 466

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment

Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1324
KOG2041\|consensus		1189		100.0
KOG3617\|consensus		1416		100.0
KOG1538\|consensus		1081		100.0
KOG3616\|consensus		1636		100.0
KOG0292\|consensus		1202		100.0
KOG2247\|consensus		615		100.0
KOG3617\|consensus		1416		100.0
KOG0276\|consensus		794		100.0
KOG1524\|consensus		737		100.0
KOG0318\|consensus		603		99.97
KOG0292\|consensus		1202		99.97
KOG1538\|consensus		1081		99.97
KOG2041\|consensus		1189		99.96
KOG0271\|consensus		480		99.96
KOG0319\|consensus		775		99.96
KOG0318\|consensus		603		99.94
KOG0272\|consensus		459		99.94
KOG1920\|consensus		1265		99.92
KOG0286\|consensus		343		99.92
KOG0276\|consensus		794		99.92
KOG0279\|consensus		315		99.91
KOG0272\|consensus		459		99.91
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	99.91
KOG0271\|consensus		480		99.91
KOG0291\|consensus		893		99.91
KOG0273\|consensus		524		99.9
KOG0319\|consensus		775		99.9
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	99.9
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	99.9
KOG4626\|consensus		966		99.9
KOG0291\|consensus		893		99.89
PF04762		928	IKI3: IKI3 family; InterPro: IPR006849 Members of	99.89
KOG0263\|consensus		707		99.89
KOG0279\|consensus		315		99.88
KOG4626\|consensus		966		99.88
KOG0273\|consensus		524		99.88
KOG0296\|consensus		399		99.87
KOG0315\|consensus		311		99.87
KOG0293\|consensus		519		99.86
KOG0306\|consensus		888		99.86
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	99.85
KOG0284\|consensus		464		99.85
KOG0645\|consensus		312		99.85
KOG0284\|consensus		464		99.85
KOG0645\|consensus		312		99.84
KOG0316\|consensus		307		99.84
PLN03077		857	Protein ECB2; Provisional	99.84
KOG0265\|consensus		338		99.84
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	99.83
KOG0263\|consensus		707		99.83
KOG1408\|consensus		1080		99.83
KOG0282\|consensus		503		99.83
KOG2048\|consensus		691		99.83
KOG0315\|consensus		311		99.83
PLN00181		793	protein SPA1-RELATED; Provisional	99.83
KOG0306\|consensus		888		99.82
PLN03077		857	Protein ECB2; Provisional	99.82
KOG0286\|consensus		343		99.82
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	99.81
KOG1539\|consensus		910		99.81
PTZ00421		493	coronin; Provisional	99.81
KOG0973\|consensus		942		99.81
KOG0285\|consensus		460		99.81
KOG0296\|consensus		399		99.81
KOG1539\|consensus		910		99.81
PLN03218		1060	maturation of RBCL 1; Provisional	99.8
KOG0266\|consensus		456		99.8
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	99.8
KOG0275\|consensus		508		99.8
KOG1524\|consensus		737		99.8
KOG0266\|consensus		456		99.79
KOG0772\|consensus		641		99.79
KOG3616\|consensus		1636		99.79
KOG0640\|consensus		430		99.78
KOG2048\|consensus		691		99.78
KOG1408\|consensus		1080		99.78
KOG0282\|consensus		503		99.77
KOG0973\|consensus		942		99.77
KOG0293\|consensus		519		99.77
KOG1920\|consensus		1265		99.77
KOG0285\|consensus		460		99.76
KOG1274\|consensus		933		99.76
KOG1446\|consensus		311		99.76
KOG0283\|consensus		712		99.76
PLN03218		1060	maturation of RBCL 1; Provisional	99.76
KOG0643\|consensus		327		99.76
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	99.75
KOG0295\|consensus		406		99.75
KOG0278\|consensus		334		99.75
PTZ00420		568	coronin; Provisional	99.75
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	99.75
KOG1063\|consensus		764		99.74
KOG0295\|consensus		406		99.74
KOG1407\|consensus		313		99.73
KOG0294\|consensus		362		99.73
KOG1407\|consensus		313		99.73
KOG0277\|consensus		311		99.72
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	99.72
KOG0643\|consensus		327		99.72
KOG0316\|consensus		307		99.72
KOG0313\|consensus		423		99.71
KOG0265\|consensus		338		99.71
COG5290		1243	IkappaB kinase complex, IKAP component [Transcript	99.71
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	99.71
KOG0288\|consensus		459		99.71
KOG0283\|consensus		712		99.7
KOG0640\|consensus		430		99.7
KOG0647\|consensus		347		99.7
KOG0772\|consensus		641		99.7
KOG2096\|consensus		420		99.7
KOG0305\|consensus		484		99.7
KOG0275\|consensus		508		99.7
KOG0310\|consensus		487		99.7
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	99.7
PLN00181		793	protein SPA1-RELATED; Provisional	99.69
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	99.69
KOG1332\|consensus		299		99.69
KOG0310\|consensus		487		99.69
KOG0289\|consensus		506		99.68
KOG2002\|consensus		1018		99.68
PTZ00421		493	coronin; Provisional	99.68
PTZ00420		568	coronin; Provisional	99.67
KOG0305\|consensus		484		99.67
KOG0313\|consensus		423		99.66
KOG2106\|consensus		626		99.66
KOG0278\|consensus		334		99.65
PRK11788		389	tetratricopeptide repeat protein; Provisional	99.65
KOG2055\|consensus		514		99.65
KOG0269\|consensus		839		99.65
KOG0281\|consensus		499		99.65
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	99.64
KOG0277\|consensus		311		99.64
KOG0289\|consensus		506		99.64
KOG2247\|consensus		615		99.64
PF04762		928	IKI3: IKI3 family; InterPro: IPR006849 Members of	99.63
KOG4497\|consensus		447		99.63
KOG2002\|consensus		1018		99.62
KOG4283\|consensus		397		99.62
KOG1445\|consensus		1012		99.62
KOG0264\|consensus		422		99.62
KOG1840\|consensus		508		99.62
KOG0268\|consensus		433		99.61
KOG0646\|consensus		476		99.61
KOG0641\|consensus		350		99.61
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	99.6
KOG0281\|consensus		499		99.6
KOG2106\|consensus		626		99.6
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	99.6
KOG0299\|consensus		479		99.59
KOG0267\|consensus		825		99.58
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	99.58
KOG0294\|consensus		362		99.58
KOG0274\|consensus		537		99.57
KOG0639\|consensus		705		99.57
PRK11788		389	tetratricopeptide repeat protein; Provisional	99.57
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	99.56
KOG1273\|consensus		405		99.56
KOG1274\|consensus		933		99.56
KOG1332\|consensus		299		99.56
KOG0264\|consensus		422		99.56
KOG4283\|consensus		397		99.55
KOG0302\|consensus		440		99.55
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	99.55
KOG1273\|consensus		405		99.54
KOG0299\|consensus		479		99.54
KOG1446\|consensus		311		99.54
KOG0307\|consensus		1049		99.54
KOG2076\|consensus		895		99.54
KOG0303\|consensus		472		99.53
KOG0288\|consensus		459		99.53
KOG0302\|consensus		440		99.52
KOG1036\|consensus		323		99.52
KOG1036\|consensus		323		99.51
KOG1840\|consensus		508		99.51
KOG0300\|consensus		481		99.51
KOG0308\|consensus		735		99.51
KOG0641\|consensus		350		99.51
KOG0301\|consensus		745		99.5
KOG0308\|consensus		735		99.5
KOG0269\|consensus		839		99.5
KOG1009\|consensus		434		99.49
KOG1009\|consensus		434		99.49
KOG0267\|consensus		825		99.49
KOG0274\|consensus		537		99.48
KOG0647\|consensus		347		99.47
KOG2055\|consensus		514		99.46
KOG2445\|consensus		361		99.45
KOG0270\|consensus		463		99.45
KOG0650\|consensus		733		99.45
KOG1126\|consensus		638		99.45
KOG2003\|consensus		840		99.44
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	99.44
KOG2096\|consensus		420		99.44
KOG0646\|consensus		476		99.44
PRK14574		822	hmsH outer membrane protein; Provisional	99.43
KOG0639\|consensus		705		99.43
KOG0300\|consensus		481		99.43
KOG1126\|consensus		638		99.43
KOG1523\|consensus		361		99.43
KOG1155\|consensus		559		99.41
KOG4328\|consensus		498		99.41
PRK01742		429	tolB translocation protein TolB; Provisional	99.41
KOG0771\|consensus		398		99.41
KOG2919\|consensus		406		99.41
KOG2076\|consensus		895		99.41
KOG0642\|consensus		577		99.4
PRK05137		435	tolB translocation protein TolB; Provisional	99.39
KOG1034\|consensus		385		99.38
KOG1063\|consensus		764		99.38
KOG0321\|consensus		720		99.37
KOG1034\|consensus		385		99.37
PRK03629		429	tolB translocation protein TolB; Provisional	99.36
KOG2445\|consensus		361		99.36
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	99.36
KOG2003\|consensus		840		99.35
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	99.35
KOG0307\|consensus		1049		99.35
KOG0547\|consensus		606		99.35
KOG0270\|consensus		463		99.33
KOG0268\|consensus		433		99.33
KOG0301\|consensus		745		99.32
PRK14574		822	hmsH outer membrane protein; Provisional	99.32
KOG2139\|consensus		445		99.32
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	99.32
KOG1445\|consensus		1012		99.31
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	99.31
PRK04922		433	tolB translocation protein TolB; Provisional	99.3
KOG4378\|consensus		673		99.3
KOG1155\|consensus		559		99.29
KOG2139\|consensus		445		99.29
KOG2919\|consensus		406		99.28
PRK02889		427	tolB translocation protein TolB; Provisional	99.27
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	99.27
KOG4378\|consensus		673		99.26
KOG1188\|consensus		376		99.26
KOG1173\|consensus		611		99.25
KOG0290\|consensus		364		99.25
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	99.25
PRK01742		429	tolB translocation protein TolB; Provisional	99.24
KOG2110\|consensus		391		99.23
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	99.23
KOG1007\|consensus		370		99.23
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	99.23
KOG4328\|consensus		498		99.22
KOG0548\|consensus		539		99.22
KOG0985\|consensus		1666		99.2
KOG2066\|consensus		846		99.2
KOG1963\|consensus		792		99.19
PRK11028		330	6-phosphogluconolactonase; Provisional	99.19
KOG0547\|consensus		606		99.19
COG4946		668	Uncharacterized protein related to the periplasmic	99.18
PRK04792		448	tolB translocation protein TolB; Provisional	99.18
KOG2111\|consensus		346		99.17
KOG1007\|consensus		370		99.17
KOG2114\|consensus		933		99.16
KOG2110\|consensus		391		99.16
KOG2047\|consensus		835		99.16
KOG0303\|consensus		472		99.16
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	99.16
PRK00178		430	tolB translocation protein TolB; Provisional	99.15
KOG0650\|consensus		733		99.13
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	99.13
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	99.12
KOG1129\|consensus		478		99.12
KOG3785\|consensus		557		99.12
KOG0985\|consensus		1666		99.12
PRK11028		330	6-phosphogluconolactonase; Provisional	99.11
KOG0624\|consensus		504		99.11
PRK05137		435	tolB translocation protein TolB; Provisional	99.11
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	99.1
PRK02889		427	tolB translocation protein TolB; Provisional	99.1
KOG0290\|consensus		364		99.1
KOG4497\|consensus		447		99.1
PRK01029		428	tolB translocation protein TolB; Provisional	99.1
KOG0321\|consensus		720		99.1
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	99.09
KOG1523\|consensus		361		99.09
KOG1129\|consensus		478		99.08
KOG1174\|consensus		564		99.08
KOG1963\|consensus		792		99.07
PRK03629		429	tolB translocation protein TolB; Provisional	99.07
KOG1130\|consensus		639		99.06
KOG1587\|consensus		555		99.06
KOG1310\|consensus		758		99.04
KOG2114\|consensus		933		99.04
KOG1130\|consensus		639		99.03
KOG4227\|consensus		609		99.03
PRK04922		433	tolB translocation protein TolB; Provisional	99.03
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	99.01
KOG2394\|consensus		636		99.0
KOG1173\|consensus		611		99.0
PRK04043		419	tolB translocation protein TolB; Provisional	98.99
KOG2315\|consensus		566		98.98
KOG1240\|consensus		1431		98.98
PRK12370		553	invasion protein regulator; Provisional	98.98
KOG0322\|consensus		323		98.98
KOG3785\|consensus		557		98.97
KOG0548\|consensus		539		98.97
KOG0495\|consensus		913		98.97
KOG4162\|consensus		799		98.96
KOG2376\|consensus		652		98.95
PRK12370		553	invasion protein regulator; Provisional	98.95
KOG1272\|consensus		545		98.94
KOG2376\|consensus		652		98.94
PRK11189		296	lipoprotein NlpI; Provisional	98.93
PRK11189		296	lipoprotein NlpI; Provisional	98.93
KOG1188\|consensus		376		98.93
KOG0649\|consensus		325		98.93
KOG0771\|consensus		398		98.93
KOG0495\|consensus		913		98.92
KOG4340\|consensus		459		98.89
KOG1174\|consensus		564		98.89
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	98.88
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	98.88
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	98.88
KOG0644\|consensus		1113		98.88
KOG0624\|consensus		504		98.87
KOG1354\|consensus		433		98.86
KOG2394\|consensus		636		98.86
PRK00178		430	tolB translocation protein TolB; Provisional	98.85
PRK04792		448	tolB translocation protein TolB; Provisional	98.85
KOG3881\|consensus		412		98.84
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	98.84
COG3071		400	HemY Uncharacterized enzyme of heme biosynthesis [	98.83
KOG2111\|consensus		346		98.83
KOG1156\|consensus		700		98.83
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	98.82
KOG1912\|consensus		1062		98.82
KOG0642\|consensus		577		98.81
KOG1272\|consensus		545		98.81
KOG1517\|consensus		1387		98.78
COG2319		466	FOG: WD40 repeat [General function prediction only	98.78
KOG1127\|consensus		1238		98.77
KOG1587\|consensus		555		98.75
PRK04841		903	transcriptional regulator MalT; Provisional	98.75
KOG0644\|consensus		1113		98.75
KOG1125\|consensus		579		98.75
KOG0649\|consensus		325		98.75
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	98.74
KOG1156\|consensus		700		98.74
COG2319		466	FOG: WD40 repeat [General function prediction only	98.74
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	98.74
PRK01029		428	tolB translocation protein TolB; Provisional	98.73
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	98.7
KOG1915\|consensus		677		98.7
KOG1912\|consensus		1062		98.7
KOG1125\|consensus		579		98.66
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	98.65
PRK04043		419	tolB translocation protein TolB; Provisional	98.65
KOG2314\|consensus		698		98.64
KOG1310\|consensus		758		98.64
KOG1240\|consensus		1431		98.64
PRK04841		903	transcriptional regulator MalT; Provisional	98.62
KOG0550\|consensus		486		98.61
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	98.6
KOG2047\|consensus		835		98.59
KOG1517\|consensus		1387		98.58
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	98.57
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	98.56
KOG0550\|consensus		486		98.56
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	98.54
KOG1127\|consensus		1238		98.54
COG4946		668	Uncharacterized protein related to the periplasmic	98.54
COG3071		400	HemY Uncharacterized enzyme of heme biosynthesis [	98.54
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	98.53
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	98.53
KOG0322\|consensus		323		98.52
KOG2321\|consensus		703		98.51
KOG4227\|consensus		609		98.5
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	98.5
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	98.47
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	98.47
KOG2034\|consensus		911		98.47
KOG2315\|consensus		566		98.45
KOG4162\|consensus		799		98.45
KOG2314\|consensus		698		98.45
KOG0974\|consensus		967		98.45
COG5170		460	CDC55 Serine/threonine protein phosphatase 2A, reg	98.43
KOG3881\|consensus		412		98.43
KOG2321\|consensus		703		98.43
KOG1941\|consensus		518		98.43
KOG2280\|consensus		829		98.4
KOG1064\|consensus		2439		98.4
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	98.39
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	98.39
KOG4340\|consensus		459		98.39
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	98.37
KOG1354\|consensus		433		98.36
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	98.36
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	98.35
KOG0974\|consensus		967		98.34
KOG1915\|consensus		677		98.33
PF06957		422	COPI_C: Coatomer (COPI) alpha subunit C-terminus;	98.32
KOG1941\|consensus		518		98.29
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	98.28
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	98.28
PF04733		290	Coatomer_E: Coatomer epsilon subunit; InterPro: IP	98.27
PF15492		282	Nbas_N: Neuroblastoma-amplified sequence, N termin	98.26
KOG1128\|consensus		777		98.26
PRK10370		198	formate-dependent nitrite reductase complex subuni	98.26
KOG1334\|consensus		559		98.25
KOG4547\|consensus		541		98.25
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	98.22
PRK14720		906	transcript cleavage factor/unknown domain fusion p	98.21
KOG4547\|consensus		541		98.19
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	98.19
PRK15359		144	type III secretion system chaperone protein SscB;	98.18
KOG1409\|consensus		404		98.17
PRK15359		144	type III secretion system chaperone protein SscB;	98.16
COG5290		1243	IkappaB kinase complex, IKAP component [Transcript	98.15
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	98.14
KOG0553\|consensus		304		98.13
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	98.1
KOG1409\|consensus		404		98.1
PRK10370		198	formate-dependent nitrite reductase complex subuni	98.09
KOG1586\|consensus		288		98.07
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	98.07
PF15492		282	Nbas_N: Neuroblastoma-amplified sequence, N termin	98.07
PF04733		290	Coatomer_E: Coatomer epsilon subunit; InterPro: IP	98.07
KOG1128\|consensus		777		98.06
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	98.06
KOG3060\|consensus		289		98.03
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	98.01
PLN02789		320	farnesyltranstransferase	97.99
KOG1586\|consensus		288		97.99
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	97.97
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	97.95
PRK14720		906	transcript cleavage factor/unknown domain fusion p	97.94
KOG3081\|consensus		299		97.93
KOG1334\|consensus		559		97.92
PLN02789		320	farnesyltranstransferase	97.91
KOG4190\|consensus		1034		97.91
TIGR02552		135	LcrH_SycD type III secretion low calcium response	97.89
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	97.88
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	97.88
COG4783		484	Putative Zn-dependent protease, contains TPR repea	97.85
KOG4532\|consensus		344		97.85
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	97.84
PF11768		545	DUF3312: Protein of unknown function (DUF3312); In	97.83
KOG2066\|consensus		846		97.83
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	97.83
PF12688		120	TPR_5: Tetratrico peptide repeat	97.82
COG4783		484	Putative Zn-dependent protease, contains TPR repea	97.82
COG4700		251	Uncharacterized protein conserved in bacteria cont	97.8
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	97.8
KOG0280\|consensus		339		97.8
KOG1585\|consensus		308		97.77
PF00400		39	WD40: WD domain, G-beta repeat; InterPro: IPR01978	97.73
KOG4532\|consensus		344		97.72
KOG0882\|consensus		558		97.7
KOG3060\|consensus		289		97.69
PF11768		545	DUF3312: Protein of unknown function (DUF3312); In	97.69
PF00400		39	WD40: WD domain, G-beta repeat; InterPro: IPR01978	97.67
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	97.65
PF13525		203	YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M	97.64
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	97.63
PF06977		248	SdiA-regulated: SdiA-regulated; InterPro: IPR00972	97.6
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	97.59
KOG1897\|consensus		1096		97.59
PRK10866		243	outer membrane biogenesis protein BamD; Provisiona	97.58
KOG4714\|consensus		319		97.58
KOG0882\|consensus		558		97.57
KOG0280\|consensus		339		97.57
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	97.56
KOG3914\|consensus		390		97.56
KOG4190\|consensus		1034		97.55
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	97.55
PF09295		395	ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter	97.53
KOG1070\|consensus		1710		97.52
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	97.51
KOG1275\|consensus		1118		97.5
KOG1585\|consensus		308		97.49
TIGR02552		135	LcrH_SycD type III secretion low calcium response	97.48
PF00930		353	DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin	97.47
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	97.46
PF12688		120	TPR_5: Tetratrico peptide repeat	97.44
PF04840		319	Vps16_C: Vps16, C-terminal region; InterPro: IPR00	97.43
COG3898		531	Uncharacterized membrane-bound protein [Function u	97.41
KOG3914\|consensus		390		97.4
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	97.4
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	97.38
KOG0553\|consensus		304		97.37
PF04841		410	Vps16_N: Vps16, N-terminal region; InterPro: IPR00	97.35
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	97.34
PF09295		395	ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter	97.34
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	97.32
KOG3081\|consensus		299		97.31
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	97.27
PF12773		50	DZR: Double zinc ribbon	97.26
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	97.26
KOG1064\|consensus		2439		97.26
COG4700		251	Uncharacterized protein conserved in bacteria cont	97.25
KOG1645\|consensus		463		97.24
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	97.23
PRK10866		243	outer membrane biogenesis protein BamD; Provisiona	97.23
KOG4640\|consensus		665		97.22
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	97.2
PF13525		203	YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M	97.2
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	97.19
PRK13616		591	lipoprotein LpqB; Provisional	97.18

>KOG2041\|consensus	Back alignment and domain information

Probab=100.00  E-value=1.7e-77  Score=642.70  Aligned_cols=998  Identities=18%  Similarity=0.257  Sum_probs=706.1

Q ss_pred             cCCCCCCeeEEEEecCCCCEEEEEeCCCcEEEEEC-CCcEEEEEe---CCCCEEEEEEcCCCCEEEEEEcCCCeEEEEEc
Q psy12365          9 EEPHGPGDVYVCWQRRTGELLATTGRDSSVSIYNK-HGKLIDKIT---LPGLCIVMDWDSEGDLLGIISSNSSAVNVWNT   84 (1324)
Q Consensus         9 ~~~h~~~i~~~~~sp~~g~~l~~~~~~~~v~v~~~-~~~~~~~~~---~~~~i~~i~~~~d~~~l~~~~~~d~~i~iw~~   84 (1324)
                      -++|...|..+.|+. ..+.|.++..+|.|.||-+ +|....+..   .+.-|.+++|+.||..+++... ||.|.|=.+
T Consensus        67 LeGH~~sV~vvTWNe-~~QKLTtSDt~GlIiVWmlykgsW~EEMiNnRnKSvV~SmsWn~dG~kIcIvYe-DGavIVGsv  144 (1189)
T KOG2041|consen   67 LEGHNASVMVVTWNE-NNQKLTTSDTSGLIIVWMLYKGSWCEEMINNRNKSVVVSMSWNLDGTKICIVYE-DGAVIVGSV  144 (1189)
T ss_pred             hccCcceEEEEEecc-ccccccccCCCceEEEEeeecccHHHHHhhCcCccEEEEEEEcCCCcEEEEEEc-cCCEEEEee
Confidence            378999999999999 9999999999999999997 554433322   3467899999999999999999 999999888


Q ss_pred             CCCeEEEEecCCCCCceEEEEecCCCEEEE-----EEEEEeCCCCeEEEEe-------------cCCcEEEEEEc-----
Q psy12365         85 YTKKRTIVDSGLRDPLTCLVWCKQCSMLQL-----SVSIYNKHGKLIDKIT-------------LPGLCIVMDWD-----  141 (1324)
Q Consensus        85 ~~~~~~~~~~~~~~~v~~~~~s~~~~~l~~-----~i~v~d~~g~~~~~~~-------------~~~~i~~~~~~-----  141 (1324)
                      ++..+....- .......+.|++|...+..     .+.+||..|....++.             .+..|..+.|.     
T Consensus       145 dGNRIwgKeL-kg~~l~hv~ws~D~~~~Lf~~ange~hlydnqgnF~~Kl~~~c~Vn~tg~~s~~~~kia~i~w~~g~~~  223 (1189)
T KOG2041|consen  145 DGNRIWGKEL-KGQLLAHVLWSEDLEQALFKKANGETHLYDNQGNFERKLEKDCEVNGTGIFSNFPTKIAEIEWNTGPYQ  223 (1189)
T ss_pred             ccceecchhc-chheccceeecccHHHHHhhhcCCcEEEecccccHHHhhhhceEEeeeeeecCCCccccceeeccCccc
Confidence            8765432110 1123457889999776655     6778886643322221             12234455554     


Q ss_pred             ---CCCCEEEEEEcCCCcEEEeecc---------cCCCeeEEEEcCCCCEEEEEeCC---------CcEEEEEc------
Q psy12365        142 ---SEGDLLGIISSNSSAVNVWTLL---------TYTLGERISWSDDGQLLAVTTSG---------GSVKIYLS------  194 (1324)
Q Consensus       142 ---~~g~~l~~~~~~~~~i~iwd~~---------~~~~i~~~~~s~~~~~l~~~~~d---------g~i~~~~~------  194 (1324)
                         ||...+++ +-.+|.+.|-.-.         +.-.+..+.|+++|.+|++++.+         +.|.+|..      
T Consensus       224 ~v~pdrP~lav-cy~nGr~QiMR~eND~~Pvv~dtgm~~vgakWnh~G~vLAvcG~~~da~~~~d~n~v~Fysp~G~i~g  302 (1189)
T KOG2041|consen  224 PVPPDRPRLAV-CYANGRMQIMRSENDPEPVVVDTGMKIVGAKWNHNGAVLAVCGNDSDADEPTDSNKVHFYSPYGHIVG  302 (1189)
T ss_pred             cCCCCCCEEEE-EEcCceehhhhhcCCCCCeEEecccEeecceecCCCcEEEEccCcccccCccccceEEEeccchhheE
Confidence               35556666 6666666554322         11345566677777777666532         24555541      


Q ss_pred             --CCC---ceeeecCC---eEEee-------c---------CcceEEEEeeccccCCCCccccee-ccccCCcc-ccccc
Q psy12365        195 --KLP---KLVVANNG---KIAIL-------S---------SLNQVSVYLRSIERKGTPWTNFII-ETEIEPSW-REYHG  248 (1324)
Q Consensus       195 --~~~---~~~~~~~~---~~~~~-------~---------~~~~v~v~~~~~~~~~~~~~~~~~-~~~~~~~~-~~~~~  248 (1324)
                        +.|   +...+|..   +++..       .         ...+..||.....  ..|.+...+ .|..+..+ +.+.+
T Consensus       303 tlkvpg~~It~lsWEg~gLriA~AvdsfiyfanIRP~ykWgy~e~TvVy~y~~~--e~p~y~i~Fwdtk~nek~vK~V~~  380 (1189)
T KOG2041|consen  303 TLKVPGSCITGLSWEGTGLRIAIAVDSFIYFANIRPEYKWGYIEETVVYVYQKE--ELPQYGIMFWDTKTNEKTVKTVTH  380 (1189)
T ss_pred             EEecCCceeeeeEEcCCceEEEEEecceEEEEeecccceEEEeeeEEEEEEccC--CCcceEEEEEecccChhhhhhhcc
Confidence              111   00111111   11100       0         0111112211111  112211111 11111111 12222


Q ss_pred             e-EEeecCceeeccccc-c------------eeeeeeee-cccCCCCcceeeecccCcceeeecCceeEeeecCeEEEEE
Q psy12365        249 L-VVANNGKIAILSSLN-Q------------VSVYLRSI-ERKGTPWTNFIIETEIEPSFLNMGPCHVAVGMNNRVWVYG  313 (1324)
Q Consensus       249 ~-~~~~~~~~~~~~~~~-~------------~~v~~~~~-~~~~~~~~~~~i~~~~~~~~~~~~~~~~a~~~~~~i~~~~  313 (1324)
                      . ..+..+..|++-... .            ..++.... +.-+++  .-.-..++.|.|+.++..++++++..+.++|.
T Consensus       381 ~~~~a~~~ehCvL~~~~d~~~i~e~s~le~~~~~~~l~LCNSIGT~--lD~kytdirP~Fv~vn~~~vviAS~e~~~iWh  458 (1189)
T KOG2041|consen  381 FENMAFYREHCVLINRQDDGVIPEYSTLENRSRVYFLQLCNSIGTS--LDYKYTDIRPKFVCVNGICVVIASEERYFIWH  458 (1189)
T ss_pred             eeehheecccEEEEeccccCCCcchhhhhcccceEEEeeecccCCc--CCCCcceeeeeEEEecceEEEEeccccEEEEE
Confidence            2 123334444432211 0            01111110 111111  00112345688999999999999988888887


Q ss_pred             ccCCCCCCcccccccccccccccccchhhhhhhccccccccccccchhcccCCCccccchhhhcccccccccccccCCCC
Q psy12365        314 LNPSVNNKSHTLVYKPQLLGDKEHLGTITSLLLNANYSSALVNSRIQLHYLGDNQKTIPDAFIKNRNYFAHTLVYKPQLL  393 (1324)
Q Consensus       314 ~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~  393 (1324)
                      ...+..++  ++.                             +                 ..++....|..+....    
T Consensus       459 y~~pK~~s--~l~-----------------------------~-----------------~k~rkegr~h~Ddtp~----  486 (1189)
T KOG2041|consen  459 YVLPKFNS--VLA-----------------------------G-----------------VKIRKEGRFHGDDTPE----  486 (1189)
T ss_pred             Eeccchhh--hhh-----------------------------h-----------------hhhcccccccCCCCcc----
Confidence            66543200  000                             0                 0000000111000000    


Q ss_pred             CCcccccccceeecccceeeeeeCCeEEEEEecCCCCCCCccccccccccccCCCCCcceeEEecCcceEEEEEecCcEE
Q psy12365        394 GDKEYLGTITSLLLNANYSSALVNSRIQLHYLGDNQKTIPDAFVDKESKLFPESGEKYTIMTQAMSEEFLFFATSEYELK  473 (1324)
Q Consensus       394 ~~~~~~~~i~~~~~~~~~~~~~~~~~~~l~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~i~~~~~~li~~~~~g~i~  473 (1324)
                            +.-              ++.     ++.+.            +  ...+.+++||++++++.+|++++.+|.|.
T Consensus       487 ------ga~--------------d~~-----l~ys~------------k--t~~G~~DpICAl~~sdk~l~vareSG~I~  527 (1189)
T KOG2041|consen  487 ------GAQ--------------DRT-----LEYST------------K--TLLGSKDPICALCISDKFLMVARESGGIY  527 (1189)
T ss_pred             ------chh--------------hce-----eeccc------------e--eeccCCCcceeeeecceEEEEEeccCceE
Confidence                  000              000     00000            0  11245688999999999999999999999


Q ss_pred             EEEeCCceeeeeecCCCCeeEEeeCCCccEEEEEEeCCCeEEEecCC---CceeccCCCCCCcceEEEec-C-CCCCcEE
Q psy12365        474 IFSLSEWKFVSGYKHSDKIKSIYPDIYGICLVLIEMNNTGFLYHTAM---DYLLPIPEFPPATEEVLWDT-V-PVDRNVF  548 (1324)
Q Consensus       474 ~~~l~~~~~~~~~~~~~~i~~i~~~~~~~~l~~~~~~~~l~~~~~~~---~~~~~~~~~~~~~~~~~w~~-~-~~~~~l~  548 (1324)
                      .|++++..+...+..+.++.++.+|+++++++++|-.|.+.++++.-   +..+..  +....+..+|+. | .+++++|
T Consensus       528 rySl~nv~l~n~y~~n~~~y~~~lNCnstRlAiId~~gv~tf~dLd~d~~g~ql~~--~~~~errDVWd~~Wa~dNp~ll  605 (1189)
T KOG2041|consen  528 RYSLNNVVLTNSYPVNPSIYSIKLNCNSTRLAIIDLVGVVTFQDLDYDFDGDQLKL--IYTSERRDVWDYEWAQDNPNLL  605 (1189)
T ss_pred             EEEecceeeeeccccCchheeEeeccCcchhhhhhhhceeeeeecccccCcceeee--eehhhhhhhhhhhhccCCchHH
Confidence            99999999999999999999999999999999999999999998762   222221  234556777776 3 6899999


Q ss_pred             EEEeCCeEEEEEEccccccCCeeEEeeceecCCCCcceEeeCCEEEEEecCCceeEEEecccccccCCC--------Cch
Q psy12365        549 VCCSKTSVVTYLFMPNYYEGPKIELVGATTIQSGQSPVLLTKGLLTLVTSSNKPLDLTLETHKTTMHNP--------KQT  620 (1324)
Q Consensus       549 v~~~~~~i~v~~~~~~~i~~~~~~~~~~~~~~~~~~p~~~~~g~~~~~~~~g~~~~~~l~~~~~~~~~~--------~~~  620 (1324)
                      +.++++++|||+       |..         |++  |+ .++|++ |.+++..++++.+|..-..+..|        ..+
T Consensus       606 AlmeKtrmyifr-------gnd---------peE--p~-s~sGyI-c~FedLeitsVlld~Il~~pE~pnk~~ii~~~ik  665 (1189)
T KOG2041|consen  606 ALMEKTRMYIFR-------GND---------PEE--PS-SVSGYI-CLFEDLEITSVLLDKILLTPENPNKTCIIEVMIK  665 (1189)
T ss_pred             hhhhhceEEEec-------CcC---------ccc--cc-cccceE-EEeeceEEEEEEHhhHhcCcCCCCcceEEEEEeh
Confidence            999999999999       665         333  66 388998 79999999999999765554433        356


Q ss_pred             HHHHHHHHHHhhcHHHHHHHHHhhCCHHHHHHHHHHHHhcCCHHHHHHHHHHccchhHHHHHHHhhhcccchhhHHHHHH
Q psy12365        621 LDISLHKVLKLLNWKEAWNICAVLNQSETWRSFAEACLQNLEFSWAIRAYQSLDEAGMVWCLESLVEEEEDTSILCGHVA  700 (1324)
Q Consensus       621 ~~~~~~~~l~~~~~~~A~~~~~~~~~~~~~~~l~~~~l~~~~~~~A~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~a~~~  700 (1324)
                      .+++...+++.-.+++|.++++..|++++|+++|+.++...+++.|+.+|.+++++.++.+++++.. +.......|++.
T Consensus       666 slrD~~~Lve~vgledA~qfiEdnPHprLWrllAe~Al~Kl~l~tAE~AFVrc~dY~Gik~vkrl~~-i~s~~~q~aei~  744 (1189)
T KOG2041|consen  666 SLRDVMNLVEAVGLEDAIQFIEDNPHPRLWRLLAEYALFKLALDTAEHAFVRCGDYAGIKLVKRLRT-IHSKEQQRAEIS  744 (1189)
T ss_pred             hhhhHHHHHHHhchHHHHHHHhcCCchHHHHHHHHHHHHHHhhhhHhhhhhhhccccchhHHHHhhh-hhhHHHHhHhHh
Confidence            7889999999999999999999999999999999999999999999999999999999999999999 988899999999


Q ss_pred             HHcCCHHHHHHHHHhCCChHHHHHHHHHHhhHHHHHHHHHhcCC----CCchHHHHHHHHHHHHcCCHHHHHHHHHHhcc
Q psy12365        701 ALLGNHDTAQQRYLTSDIPTMALTLRRDLRQWREALALATSLGS----NQTPIISCDYAQQLEMTGQHAQALSFYQKSME  776 (1324)
Q Consensus       701 ~~~g~~~~A~~~~~~~~~~~~a~~~~~~~~~~~~Al~~~~~~~~----~~~~~~~~~~~~~~~~~g~~~~A~~~y~~al~  776 (1324)
                      .+.|+|++|+++|..+.+.+.|+++|.++|+|.+.+++.+....    .....+++++|......-.+++|.++|.+...
T Consensus       745 ~~~g~feeaek~yld~drrDLAielr~klgDwfrV~qL~r~g~~d~dD~~~e~A~r~ig~~fa~~~~We~A~~yY~~~~~  824 (1189)
T KOG2041|consen  745 AFYGEFEEAEKLYLDADRRDLAIELRKKLGDWFRVYQLIRNGGSDDDDEGKEDAFRNIGETFAEMMEWEEAAKYYSYCGD  824 (1189)
T ss_pred             hhhcchhHhhhhhhccchhhhhHHHHHhhhhHHHHHHHHHccCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccc
Confidence            99999999999999999999999999999999999999998433    33458889999999999999999999999754


Q ss_pred             cCCCCCCChhhHHhhhchHHHHHHhcCCHHHHHHHHHhcCC-hHHHHHHHHHHHHccCHHHHHHHHHHhcCHHHHHHHHH
Q psy12365        777 LATPDIQDPECQRKCKEGIARTSIRVGDFRLGIRLAAESNS-SVLKNECADILQQFNKLNDAVTLYESAGNYEKAATCYI  855 (1324)
Q Consensus       777 ~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~~~~-~~~~~~l~~~~~~~g~~~~A~~~y~~~~~~~~~~~~~~  855 (1324)
                      ...               .+.++++..+|++.+.+++.+++ ..++-.+|+++...|..++|.+.|.+.+....++..+.
T Consensus       825 ~e~---------------~~ecly~le~f~~LE~la~~Lpe~s~llp~~a~mf~svGMC~qAV~a~Lr~s~pkaAv~tCv  889 (1189)
T KOG2041|consen  825 TEN---------------QIECLYRLELFGELEVLARTLPEDSELLPVMADMFTSVGMCDQAVEAYLRRSLPKAAVHTCV  889 (1189)
T ss_pred             hHh---------------HHHHHHHHHhhhhHHHHHHhcCcccchHHHHHHHHHhhchHHHHHHHHHhccCcHHHHHHHH
Confidence            433               68999999999999999999988 88999999999999999999999999999999999999


Q ss_pred             HcCCHHHHHhhhhccCCHH---HHHHHHHHHHHcCCHHHHHHHHHHhhChHHHHHHHHhccCCHHHHHHHHHHhcChHHH
Q psy12365        856 QLKNWTKIGQLLPHIKSAT---TFIQYAKAKEAMGSYRESVGAYERAEDYDNVVRVDLDHLNDIRHAVDIVKAKKCTEGA  932 (1324)
Q Consensus       856 ~~~~~~~A~~~~~~~~~~~---~~~~~a~~~~~~g~~~~A~~~y~~a~~~~~a~~~~~~~~~~~~~a~~~~~~~~~~~~~  932 (1324)
                      .+++|.+|.+++++..-+.   +...+|..+...++.-+|++.+++||..-.|.+++.+.. +.+               
T Consensus       890 ~LnQW~~avelaq~~~l~qv~tliak~aaqll~~~~~~eaIe~~Rka~~~~daarll~qma-e~e---------------  953 (1189)
T KOG2041|consen  890 ELNQWGEAVELAQRFQLPQVQTLIAKQAAQLLADANHMEAIEKDRKAGRHLDAARLLSQMA-ERE---------------  953 (1189)
T ss_pred             HHHHHHHHHHHHHhccchhHHHHHHHHHHHHHhhcchHHHHHHhhhcccchhHHHHHHHHh-HHH---------------
Confidence            9999999999999988444   444567777889999999999999998777777766421 111               


Q ss_pred             HHHHHHHHHcCCHHHHHHHHHHcCCHHHHHHHHHhccchhHhhhhccCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHh
Q psy12365        933 KRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFLLEEDEPNPVELKRLAIHFEEDKDMFRAAQYYYHA 1012 (1324)
Q Consensus       933 ~~la~~~~~~g~~~~Ai~~~~~~~~~~~A~~l~~~~~~~~~~~~~l~l~~~~~~~~~~~la~~~~~~g~~~~A~~~y~~~ 1012 (1324)
                            ..+--.|.+..++|..+     |+-                                                .
T Consensus       954 ------~~K~~p~lr~KklYVL~-----AlL------------------------------------------------v  974 (1189)
T KOG2041|consen  954 ------QEKYVPYLRLKKLYVLG-----ALL------------------------------------------------V  974 (1189)
T ss_pred             ------hhccCCHHHHHHHHHHH-----HHH------------------------------------------------H
Confidence                  00111233444444433     110                                                0


Q ss_pred             CCHHHHHHHHHhhcCCCCCcHHHHHHHHhhhhcccCHHHHHHHHHhhccccCCCCCChHHHHHHHHhccCHHHHHHHHHH
Q psy12365       1013 KEYGRAMKLLLVTARQDKDSDENLWLGVSIVSDSHDEKLVETFKTLLEGKLDGVKRNPKFLYRVLMNTGDYVAASSCALD 1092 (1324)
Q Consensus      1013 g~~~~A~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~l~~~y~~~~~~~~A~~~~~~ 1092 (1324)
                      .++.++++-+++.                                                                   
T Consensus       975 E~h~~~ik~~~~~-------------------------------------------------------------------  987 (1189)
T KOG2041|consen  975 ENHRQTIKELRKI-------------------------------------------------------------------  987 (1189)
T ss_pred             HHHHHHHHHhhhh-------------------------------------------------------------------
Confidence            1111122222221                                                                   


Q ss_pred             HHHHHHHhcCHHHHHHHHHHHHHHHHHccCCCcHHHHHHHHHHHHHHHHHHHHHhCChhhHHHHHHHHHhhccCC-Ccch
Q psy12365       1093 VARDEAARGSYRNCHETLYSTIQELKKHKLQVGNDLMAGLMIIHSYLLARYHVRNANHSLAAPLLIRVAENISFF-PLHA 1171 (1324)
Q Consensus      1093 ~a~~~~~~g~~~~a~~~l~~~~~~~~~~~~~~~~~~~~~l~~~~~y~l~~~~~~~g~~~~A~~~l~~~~~~~~~~-p~~~ 1171 (1324)
                           ...|..++|.++|.+..   .....++.+..|+..+++|+++||+.+...|....|+++.+++.+|.+.+ |.++
T Consensus       988 -----~~~g~~~dat~lles~~---l~~~~ri~~n~WrgAEAyHFmilAQrql~eg~v~~Al~Tal~L~DYEd~lpP~ei 1059 (1189)
T KOG2041|consen  988 -----DKHGFLEDATDLLESGL---LAEQSRILENTWRGAEAYHFMILAQRQLFEGRVKDALQTALILSDYEDFLPPAEI 1059 (1189)
T ss_pred             -----hhcCcchhhhhhhhhhh---hhhHHHHHHhhhhhHHHHHHHHHHHHHHHhchHHHHHHHHhhhccHhhcCCHHHH
Confidence                 11223333333333211   11112345668999999999999999999999999999999999999999 7899


Q ss_pred             hHHHHHHHHHHHHhcChHHHHHHHHHhcChhhhhhccHHHhHHHHHHh----cCCCCCCCCCCCccCCCCCCCCCCcccc
Q psy12365       1172 TSILTSTVIECKKANLQESALKFATLLLRPEYRSNLEDKYRKQIELIV----RKAPRKDIASPEEAHVLPCPYCDTMVPD 1247 (1324)
Q Consensus      1172 ~~~l~~~~~~~~~~~~~~~A~~~~~~l~~~e~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~c~~c~~~~~~ 1247 (1324)
                      +++++.++++-+.+|.+++||      |++|....++.+.+..++.++    .+.+  + .++-.+ ...|..|+.+++.
T Consensus      1060 ySllALaaca~raFGtCSKAf------mkLe~~e~l~~a~kq~ye~La~~iFsk~~--p-~d~~~~-~vdc~~cg~~i~~ 1129 (1189)
T KOG2041|consen 1060 YSLLALAACAVRAFGTCSKAF------MKLEAFEELDDAEKQEYENLAFRIFSKNP--P-VDPNSA-KVDCSVCGAKIDP 1129 (1189)
T ss_pred             HHHHHHHHhhhhhhhhhHHHH------HHHHhhhhCCHHHHHHHHHHHHHHhccCC--C-CCCCcc-ceeeeecCCcCCc
Confidence            999999999999999999998      999888889888887777764    5553  2 222235 6789999999999


Q ss_pred             cccccccccCCCcceeecCccccccCcccCCCCCcccchHHHHHHHhcCCCCCCcccCCC
Q psy12365       1248 MMLHCASCARIIPFCIASGKHITRNELTKCLECNFPAIHRHLVLIVDQEGFCPLCRTDLR 1307 (1324)
Q Consensus      1248 ~~~~c~~c~~~~~~c~~tg~~i~~~~~~~C~~c~~~a~~~~~~~~~~~~~~Cp~C~~~~~ 1307 (1324)
                      ++++|+.|...||.|++||+||+...+|.||.|+|.|..++..    +-.+||+||+++.
T Consensus      1130 ~~~~c~ec~~kfP~CiasG~pIt~~~fWlC~~CkH~a~~~EIs----~y~~CPLCHs~~~ 1185 (1189)
T KOG2041|consen 1130 YDLQCSECQTKFPVCIASGRPITDNIFWLCPRCKHRAHQHEIS----KYNCCPLCHSMES 1185 (1189)
T ss_pred             cCCCChhhcCcCceeeccCCccccceEEEcccccccccccccc----ccccCccccChhh
Confidence            9999999999999999999999999999999999999999966    6679999999764

>KOG3617\|consensus	Back alignment and domain information

>KOG1538\|consensus	Back alignment and domain information

>KOG3616\|consensus	Back alignment and domain information

>KOG0292\|consensus	Back alignment and domain information

>KOG2247\|consensus	Back alignment and domain information

>KOG3617\|consensus	Back alignment and domain information

>KOG0276\|consensus	Back alignment and domain information

>KOG1524\|consensus	Back alignment and domain information

>KOG0318\|consensus	Back alignment and domain information

>KOG0292\|consensus	Back alignment and domain information

>KOG1538\|consensus	Back alignment and domain information

>KOG2041\|consensus	Back alignment and domain information

>KOG0271\|consensus	Back alignment and domain information

>KOG0319\|consensus	Back alignment and domain information

>KOG0318\|consensus	Back alignment and domain information

>KOG0272\|consensus	Back alignment and domain information

>KOG1920\|consensus	Back alignment and domain information

>KOG0286\|consensus	Back alignment and domain information

>KOG0276\|consensus	Back alignment and domain information

>KOG0279\|consensus	Back alignment and domain information

>KOG0272\|consensus	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>KOG0271\|consensus	Back alignment and domain information

>KOG0291\|consensus	Back alignment and domain information

>KOG0273\|consensus	Back alignment and domain information

>KOG0319\|consensus	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>KOG4626\|consensus	Back alignment and domain information

>KOG0291\|consensus	Back alignment and domain information

>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation []	Back alignment and domain information

>KOG0263\|consensus	Back alignment and domain information

>KOG0279\|consensus	Back alignment and domain information

>KOG4626\|consensus	Back alignment and domain information

>KOG0273\|consensus	Back alignment and domain information

>KOG0296\|consensus	Back alignment and domain information

>KOG0315\|consensus	Back alignment and domain information

>KOG0293\|consensus	Back alignment and domain information

>KOG0306\|consensus	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>KOG0284\|consensus	Back alignment and domain information

>KOG0645\|consensus	Back alignment and domain information

>KOG0284\|consensus	Back alignment and domain information

>KOG0645\|consensus	Back alignment and domain information

>KOG0316\|consensus	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>KOG0265\|consensus	Back alignment and domain information

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto

Back alignment and domain information

>KOG0263\|consensus	Back alignment and domain information

>KOG1408\|consensus	Back alignment and domain information

>KOG0282\|consensus	Back alignment and domain information

>KOG2048\|consensus	Back alignment and domain information

>KOG0315\|consensus	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG0306\|consensus	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>KOG0286\|consensus	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>KOG1539\|consensus	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG0973\|consensus	Back alignment and domain information

>KOG0285\|consensus	Back alignment and domain information

>KOG0296\|consensus	Back alignment and domain information

>KOG1539\|consensus	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>KOG0266\|consensus	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>KOG0275\|consensus	Back alignment and domain information

>KOG1524\|consensus	Back alignment and domain information

>KOG0266\|consensus	Back alignment and domain information

>KOG0772\|consensus	Back alignment and domain information

>KOG3616\|consensus	Back alignment and domain information

>KOG0640\|consensus	Back alignment and domain information

>KOG2048\|consensus	Back alignment and domain information

>KOG1408\|consensus	Back alignment and domain information

>KOG0282\|consensus	Back alignment and domain information

>KOG0973\|consensus	Back alignment and domain information

>KOG0293\|consensus	Back alignment and domain information

>KOG1920\|consensus	Back alignment and domain information

>KOG0285\|consensus	Back alignment and domain information

>KOG1274\|consensus	Back alignment and domain information

>KOG1446\|consensus	Back alignment and domain information

>KOG0283\|consensus	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>KOG0643\|consensus	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>KOG0295\|consensus	Back alignment and domain information

>KOG0278\|consensus	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>KOG1063\|consensus	Back alignment and domain information

>KOG0295\|consensus	Back alignment and domain information

>KOG1407\|consensus	Back alignment and domain information

>KOG0294\|consensus	Back alignment and domain information

>KOG1407\|consensus	Back alignment and domain information

>KOG0277\|consensus	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>KOG0643\|consensus	Back alignment and domain information

>KOG0316\|consensus	Back alignment and domain information

>KOG0313\|consensus	Back alignment and domain information

>KOG0265\|consensus	Back alignment and domain information

>COG5290 IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>KOG0288\|consensus	Back alignment and domain information

>KOG0283\|consensus	Back alignment and domain information

>KOG0640\|consensus	Back alignment and domain information

>KOG0647\|consensus	Back alignment and domain information

>KOG0772\|consensus	Back alignment and domain information

>KOG2096\|consensus	Back alignment and domain information

>KOG0305\|consensus	Back alignment and domain information

>KOG0275\|consensus	Back alignment and domain information

>KOG0310\|consensus	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

Back alignment and domain information

>KOG1332\|consensus	Back alignment and domain information

>KOG0310\|consensus	Back alignment and domain information

>KOG0289\|consensus	Back alignment and domain information

>KOG2002\|consensus	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>KOG0305\|consensus	Back alignment and domain information

>KOG0313\|consensus	Back alignment and domain information

>KOG2106\|consensus	Back alignment and domain information

>KOG0278\|consensus	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>KOG2055\|consensus	Back alignment and domain information

>KOG0269\|consensus	Back alignment and domain information

>KOG0281\|consensus	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG0277\|consensus	Back alignment and domain information

>KOG0289\|consensus	Back alignment and domain information

>KOG2247\|consensus	Back alignment and domain information

>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation []	Back alignment and domain information

>KOG4497\|consensus	Back alignment and domain information

>KOG2002\|consensus	Back alignment and domain information

>KOG4283\|consensus	Back alignment and domain information

>KOG1445\|consensus	Back alignment and domain information

>KOG0264\|consensus	Back alignment and domain information

>KOG1840\|consensus	Back alignment and domain information

>KOG0268\|consensus	Back alignment and domain information

>KOG0646\|consensus	Back alignment and domain information

>KOG0641\|consensus	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG0281\|consensus	Back alignment and domain information

>KOG2106\|consensus	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG0299\|consensus	Back alignment and domain information

>KOG0267\|consensus	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>KOG0294\|consensus	Back alignment and domain information

>KOG0274\|consensus	Back alignment and domain information

>KOG0639\|consensus	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>KOG1273\|consensus	Back alignment and domain information

>KOG1274\|consensus	Back alignment and domain information

>KOG1332\|consensus	Back alignment and domain information

>KOG0264\|consensus	Back alignment and domain information

>KOG4283\|consensus	Back alignment and domain information

>KOG0302\|consensus	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>KOG1273\|consensus	Back alignment and domain information

>KOG0299\|consensus	Back alignment and domain information

>KOG1446\|consensus	Back alignment and domain information

>KOG0307\|consensus	Back alignment and domain information

>KOG2076\|consensus	Back alignment and domain information

>KOG0303\|consensus	Back alignment and domain information

>KOG0288\|consensus	Back alignment and domain information

>KOG0302\|consensus	Back alignment and domain information

>KOG1036\|consensus	Back alignment and domain information

>KOG1036\|consensus	Back alignment and domain information

>KOG1840\|consensus	Back alignment and domain information

>KOG0300\|consensus	Back alignment and domain information

>KOG0308\|consensus	Back alignment and domain information

>KOG0641\|consensus	Back alignment and domain information

>KOG0301\|consensus	Back alignment and domain information

>KOG0308\|consensus	Back alignment and domain information

>KOG0269\|consensus	Back alignment and domain information

>KOG1009\|consensus	Back alignment and domain information

>KOG1009\|consensus	Back alignment and domain information

>KOG0267\|consensus	Back alignment and domain information

>KOG0274\|consensus	Back alignment and domain information

>KOG0647\|consensus	Back alignment and domain information

>KOG2055\|consensus	Back alignment and domain information

>KOG2445\|consensus	Back alignment and domain information

>KOG0270\|consensus	Back alignment and domain information

>KOG0650\|consensus	Back alignment and domain information

>KOG1126\|consensus	Back alignment and domain information

>KOG2003\|consensus	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG2096\|consensus	Back alignment and domain information

>KOG0646\|consensus	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>KOG0639\|consensus	Back alignment and domain information

>KOG0300\|consensus	Back alignment and domain information

>KOG1126\|consensus	Back alignment and domain information

>KOG1523\|consensus	Back alignment and domain information

>KOG1155\|consensus	Back alignment and domain information

>KOG4328\|consensus	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0771\|consensus	Back alignment and domain information

>KOG2919\|consensus	Back alignment and domain information

>KOG2076\|consensus	Back alignment and domain information

>KOG0642\|consensus	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1034\|consensus	Back alignment and domain information

>KOG1063\|consensus	Back alignment and domain information

>KOG0321\|consensus	Back alignment and domain information

>KOG1034\|consensus	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2445\|consensus	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>KOG2003\|consensus	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>KOG0307\|consensus	Back alignment and domain information

>KOG0547\|consensus	Back alignment and domain information

>KOG0270\|consensus	Back alignment and domain information

>KOG0268\|consensus	Back alignment and domain information

>KOG0301\|consensus	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>KOG2139\|consensus	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>KOG1445\|consensus	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG4378\|consensus	Back alignment and domain information

>KOG1155\|consensus	Back alignment and domain information

>KOG2139\|consensus	Back alignment and domain information

>KOG2919\|consensus	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>KOG4378\|consensus	Back alignment and domain information

>KOG1188\|consensus	Back alignment and domain information

>KOG1173\|consensus	Back alignment and domain information

>KOG0290\|consensus	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2110\|consensus	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>KOG1007\|consensus	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG4328\|consensus	Back alignment and domain information

>KOG0548\|consensus	Back alignment and domain information

>KOG0985\|consensus	Back alignment and domain information

>KOG2066\|consensus	Back alignment and domain information

>KOG1963\|consensus	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>KOG0547\|consensus	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2111\|consensus	Back alignment and domain information

>KOG1007\|consensus	Back alignment and domain information

>KOG2114\|consensus	Back alignment and domain information

>KOG2110\|consensus	Back alignment and domain information

>KOG2047\|consensus	Back alignment and domain information

>KOG0303\|consensus	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0650\|consensus	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>KOG1129\|consensus	Back alignment and domain information

>KOG3785\|consensus	Back alignment and domain information

>KOG0985\|consensus	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>KOG0624\|consensus	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0290\|consensus	Back alignment and domain information

>KOG4497\|consensus	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0321\|consensus	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>KOG1523\|consensus	Back alignment and domain information

>KOG1129\|consensus	Back alignment and domain information

>KOG1174\|consensus	Back alignment and domain information

>KOG1963\|consensus	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1130\|consensus	Back alignment and domain information

>KOG1587\|consensus	Back alignment and domain information

>KOG1310\|consensus	Back alignment and domain information

>KOG2114\|consensus	Back alignment and domain information

>KOG1130\|consensus	Back alignment and domain information

>KOG4227\|consensus	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>KOG2394\|consensus	Back alignment and domain information

>KOG1173\|consensus	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2315\|consensus	Back alignment and domain information

>KOG1240\|consensus	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>KOG0322\|consensus	Back alignment and domain information

>KOG3785\|consensus	Back alignment and domain information

>KOG0548\|consensus	Back alignment and domain information

>KOG0495\|consensus	Back alignment and domain information

>KOG4162\|consensus	Back alignment and domain information

>KOG2376\|consensus	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>KOG1272\|consensus	Back alignment and domain information

>KOG2376\|consensus	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>KOG1188\|consensus	Back alignment and domain information

>KOG0649\|consensus	Back alignment and domain information

>KOG0771\|consensus	Back alignment and domain information

>KOG0495\|consensus	Back alignment and domain information

>KOG4340\|consensus	Back alignment and domain information

>KOG1174\|consensus	Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>KOG0644\|consensus	Back alignment and domain information

>KOG0624\|consensus	Back alignment and domain information

>KOG1354\|consensus	Back alignment and domain information

>KOG2394\|consensus	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG3881\|consensus	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>KOG2111\|consensus	Back alignment and domain information

>KOG1156\|consensus	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>KOG1912\|consensus	Back alignment and domain information

>KOG0642\|consensus	Back alignment and domain information

>KOG1272\|consensus	Back alignment and domain information

>KOG1517\|consensus	Back alignment and domain information

>COG2319 FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>KOG1127\|consensus	Back alignment and domain information

>KOG1587\|consensus	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>KOG0644\|consensus	Back alignment and domain information

>KOG1125\|consensus	Back alignment and domain information

>KOG0649\|consensus	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>KOG1156\|consensus	Back alignment and domain information

>COG2319 FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>KOG1915\|consensus	Back alignment and domain information

>KOG1912\|consensus	Back alignment and domain information

>KOG1125\|consensus	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2314\|consensus	Back alignment and domain information

>KOG1310\|consensus	Back alignment and domain information

>KOG1240\|consensus	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>KOG0550\|consensus	Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>KOG2047\|consensus	Back alignment and domain information

>KOG1517\|consensus	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG0550\|consensus	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>KOG1127\|consensus	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>KOG0322\|consensus	Back alignment and domain information

>KOG2321\|consensus	Back alignment and domain information

>KOG4227\|consensus	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>KOG2034\|consensus	Back alignment and domain information

>KOG2315\|consensus	Back alignment and domain information

>KOG4162\|consensus	Back alignment and domain information

>KOG2314\|consensus	Back alignment and domain information

>KOG0974\|consensus	Back alignment and domain information

>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>KOG3881\|consensus	Back alignment and domain information

>KOG2321\|consensus	Back alignment and domain information

>KOG1941\|consensus	Back alignment and domain information

>KOG2280\|consensus	Back alignment and domain information

>KOG1064\|consensus	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>KOG4340\|consensus	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>KOG1354\|consensus	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0974\|consensus	Back alignment and domain information

>KOG1915\|consensus	Back alignment and domain information

>PF06957 COPI_C: Coatomer (COPI) alpha subunit C-terminus; InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG1941\|consensus	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal	Back alignment and domain information

>KOG1128\|consensus	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>KOG1334\|consensus	Back alignment and domain information

>KOG4547\|consensus	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>KOG4547\|consensus	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>KOG1409\|consensus	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>COG5290 IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0553\|consensus	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>KOG1409\|consensus	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>KOG1586\|consensus	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal	Back alignment and domain information

>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG1128\|consensus	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>KOG3060\|consensus	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PLN02789 farnesyltranstransferase	Back alignment and domain information

>KOG1586\|consensus	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>KOG3081\|consensus	Back alignment and domain information

>KOG1334\|consensus	Back alignment and domain information

>PLN02789 farnesyltranstransferase	Back alignment and domain information

>KOG4190\|consensus	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>KOG4532\|consensus	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats	Back alignment and domain information

>KOG2066\|consensus	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown]	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>KOG0280\|consensus	Back alignment and domain information

>KOG1585\|consensus	Back alignment and domain information

>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>KOG4532\|consensus	Back alignment and domain information

>KOG0882\|consensus	Back alignment and domain information

>KOG3060\|consensus	Back alignment and domain information

>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats	Back alignment and domain information

>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators []	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>KOG1897\|consensus	Back alignment and domain information

>PRK10866 outer membrane biogenesis protein BamD; Provisional	Back alignment and domain information

>KOG4714\|consensus	Back alignment and domain information

>KOG0882\|consensus	Back alignment and domain information

>KOG0280\|consensus	Back alignment and domain information

>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C

Back alignment and domain information

>KOG3914\|consensus	Back alignment and domain information

>KOG4190\|consensus	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi	Back alignment and domain information

>KOG1070\|consensus	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>KOG1275\|consensus	Back alignment and domain information

>KOG1585\|consensus	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex	Back alignment and domain information

>COG3898 Uncharacterized membrane-bound protein [Function unknown]	Back alignment and domain information

>KOG3914\|consensus	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>KOG0553\|consensus	Back alignment and domain information

>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>KOG3081\|consensus	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>PF12773 DZR: Double zinc ribbon	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>KOG1064\|consensus	Back alignment and domain information

>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown]	Back alignment and domain information

>KOG1645\|consensus	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>PRK10866 outer membrane biogenesis protein BamD; Provisional	Back alignment and domain information

>KOG4640\|consensus	Back alignment and domain information

Back alignment and domain information

>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>PRK13616 lipoprotein LpqB; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		1324
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-13
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-08
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	4e-07
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	2e-04
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	7e-04
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	1e-06
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	5e-06
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	7e-05
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	3e-05
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	4e-05
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	3e-05
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	4e-05
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	4e-05
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	3e-04
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	8e-05
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	9e-05
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	5e-04
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	2e-04
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	3e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 73.3 bits (179), Expect = 4e-13
 Identities = 86/601 (14%), Positives = 177/601 (29%), Gaps = 165/601 (27%)

Query: 702  LLGNHDTAQQRYLTSDIPTMALTLRRDLRQWREALALATSLGSNQTPIISCDYAQQLEMT 761
            LL   +   Q+++          LR +  ++   L         Q  +++  Y +Q +  
Sbjct: 71   LLSKQEEMVQKFVEE-------VLRINY-KF---LMSPIKTEQRQPSMMTRMYIEQRDRL 119

Query: 762  GQHAQALSFYQKSMELATPDIQDPECQRKCKEGIARTSIRVGDFRLGIR---------LA 812
                Q  + Y          +   +   K ++ +    +R     + I          +A
Sbjct: 120  YNDNQVFAKYN---------VSRLQPYLKLRQAL--LELRPAKN-VLIDGVLGSGKTWVA 167

Query: 813  AESNSSVLKNECADILQQFNKLNDAVTLYESAGNYEKAATCYIQLKNWTKIGQLLPHIKS 872
             +    V  +    +  + +     +  + +  N     T    L+       LL  I  
Sbjct: 168  LD----VCLSY--KVQCKMD---FKI-FWLNLKNCNSPETVLEMLQK------LLYQIDP 211

Query: 873  ATTFIQYAKAKEAMGSYR---ESVGAYER----AEDYDNVVRVDLDHLNDIRH--AVDIV 923
                  +    +   + +    S+ A  R    ++ Y+N + V L ++ + +   A ++ 
Sbjct: 212  -----NWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLV-LLNVQNAKAWNAFNL- 264

Query: 924  KAKKC----TEGAKRIADYCNKHGDFGAAIHFLILSKCYQDAFNLSQQHKKLHEFGKFL- 978
                C    T   K++ D+        AA    I    +       +  K L    K+L 
Sbjct: 265  ---SCKILLTTRFKQVTDF------LSAATTTHISLDHHSMTLTPDEV-KSL--LLKYLD 312

Query: 979  -LEEDEP------NPVELKRLAIHFEEDKDMFRAAQYY--YHAKEYGRAMKLLL-----V 1024
               +D P      NP  L  +A   E  +D       +   +  +    ++  L      
Sbjct: 313  CRPQDLPREVLTTNPRRLSIIA---ESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPA 369

Query: 1025 TARQ--------DKDSD------ENLWLGVSIVSDSHDEKLVETF--KTLLEGKLDGVKR 1068
              R+           +         +W  V     S    +V      +L+E      K+
Sbjct: 370  EYRKMFDRLSVFPPSAHIPTILLSLIWFDVI---KSDVMVVVNKLHKYSLVE------KQ 420

Query: 1069 NPKFLYRVLMNTGDYVAASSCALDVARDEAARGSYRNCHETL---YSTIQELKKHKLQV- 1124
              +    +           S  L++             H ++   Y+  +      L   
Sbjct: 421  PKESTISIP----------SIYLELKVKLENE---YALHRSIVDHYNIPKTFDSDDLIPP 467

Query: 1125 GNDLMAGLMIIHSYLLARYHVRNANHSLAAPLLIRVAENISFFPLHATSILTSTVIECKK 1184
              D        +S++   +H++N  H     L   V  +  F  L       ST      
Sbjct: 468  YLD-----QYFYSHIG--HHLKNIEHPERMTLFRMVFLDFRF--LEQKIRHDSTAWNASG 518

Query: 1185 ANLQESALKFATLLLRPEYRSNLED---KYRKQIELIVRKAPRKDIASPEEAHVLPCPYC 1241
            + L        TL     Y+  + D   KY + +  I+   P+       E +++   Y 
Sbjct: 519  SIL-------NTLQQLKFYKPYICDNDPKYERLVNAILDFLPKI------EENLICSKYT 565

Query: 1242 D 1242
            D
Sbjct: 566  D 566

PyMOL of 1vt4

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Length = 1630	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		1324
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	100.0
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	100.0
2ymu_A		577	WD-40 repeat protein; unknown function, two domain	99.98
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	99.97
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	99.97
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	99.96
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	99.96
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	99.95
3ow8_A		321	WD repeat-containing protein 61; structural genomi	99.95
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	99.95
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	99.94
2ymu_A		577	WD-40 repeat protein; unknown function, two domain	99.94
2oaj_A		902	Protein SNI1; WD40 repeat, beta propeller, endocyt	99.94
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	99.94
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	99.94
3frx_A		319	Guanine nucleotide-binding protein subunit beta- l	99.93
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	99.93
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	99.93
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	99.93
2xzm_R		343	RACK1; ribosome, translation; 3.93A {Tetrahymena t	99.92
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	99.92
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	99.92
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	99.92
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	99.92
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	99.92
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	99.91
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	99.91
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	99.91
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	99.9
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	99.9
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	99.9
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	99.9
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	99.9
2oaj_A		902	Protein SNI1; WD40 repeat, beta propeller, endocyt	99.9
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	99.9
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	99.9
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	99.9
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	99.89
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	99.89
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	99.89
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	99.89
3ow8_A		321	WD repeat-containing protein 61; structural genomi	99.89
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	99.89
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	99.89
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	99.88
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	99.88
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	99.88
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	99.88
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	99.88
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	99.88
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	99.88
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	99.87
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	99.87
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	99.87
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	99.87
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	99.86
3dw8_B		447	Serine/threonine-protein phosphatase 2A 55 kDa RE	99.86
4h5i_A		365	Guanine nucleotide-exchange factor SEC12; copii ve	99.86
2pm7_B		297	Protein transport protein SEC13, protein transport	99.86
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	99.86
3frx_A		319	Guanine nucleotide-binding protein subunit beta- l	99.86
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	99.86
3gre_A		437	Serine/threonine-protein kinase VPS15; seven-blade	99.86
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	99.86
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	99.86
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	99.86
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	99.85
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	99.85
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	99.85
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	99.85
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	99.85
2xzm_R		343	RACK1; ribosome, translation; 3.93A {Tetrahymena t	99.85
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	99.85
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	99.84
2j04_A		588	TAU60, YPL007P, hypothetical protein YPL007C; beta	99.84
4ggc_A		318	P55CDC, cell division cycle protein 20 homolog; ce	99.84
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	99.84
3f3f_A		351	Nucleoporin SEH1; structural protein, protein comp	99.84
2pm7_B		297	Protein transport protein SEC13, protein transport	99.83
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	99.83
4h5i_A		365	Guanine nucleotide-exchange factor SEC12; copii ve	99.83
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	99.83
3gre_A		437	Serine/threonine-protein kinase VPS15; seven-blade	99.82
2j04_B		524	YDR362CP, TAU91; beta propeller, type 2 promoters,	99.82
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	99.82
3jrp_A		379	Fusion protein of protein transport protein SEC13	99.82
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	99.81
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	99.81
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	99.81
2j04_A		588	TAU60, YPL007P, hypothetical protein YPL007C; beta	99.81
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	99.8
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	99.8
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	99.8
2gw1_A		514	Mitochondrial precursor proteins import receptor;	99.8
3dw8_B		447	Serine/threonine-protein phosphatase 2A 55 kDa RE	99.79
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	99.79
3jrp_A		379	Fusion protein of protein transport protein SEC13	99.79
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	99.79
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	99.79
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	99.79
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	99.79
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	99.78
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	99.78
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	99.78
2j04_B		524	YDR362CP, TAU91; beta propeller, type 2 promoters,	99.78
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	99.78
3jro_A		753	Fusion protein of protein transport protein SEC13	99.77
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	99.77
2w18_A		356	PALB2, fancn, partner and localizer of BRCA2; fanc	99.77
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	99.77
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	99.77
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	99.77
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	99.76
1b89_A		449	Protein (clathrin heavy chain); triskelion, coated	99.76
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	99.76
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	99.76
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	99.75
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	99.75
3f3f_A		351	Nucleoporin SEH1; structural protein, protein comp	99.75
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	99.75
4ggc_A		318	P55CDC, cell division cycle protein 20 homolog; ce	99.75
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	99.75
3vu4_A		355	KMHSV2; beta-propeller fold, protein transport; 2.	99.74
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	99.74
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	99.73
3jro_A		753	Fusion protein of protein transport protein SEC13	99.73
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	99.73
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	99.73
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	99.73
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	99.73
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	99.73
2xm6_A		490	Protein corresponding to locus C5321 from CFT073 s	99.72
2gw1_A		514	Mitochondrial precursor proteins import receptor;	99.72
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	99.72
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	99.71
4gq1_A		393	NUP37; propeller, transport protein; 2.40A {Schizo	99.71
4gq1_A		393	NUP37; propeller, transport protein; 2.40A {Schizo	99.71
1k32_A		1045	Tricorn protease; protein degradation, substrate g	99.7
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	99.7
2xm6_A		490	Protein corresponding to locus C5321 from CFT073 s	99.7
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	99.69
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	99.69
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	99.69
3vu4_A		355	KMHSV2; beta-propeller fold, protein transport; 2.	99.69
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	99.69
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	99.68
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	99.68
1b89_A		449	Protein (clathrin heavy chain); triskelion, coated	99.67
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	99.65
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	99.63
4g1t_A		472	Interferon-induced protein with tetratricopeptide	99.61
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	99.61
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	99.61
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	99.6
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	99.6
1k32_A		1045	Tricorn protease; protein degradation, substrate g	99.6
2w18_A		356	PALB2, fancn, partner and localizer of BRCA2; fanc	99.59
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	99.59
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	99.59
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	99.58
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	99.58
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	99.56
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	99.56
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	99.56
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	99.55
4g1t_A		472	Interferon-induced protein with tetratricopeptide	99.55
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	99.55
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	99.54
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	99.53
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	99.53
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	99.52
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	99.51
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	99.5
2oit_A		434	Nucleoporin 214KDA; NH2 terminal domain of NUP214/	99.5
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	99.5
3u4t_A		272	TPR repeat-containing protein; structural genomics	99.49
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	99.48
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	99.48
3e4b_A		452	ALGK; tetratricopeptide repeat, superhelix, algina	99.48
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	99.47
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	99.47
3u4t_A		272	TPR repeat-containing protein; structural genomics	99.47
2oit_A		434	Nucleoporin 214KDA; NH2 terminal domain of NUP214/	99.47
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	99.47
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	99.47
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	99.46
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	99.46
3e4b_A		452	ALGK; tetratricopeptide repeat, superhelix, algina	99.45
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	99.44
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	99.44
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	99.44
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	99.43
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	99.42
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	99.42
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	99.42
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	99.41
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	99.41
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	99.4
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	99.38
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	99.38
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	99.37
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	99.37
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	99.36
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	99.34
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	99.34
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	99.34
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	99.33
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	99.32
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	99.32
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	99.31
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	99.31
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	99.31
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	99.3
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	99.3
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	99.29
1jof_A		365	Carboxy-CIS,CIS-muconate cyclase; beta-propeller,	99.29
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	99.29
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	99.28
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	99.26
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	99.26
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	99.26
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	99.26
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	99.25
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	99.24
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	99.24
1jof_A		365	Carboxy-CIS,CIS-muconate cyclase; beta-propeller,	99.23
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	99.23
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	99.23
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	99.23
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	99.23
3mkq_B		177	Coatomer subunit alpha; beta-propeller, alpha-sole	99.23
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	99.22
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	99.22
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	99.21
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	99.21
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	99.19
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	99.18
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	99.16
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	99.16
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	99.15
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	99.14
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	99.14
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	99.13
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	99.11
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	99.1
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	99.09
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	99.08
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	99.05
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	99.05
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	99.05
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	99.04
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	99.04
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	99.04
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	99.03
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	99.03
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	99.03
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	99.02
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	99.0
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	99.0
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	99.0
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	98.99
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	98.98
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	98.98
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	98.98
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	98.95
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	98.94
2oiz_A		361	Aromatic amine dehydrogenase, large subunit; oxido	98.94
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	98.91
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	98.91
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	98.87
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	98.87
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	98.87
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	98.85
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	98.84
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	98.84
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	98.83
2oiz_A		361	Aromatic amine dehydrogenase, large subunit; oxido	98.83
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	98.82
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	98.79
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	98.78
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	98.77
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	98.76
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	98.76
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	98.76
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	98.76
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	98.75
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	98.74
2mad_H		373	Methylamine dehydrogenase (heavy subunit); oxidore	98.73
1xip_A		388	Nucleoporin NUP159; beta-propeller, transport prot	98.72
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	98.72
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	98.72
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	98.72
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	98.71
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	98.71
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	98.71
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	98.7
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	98.7
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	98.69
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	98.68
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	98.68
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	98.66
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	98.66
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	98.66
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	98.66
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	98.66
3lvg_A		624	Clathrin heavy chain 1; SELF assembly, coated PIT,	98.65
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	98.64
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	98.64
4f3v_A		282	ESX-1 secretion system protein ECCA1; tetratricope	98.63
3sjl_D		386	Methylamine dehydrogenase heavy chain; MAUG, C-hem	98.62
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	98.61
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	98.61
3c75_H		426	MADH, methylamine dehydrogenase heavy chain; coppe	98.6
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	98.59
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	98.59
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	98.59
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	98.58
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	98.57
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	98.57
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	98.56
3mv2_A		325	Coatomer subunit alpha; vesicular membrane coat CO	98.56
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	98.55
3sjl_D		386	Methylamine dehydrogenase heavy chain; MAUG, C-hem	98.54
2mad_H		373	Methylamine dehydrogenase (heavy subunit); oxidore	98.54
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	98.52
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	98.51
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	98.5
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	98.49
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	98.49
4f3v_A		282	ESX-1 secretion system protein ECCA1; tetratricope	98.48
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	98.46
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	98.46
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	98.45
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	98.43
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	98.43
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	98.43
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	98.43
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	98.42
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	98.42
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	98.42
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	98.41
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	98.4
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	98.38
3mkr_B		320	Coatomer subunit alpha; tetratricopeptide repeats	98.38
3mkq_B		177	Coatomer subunit alpha; beta-propeller, alpha-sole	98.37
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	98.37
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	98.36
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	98.34
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	98.34
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	98.34
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	98.33
1xip_A		388	Nucleoporin NUP159; beta-propeller, transport prot	98.32
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	98.32
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	98.31
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	98.3
3c75_H		426	MADH, methylamine dehydrogenase heavy chain; coppe	98.3
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	98.3
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	98.29
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	98.29
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	98.27
2qe8_A		343	Uncharacterized protein; structural genomics, join	98.27
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	98.26
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	98.26
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	98.25
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	98.25
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	98.23
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	98.22
3mv2_B		310	Coatomer subunit epsilon; vesicular membrane coat	98.21
3dra_A		306	Protein farnesyltransferase/geranylgeranyltransfer	98.21
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	98.21
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	98.2
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	98.2
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	98.2
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	98.19
3mv2_B		310	Coatomer subunit epsilon; vesicular membrane coat	98.19
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	98.18
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	98.17
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	98.16
3dra_A		306	Protein farnesyltransferase/geranylgeranyltransfer	98.16
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	98.16
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	98.15
4g26_A		501	Pentatricopeptide repeat-containing protein AT2G3	98.15
4g26_A		501	Pentatricopeptide repeat-containing protein AT2G3	98.14
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	98.14
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	98.14
1npe_A		267	Nidogen, entactin; glycoprotein, basement membrane	98.14
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	98.11
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	98.11
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	98.1
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	98.1
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	98.1
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	98.08
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	98.07
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	98.07
2ece_A		462	462AA long hypothetical selenium-binding protein;	98.07
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	98.06
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	98.06
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	98.02
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	98.01
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	98.01
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	98.01
1mda_H		368	Methylamine dehydrogenase (heavy subunit); electro	98.0
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	98.0
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	98.0
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	98.0
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	97.99
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	97.97
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	97.96
1npe_A		267	Nidogen, entactin; glycoprotein, basement membrane	97.95
2qe8_A		343	Uncharacterized protein; structural genomics, join	97.94
3lvg_A		624	Clathrin heavy chain 1; SELF assembly, coated PIT,	97.94
2ece_A		462	462AA long hypothetical selenium-binding protein;	97.94
3qqz_A		255	Putative uncharacterized protein YJIK; MCSG, PSI-2	97.93
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	97.93
4e6h_A		679	MRNA 3'-END-processing protein RNA14; HAT domain,	97.92
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	97.89
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	97.89
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	97.88
3k9i_A		117	BH0479 protein; putative protein binding protein,	97.85
3q7m_A		376	Lipoprotein YFGL, BAMB; beta-propeller, BAM comple	97.85
4e6h_A		679	MRNA 3'-END-processing protein RNA14; HAT domain,	97.84
1fwx_A		595	Nitrous oxide reductase; beta-propeller domain, cu	97.82
2p4o_A		306	Hypothetical protein; putative lactonase, structur	97.76
3q7a_A		349	Farnesyltransferase alpha subunit; protein prenylt	97.76
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	97.75
2l6j_A		111	TPR repeat-containing protein associated with HSP;	97.73
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	97.73
3q7a_A		349	Farnesyltransferase alpha subunit; protein prenylt	97.69
1mda_H		368	Methylamine dehydrogenase (heavy subunit); electro	97.68
3k9i_A		117	BH0479 protein; putative protein binding protein,	97.68
1na3_A		91	Designed protein CTPR2; de novo protein; HET: IPT;	97.68
2l6j_A		111	TPR repeat-containing protein associated with HSP;	97.66
2hz6_A		369	Endoplasmic reticulum to nucleus signalling 1 isof	97.65
1klx_A		138	Cysteine rich protein B; structural genomics, heli	97.64
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	97.63
1fwx_A		595	Nitrous oxide reductase; beta-propeller domain, cu	97.62
1klx_A		138	Cysteine rich protein B; structural genomics, heli	97.59
3ma5_A		100	Tetratricopeptide repeat domain protein; NESG, str	97.59
2fp8_A		322	Strictosidine synthase; six bladed beta propeller	97.55
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	97.54
3v64_C		349	Agrin; beta propeller, laminin-G, signaling, prote	97.51
2xe4_A		751	Oligopeptidase B; hydrolase-inhibitor complex, hyd	97.49
3v65_B		386	Low-density lipoprotein receptor-related protein;	97.48
3v64_C		349	Agrin; beta propeller, laminin-G, signaling, prote	97.47
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	97.47
1ijq_A		316	LDL receptor, low-density lipoprotein receptor; be	97.45
2kat_A		115	Uncharacterized protein; NESG, structure, structur	97.37
3q7m_A		376	Lipoprotein YFGL, BAMB; beta-propeller, BAM comple	97.37
2kat_A		115	Uncharacterized protein; NESG, structure, structur	97.36
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	97.36
1ijq_A		316	LDL receptor, low-density lipoprotein receptor; be	97.33
1na3_A		91	Designed protein CTPR2; de novo protein; HET: IPT;	97.32
3v65_B		386	Low-density lipoprotein receptor-related protein;	97.32
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	97.3
1zu2_A		158	Mitochondrial import receptor subunit TOM20-3; TPR	97.28
2fp8_A		322	Strictosidine synthase; six bladed beta propeller	97.27
1zu2_A		158	Mitochondrial import receptor subunit TOM20-3; TPR	97.27
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	97.25
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	97.11
2kc7_A		99	BFR218_protein; tetratricopeptide repeat, all-alph	97.1
4a2l_A		795	BT_4663, two-component system sensor histidine kin	97.09
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	97.08
4a2l_A		795	BT_4663, two-component system sensor histidine kin	97.08
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	97.07
3ma5_A		100	Tetratricopeptide repeat domain protein; NESG, str	97.06
3sov_A		318	LRP-6, low-density lipoprotein receptor-related pr	97.05
3dss_A		331	Geranylgeranyl transferase type-2 subunit alpha; p	97.04
3dss_A		331	Geranylgeranyl transferase type-2 subunit alpha; p	97.03
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	97.02
3tc9_A		430	Hypothetical hydrolase; 6-bladed beta-propeller, i	97.01
3hxj_A		330	Pyrrolo-quinoline quinone; all beta protein. incom	96.98
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	96.91
2p4o_A		306	Hypothetical protein; putative lactonase, structur	96.88
4hw6_A		433	Hypothetical protein, IPT/TIG domain protein; puta	96.87
3amr_A		355	3-phytase; beta-propeller, phytate, MYO-inositol h	96.8
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	96.8
2p9w_A		334	MAL S 1 allergenic protein; beta propeller; 1.35A	96.77
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	96.71
1kb0_A		677	Quinohemoprotein alcohol dehydrogenase; beta-prope	96.64
2uy1_A		493	Cleavage stimulation factor 77; RNA-binding protei	96.63
3hxj_A		330	Pyrrolo-quinoline quinone; all beta protein. incom	96.62
3ei3_A		1158	DNA damage-binding protein 1; UV-damage, DDB, nucl	96.61
3tc9_A		430	Hypothetical hydrolase; 6-bladed beta-propeller, i	96.59
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	96.52
3v9f_A		781	Two-component system sensor histidine kinase/RESP	96.49
2kc7_A		99	BFR218_protein; tetratricopeptide repeat, all-alph	96.48
3qqz_A		255	Putative uncharacterized protein YJIK; MCSG, PSI-2	96.34
2uy1_A		493	Cleavage stimulation factor 77; RNA-binding protei	96.33
3sov_A		318	LRP-6, low-density lipoprotein receptor-related pr	96.29
2p9w_A		334	MAL S 1 allergenic protein; beta propeller; 1.35A	96.27
3ly7_A		372	Transcriptional activator CADC; alpha/beta domain,	96.22
1yiq_A		689	Quinohemoprotein alcohol dehydrogenase; electron t	96.2
2v5f_A		104	Prolyl 4-hydroxylase subunit alpha-1; endoplasmic	96.19
1kb0_A		677	Quinohemoprotein alcohol dehydrogenase; beta-prope	96.19
3s94_A		619	LRP-6, low-density lipoprotein receptor-related pr	96.16
3v9f_A		781	Two-component system sensor histidine kinase/RESP	96.16
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	96.13
3ffl_A		167	Anaphase-promoting complex subunit 7; tetratricope	96.03
4hw6_A		433	Hypothetical protein, IPT/TIG domain protein; puta	95.96
3ffl_A		167	Anaphase-promoting complex subunit 7; tetratricope	95.96

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

Probab=100.00  E-value=7.7e-38  Score=407.05  Aligned_cols=673  Identities=13%  Similarity=0.092  Sum_probs=431.5

Q ss_pred             ccceecccCCCCCCeeEEEEecCCCCEEEEEeCCCcEEEEEC-CCcEEEEEe-CCCCEEEEEEcCCCCEEEEEEcCCCeE
Q psy12365          2 DKLIFTLEEPHGPGDVYVCWQRRTGELLATTGRDSSVSIYNK-HGKLIDKIT-LPGLCIVMDWDSEGDLLGIISSNSSAV   79 (1324)
Q Consensus         2 ~~~~~~~~~~h~~~i~~~~~sp~~g~~l~~~~~~~~v~v~~~-~~~~~~~~~-~~~~i~~i~~~~d~~~l~~~~~~d~~i   79 (1324)
                      +........+|.+.|.+++||| +|++|++++.+|.|++||. +|+.+..+. |.+.|.+++|+|+|++|++++. ||.|
T Consensus         2 ~l~~~~~~~~h~~~v~~i~~sp-~~~~la~~~~~g~v~iwd~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~~~~~-dg~i   79 (814)
T 3mkq_A            2 KLDIKKTFSNRSDRVKGIDFHP-TEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSD-DFRI   79 (814)
T ss_dssp             CCCCEEEEEEECSCEEEEEECS-SSSEEEEEETTSEEEEEETTTTEEEEEEECCSSCEEEEEEEGGGTEEEEEET-TSEE
T ss_pred             CcccceeeecCCCceEEEEECC-CCCEEEEEeCCCEEEEEECCCCceEEEEecCCCcEEEEEEeCCCCEEEEEeC-CCeE
Confidence            3333334468999999999999 9999999999999999996 677888887 8899999999999999999998 9999


Q ss_pred             EEEEcCCCeEEEEecCCCCCceEEEEecCCCEEEE-----EEEEEeCCC--CeEEEEe-cCCcEEEEEEcC-CCCEEEEE
Q psy12365         80 NVWNTYTKKRTIVDSGLRDPLTCLVWCKQCSMLQL-----SVSIYNKHG--KLIDKIT-LPGLCIVMDWDS-EGDLLGII  150 (1324)
Q Consensus        80 ~iw~~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~~-----~i~v~d~~g--~~~~~~~-~~~~i~~~~~~~-~g~~l~~~  150 (1324)
                      ++||+.+++....+.+|.+.|++++|+|+++.|++     .|++||...  .....+. |.+.|.+++|+| ++..+++ 
T Consensus        80 ~vw~~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~~~~~dg~i~vw~~~~~~~~~~~~~~~~~~v~~~~~~p~~~~~l~~-  158 (814)
T 3mkq_A           80 RVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFAS-  158 (814)
T ss_dssp             EEEETTTCCEEEEEECCSSCEEEEEECSSSSEEEEEETTSEEEEEEGGGTSEEEEEEECCSSCEEEEEEETTEEEEEEE-
T ss_pred             EEEECCCCcEEEEEecCCCCEEEEEEeCCCCEEEEEcCCCEEEEEECCCCceEEEEEcCCCCcEEEEEEEcCCCCEEEE-
Confidence            99999999888888899999999999999999888     899999873  3334443 788999999999 8889999 


Q ss_pred             EcCCCcEEEeecccC-----------CCeeEEEEcC--CCCEEEEEeCCCcEEEEEcCCCceeeecC---Ce--------
Q psy12365        151 SSNSSAVNVWTLLTY-----------TLGERISWSD--DGQLLAVTTSGGSVKIYLSKLPKLVVANN---GK--------  206 (1324)
Q Consensus       151 ~~~~~~i~iwd~~~~-----------~~i~~~~~s~--~~~~l~~~~~dg~i~~~~~~~~~~~~~~~---~~--------  206 (1324)
                      ++.|+.|++||+.+.           ..+..+.|+|  ++.++++++.||.|++|+...........   ..        
T Consensus       159 ~~~dg~v~vwd~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~l~~~~~dg~i~~~d~~~~~~~~~~~~~~~~v~~~~~~~  238 (814)
T 3mkq_A          159 GCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHP  238 (814)
T ss_dssp             EETTSEEEEEETTCSSCSEEEECCCTTCCCEEEECCSTTCCEEEEECTTSEEEEEETTTTEEEEEEECCSSCEEEEEECS
T ss_pred             EeCCCeEEEEECCCCcceeEEecCCCCCEEEEEEEECCCCCEEEEEeCCCEEEEEECCCCcEEEEEcCCCCCEEEEEEcC
Confidence            999999999998621           6789999999  99999999999999999976553322111   11        


Q ss_pred             ----EEeecCcceEEEEeeccccCCCCcccceeccccCCccccccceEEeecCce--eecccccceeeeeeeecccCCCC
Q psy12365        207 ----IAILSSLNQVSVYLRSIERKGTPWTNFIIETEIEPSWREYHGLVVANNGKI--AILSSLNQVSVYLRSIERKGTPW  280 (1324)
Q Consensus       207 ----~~~~~~~~~v~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~v~~~~~~~~~~~~  280 (1324)
                          ++..+.-..+.++ +...  +.+..      .+......+.......++..  +.....+.+.++.....  ... 
T Consensus       239 ~~~~l~~~~~dg~v~vw-d~~~--~~~~~------~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~-  306 (814)
T 3mkq_A          239 TLPIIISGSEDGTLKIW-NSST--YKVEK------TLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLGND--EPT-  306 (814)
T ss_dssp             SSSEEEEEETTSCEEEE-ETTT--CSEEE------EECCSSSSEEEEEECTTCGGGEEEEEETTEEEEEECSCC--SCC-
T ss_pred             CCCEEEEEeCCCeEEEE-ECCC--CcEEE------EeecCCCcEEEEEEccCCCceEEEEEeCCCEEEEEcCCC--Cce-
Confidence                1111111122221 1000  00000      00000000000000112221  11111222222211110  000 


Q ss_pred             cceeeecccCcceeeecCceeEeeec----CeEEEE------EccCCCCCCcccccccccccccccccchhhhhhhcccc
Q psy12365        281 TNFIIETEIEPSFLNMGPCHVAVGMN----NRVWVY------GLNPSVNNKSHTLVYKPQLLGDKEHLGTITSLLLNANY  350 (1324)
Q Consensus       281 ~~~~i~~~~~~~~~~~~~~~~a~~~~----~~i~~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~  350 (1324)
                        .  .+..       ....++.+..    ..+...      .......       ..........+...+.++.++++.
T Consensus       307 --~--~~~~-------~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~spdg  368 (814)
T 3mkq_A          307 --L--SLDP-------VGKLVWSGGKNAAASDIFTAVIRGNEEVEQDEP-------LSLQTKELGSVDVFPQSLAHSPNG  368 (814)
T ss_dssp             --E--EECS-------SSEEEEECCTTSCTTCEEEEECCSCCCCCSSSC-------BCCCCEEECCCSSCCSEEEECTTS
T ss_pred             --e--EECC-------CCCEEEECcccccceeeeeeecccccccccCcc-------ceeeeecCCCCccCCceeEECCCC
Confidence              0  0000       1111111110    011111      1111110       111111122233345555666543


Q ss_pred             ccccccccchhcccCCCccccchhhhcccccccccccccCCCCCCcccccccceeecc--cceeeee-eCCeEEEEEecC
Q psy12365        351 SSALVNSRIQLHYLGDNQKTIPDAFIKNRNYFAHTLVYKPQLLGDKEYLGTITSLLLN--ANYSSAL-VNSRIQLHYLGD  427 (1324)
Q Consensus       351 ~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~--~~~~~~~-~~~~~~l~~i~~  427 (1324)
                      ....+        .+++...+++..                 .......+.+..+..+  +.+.++. .++.+.+|....
T Consensus       369 ~~la~--------~~~~~~~i~~~~-----------------~~~~~~~~~i~~~~~spdg~~la~~~~~g~v~l~~~~~  423 (814)
T 3mkq_A          369 RFVTV--------VGDGEYVIYTAL-----------------AWRNKAFGKCQDFVWGPDSNSYALIDETGQIKYYKNFK  423 (814)
T ss_dssp             SEEEE--------EETTEEEEEETT-----------------TTEEEEEEECSEEEECTTSSCEEEECTTCCEEEEETTE
T ss_pred             CEEEE--------ecCCEEEEEECc-----------------cccccCCCceEEEEEeCCCCeEEEEeCCCcEEEEECCC
Confidence            32211        112222222110                 0011112344444443  3444444 467777774221


Q ss_pred             CCCCCCccccccccccccCCCCCcceeEEecCc-----ceEEEEEecCcEEEEEeCCceeeeeecCCCCeeEEeeCCCcc
Q psy12365        428 NQKTIPDAFVDKESKLFPESGEKYTIMTQAMSE-----EFLFFATSEYELKIFSLSEWKFVSGYKHSDKIKSIYPDIYGI  502 (1324)
Q Consensus       428 ~~~~~~~~~~~~~~~~~~~~~~~~~i~~i~~~~-----~~li~~~~~g~i~~~~l~~~~~~~~~~~~~~i~~i~~~~~~~  502 (1324)
                      +                    +...+.++.+++     ..+++++.+|+|++|++.++..+..+.....  .+.|+|+|+
T Consensus       424 ~--------------------~~~~v~~~~~s~dg~~~~~l~~~~~d~~v~~~d~~~~~~~~~~~~~~~--~v~~s~dg~  481 (814)
T 3mkq_A          424 E--------------------VTSWSVPMHSAIDRLFSGALLGVKSDGFVYFFDWDNGTLVRRIDVNAK--DVIWSDNGE  481 (814)
T ss_dssp             E--------------------CTTCCCCCSSCCCEEECSSSEEEEETTEEEEECTTTCCEEEEESSCEE--EEEECTTSS
T ss_pred             C--------------------ccceEEcCCcCccceecceEEEEecCCEEEEEECCcCcEEEEEecCCC--EEEEcCCCC
Confidence            1                    112234444443     3788889999999999999988888775443  899999999


Q ss_pred             EEEEEE-----eCCCeEEEecCC-------------------CceeccCCCCCCcceEEEecCCCCCcEEEEEe-CCeEE
Q psy12365        503 CLVLIE-----MNNTGFLYHTAM-------------------DYLLPIPEFPPATEEVLWDTVPVDRNVFVCCS-KTSVV  557 (1324)
Q Consensus       503 ~l~~~~-----~~~~l~~~~~~~-------------------~~~~~~~~~~~~~~~~~w~~~~~~~~l~v~~~-~~~i~  557 (1324)
                      +|++.+     ..+.++++....                   +....+.++...+.+..|+     .++++... .+++.
T Consensus       482 ~la~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~s~~w~-----~~~~i~~t~~~~~~  556 (814)
T 3mkq_A          482 LVMIVNTNSNGDEASGYTLLFNKDAYLEAANNGNIDDSEGVDEAFDVLYELSESITSGKWV-----GDVFIFTTATNRLN  556 (814)
T ss_dssp             EEEEEECCCSSCSCSEEEEEECHHHHHHHHHHTCCBTTTBCTTTEEEEEEECSCCSEEEEE-----TTEEEEECTTSEEE
T ss_pred             EEEEEEcCcccCCceEEEEEechHHhhhhhhccCCccccchhhheeeeeEeccEEEeeEEe-----CCEEEEEcCCCeEE
Confidence            999995     334456553321                   1111122223446677886     35666655 45555


Q ss_pred             EEEEccccccCCeeEEeeceecCCCCcceEeeCCEEEEEecCCceeEEEeccccc------------------ccCCC--
Q psy12365        558 TYLFMPNYYEGPKIELVGATTIQSGQSPVLLTKGLLTLVTSSNKPLDLTLETHKT------------------TMHNP--  617 (1324)
Q Consensus       558 v~~~~~~~i~~~~~~~~~~~~~~~~~~p~~~~~g~~~~~~~~g~~~~~~l~~~~~------------------~~~~~--  617 (1324)
                      .+.       +.+...+....-+-.........+.+.+...++++....++....                  +...+  
T Consensus       557 ~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~l~~~d~~~~~~~~~l~~~~~~~~~~~~~~~~~~a~~~~l~~i~~~  629 (814)
T 3mkq_A          557 YFV-------GGKTYNLAHYTKEMYLLGYLARDNKVYLADREVHVYGYEISLEVLEFQTLTLRGEIEEAIENVLPNVEGK  629 (814)
T ss_dssp             EEE-------TTEEEEEEECSSCCEEEEEEGGGTEEEEECTTCCEEEEECCHHHHHHHHHHHTTCHHHHHHHTGGGCCCH
T ss_pred             EEe-------CCeeEEEEECCccEEEEEEEecCCEEEEEcCCCCEEEEEECcHHHHHhHHHHhCCHHHHHHHHHhcCCch
Confidence            543       333222211111000000112445566777888877766643111                  00001  


Q ss_pred             ----------------------CchHHHHHHHHHHhhcHHHHHHHHHhhCCHHHHHHHHHHHHhcCCHHHHHHHHHHccc
Q psy12365        618 ----------------------KQTLDISLHKVLKLLNWKEAWNICAVLNQSETWRSFAEACLQNLEFSWAIRAYQSLDE  675 (1324)
Q Consensus       618 ----------------------~~~~~~~~~~~l~~~~~~~A~~~~~~~~~~~~~~~l~~~~l~~~~~~~A~~~~~~~~~  675 (1324)
                                            .......|..++..|++++|+++++.++++..|..+|+.+++.++++.|++||.++++
T Consensus       630 ~~~~~~~~~l~~~~~~~~a~~~~~~~~~~f~~~l~~~~~~~A~~~~~~~~~~~~W~~la~~al~~~~~~~A~~~y~~~~d  709 (814)
T 3mkq_A          630 DSLTKIARFLEGQEYYEEALNISPDQDQKFELALKVGQLTLARDLLTDESAEMKWRALGDASLQRFNFKLAIEAFTNAHD  709 (814)
T ss_dssp             HHHHHHHHHHHHTTCHHHHHHHCCCHHHHHHHHHHHTCHHHHHHHHTTCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHhCCChHHheecCCCcchheehhhhcCCHHHHHHHHHhhCcHhHHHHHHHHHHHcCCHHHHHHHHHHccC
Confidence                                  0122346778899999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHHhhhcccchhhHHHHHHHHcCCHHHHHHHHHhCCChHHHHHHHHHHhhHHHHHHHHHhcCCCC--chHHHHH
Q psy12365        676 AGMVWCLESLVEEEEDTSILCGHVAALLGNHDTAQQRYLTSDIPTMALTLRRDLRQWREALALATSLGSNQ--TPIISCD  753 (1324)
Q Consensus       676 ~~~~~~l~~~~~~~~~~~~~~a~~~~~~g~~~~A~~~~~~~~~~~~a~~~~~~~~~~~~Al~~~~~~~~~~--~~~~~~~  753 (1324)
                      +..+.++..... ..+....++.++...|+++.|..+|.+.+++++|+++|.+.++|++|+.+++...+..  ++.+...
T Consensus       710 ~~~l~~l~~~~~-~~~~~~~~~~~a~~~~~~~~A~~~~~~~g~~~~a~~~~~~~~~~~~A~~lA~~~~~~~~~i~~~~~~  788 (814)
T 3mkq_A          710 LESLFLLHSSFN-NKEGLVTLAKDAETTGKFNLAFNAYWIAGDIQGAKDLLIKSQRFSEAAFLGSTYGLGDNEVNDIVTK  788 (814)
T ss_dssp             HHHHHHHHHHTT-CHHHHHHHHHHHHHTTCHHHHHHHHHHHTCHHHHHHHHHHTTCHHHHHHHHHHTTCCHHHHHHHHHH
T ss_pred             hhhhHHHHHHcC-CHHHHHHHHHHHHHcCchHHHHHHHHHcCCHHHHHHHHHHcCChHHHHHHHHHhCCChHHHHHHHHH
Confidence            999999999888 7788889999999999999999999999999999999999999999999999999999  9999999


Q ss_pred             HHHHHHHcCCHHHH
Q psy12365        754 YAQQLEMTGQHAQA  767 (1324)
Q Consensus       754 ~~~~~~~~g~~~~A  767 (1324)
                      ++..++..|+++.|
T Consensus       789 ~~~~L~~~~~~~~a  802 (814)
T 3mkq_A          789 WKENLILNGKNTVS  802 (814)
T ss_dssp             HHHHHHTTTCHHHH
T ss_pred             HHHHHHhccchhHH
Confidence            99999999986544

PyMOL of 3mkq

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme}	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme}	Back alignment and structure

>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R*	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens}	Back alignment and structure

>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R*	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae}	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens}	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae}	Back alignment and structure

>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens}	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens}	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli}	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A	Back alignment and structure

>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli}	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens}	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens}	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ...

Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae}	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ...	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ...	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H*	Back alignment and structure

>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C*	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis}	Back alignment and structure

>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ...	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus}	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>3mv2_A Coatomer subunit alpha; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_A	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ...	Back alignment and structure

>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H*	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis}	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>3mkr_B Coatomer subunit alpha; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae}	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C*	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus}	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413}	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B	Back alignment and structure

>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans}	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans}	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A	Back alignment and structure

>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii}	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1	Back alignment and structure

>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A	Back alignment and structure

>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii}	Back alignment and structure

>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli}	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A	Back alignment and structure

>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A	Back alignment and structure

>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A	Back alignment and structure

>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3	Back alignment and structure

>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A*	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A*	Back alignment and structure

>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A	Back alignment and structure

>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens}	Back alignment and structure

>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A	Back alignment and structure

>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A	Back alignment and structure

>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A*	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus}	Back alignment and structure

>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major}	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus}	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1	Back alignment and structure

>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis}	Back alignment and structure

>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A	Back alignment and structure

>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis}	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1	Back alignment and structure

>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1	Back alignment and structure

>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A*	Back alignment and structure

>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis}	Back alignment and structure

>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A*	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A*	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A	Back alignment and structure

>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B	Back alignment and structure

>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A*	Back alignment and structure

>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A*	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis}	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3	Back alignment and structure

>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus}	Back alignment and structure

>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis}	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B	Back alignment and structure

>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis}	Back alignment and structure

>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ...	Back alignment and structure

>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis}	Back alignment and structure

>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli}	Back alignment and structure

>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B	Back alignment and structure

>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B	Back alignment and structure

>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis}	Back alignment and structure

>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A	Back alignment and structure

>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida}	Back alignment and structure

>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A	Back alignment and structure

>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A*	Back alignment and structure

>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens}	Back alignment and structure

>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus}	Back alignment and structure

>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		1324
d1jmxb_		346	b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase	2e-04
d1b89a_		336	a.118.1.3 (A:) Clathrin heavy chain proximal leg s	0.001
d1tbga_		340	b.69.4.1 (A:) beta1-subunit of the signal-transduc	0.004

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346	Back information, alignment and structure


class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: YVTN repeat-like/Quinoprotein amine dehydrogenase
family: Quinohemoprotein amine dehydrogenase B chain
domain: Quinohemoprotein amine dehydrogenase B chain
species: Pseudomonas putida [TaxId: 303]

 Score = 42.4 bits (98), Expect = 2e-04
 Identities = 11/170 (6%), Positives = 42/170 (24%), Gaps = 5/170 (2%)

Query: 26  GELLATTGRDSSVSIYN-KHGKLIDKITLPGLCIV--MDWDSEGDLLGIISSNSSAVNVW 82
            E +  T   +++ + +     +     +P            +     +++++   +   
Sbjct: 8   HEYMIVTNYPNNLHVVDVASDTVYKSCVMPDKFGPGTAMMAPDNRTAYVLNNHYGDIYGI 67

Query: 83  NTYTKK--RTIVDSGLRDPLTCLVWCKQCSMLQLSVSIYNKHGKLIDKITLPGLCIVMDW 140
           +  T K       S +   +   ++    S     V       + ++   +     +  +
Sbjct: 68  DLDTCKNTFHANLSSVPGEVGRSMYSFAISPDGKEVYATVNPTQRLNDHYVVKPPRLEVF 127

Query: 141 DSEGDLLGIISSNSSAVNVWTLLTYTLGERISWSDDGQLLAVTTSGGSVK 190
            +   L               L+       +  +          +G    
Sbjct: 128 STADGLEAKPVRTFPMPRQVYLMRAADDGSLYVAGPDIYKMDVKTGKYTV 177

PyMOL of d1jmxb_

>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Length = 336	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		1324
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	99.93
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	99.91
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	99.91
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	99.88
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	99.88
d1tbga_		340	beta1-subunit of the signal-transducing G protein	99.88
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	99.88
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	99.87
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	99.86
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	99.85
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	99.84
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	99.84
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	99.82
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	99.81
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	99.81
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	99.8
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	99.79
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	99.79
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	99.77
d1tbga_		340	beta1-subunit of the signal-transducing G protein	99.76
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	99.74
d1yfqa_		342	Cell cycle arrest protein BUB3 {Baker's yeast (Sac	99.71
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	99.71
d1pgua2		287	Actin interacting protein 1 {Baker's yeast (Saccha	99.69
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	99.67
d1p22a2		293	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	99.63
d1sq9a_		393	Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac	99.62
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.62
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	99.61
d1sq9a_		393	Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac	99.61
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	99.58
d1hzua2		426	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.56
d1yfqa_		342	Cell cycle arrest protein BUB3 {Baker's yeast (Sac	99.55
d1p22a2		293	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	99.55
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	99.53
d1pgua2		287	Actin interacting protein 1 {Baker's yeast (Saccha	99.52
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	99.5
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	99.48
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	99.47
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	99.47
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	99.39
d1hzua2		426	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.38
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	99.33
d2madh_		373	Methylamine dehydrogenase, H-chain {Gram negative	99.32
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	99.31
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	99.3
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.28
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	99.18
d2bbkh_		355	Methylamine dehydrogenase, H-chain {Paracoccus den	99.15
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	99.11
d2bgra1		470	Dipeptidyl peptidase IV/CD26, N-terminal domain {P	99.0
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	98.98
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	98.97
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	98.94
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	98.93
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	98.92
d2bbkh_		355	Methylamine dehydrogenase, H-chain {Paracoccus den	98.9
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	98.89
d2madh_		373	Methylamine dehydrogenase, H-chain {Gram negative	98.85
d1dcea1		334	Rab geranylgeranyltransferase alpha-subunit, N-ter	98.85
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	98.81
d2hqsa1		269	TolB, C-terminal domain {Escherichia coli [TaxId:	98.74
d1mdah_		368	Methylamine dehydrogenase, H-chain {Paracoccus den	98.73
d1dcea1		334	Rab geranylgeranyltransferase alpha-subunit, N-ter	98.73
d2bgra1		470	Dipeptidyl peptidase IV/CD26, N-terminal domain {P	98.59
d1ouva_		265	Cysteine rich protein C (HcpC) {Helicobacter pylor	98.58
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	98.54
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	98.53
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	98.53
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	98.48
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	98.48
d1mdah_		368	Methylamine dehydrogenase, H-chain {Paracoccus den	98.47
d1qnia2		441	Nitrous oxide reductase, N-terminal domain {Pseudo	98.47
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	98.46
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	98.45
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	98.41
d1ya0a1		497	SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	98.41
d1qnia2		441	Nitrous oxide reductase, N-terminal domain {Pseudo	98.39
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	98.38
d1k32a2		281	Tricorn protease N-terminal domain {Archaeon Therm	98.37
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	98.31
d1jofa_		365	3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu	98.3
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	98.28
d1b89a_		336	Clathrin heavy chain proximal leg segment {Cow (Bo	98.24
d1ouva_		265	Cysteine rich protein C (HcpC) {Helicobacter pylor	98.24
d1ya0a1		497	SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	98.21
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	98.2
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	98.19
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	98.19
d2onda1		308	Cleavage stimulation factor 77 kDa subunit CSTF3 {	98.18
d2hqsa1		269	TolB, C-terminal domain {Escherichia coli [TaxId:	98.18
d1jofa_		365	3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu	98.18
d1b89a_		336	Clathrin heavy chain proximal leg segment {Cow (Bo	98.16
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	98.15
d1rwia_		260	Serine/threonine-protein kinase PknD {Mycobacteriu	98.14
d1rwia_		260	Serine/threonine-protein kinase PknD {Mycobacteriu	98.13
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	98.13
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	98.11
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	98.1
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	98.1
d1xfda1		465	Dipeptidyl aminopeptidase-like protein 6, DPP6, N-	98.08
d2onda1		308	Cleavage stimulation factor 77 kDa subunit CSTF3 {	98.06
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	98.04
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	97.98
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	97.98
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	97.97
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	97.96
d1xfda1		465	Dipeptidyl aminopeptidase-like protein 6, DPP6, N-	97.95
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	97.93
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	97.93
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	97.91
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	97.87
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	97.8
d1tjca_		95	Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human	97.79
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	97.79
d1tjca_		95	Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human	97.74
d1zu2a1		145	Mitochondrial import receptor subunit tom20-3 {Tha	97.48
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	97.47
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	97.32
d1k32a2		281	Tricorn protease N-terminal domain {Archaeon Therm	97.3
d1zu2a1		145	Mitochondrial import receptor subunit tom20-3 {Tha	97.28
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	97.18
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	97.08
d1zbpa1		264	Hypothetical protein VPA1032 {Vibrio parahaemolyti	97.07
d1zbpa1		264	Hypothetical protein VPA1032 {Vibrio parahaemolyti	97.06
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	96.99
d1qsaa1		450	70 KDa soluble lytic transglycosylase (SLT70), sup	96.64
d1npea_		263	Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	96.54
d1klxa_		133	Cysteine rich protein B (HcpB) {Helicobacter pylor	96.2
d1qsaa1		450	70 KDa soluble lytic transglycosylase (SLT70), sup	96.12
d1klxa_		133	Cysteine rich protein B (HcpB) {Helicobacter pylor	96.09
d1fwxa2		459	Nitrous oxide reductase, N-terminal domain {Paraco	95.66
d1npea_		263	Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	95.59
d1ijqa1		266	Low density lipoprotein (LDL) receptor {Human (Hom	95.53
d1utca2		327	Clathrin heavy-chain terminal domain {Rat (Rattus	95.28
d1ijqa1		266	Low density lipoprotein (LDL) receptor {Human (Hom	94.72
d2baya1		56	Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac	94.61
d1fwxa2		459	Nitrous oxide reductase, N-terminal domain {Paraco	93.86
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	92.66
d1h6la_		353	Thermostable phytase (3-phytase) {Bacillus amyloli	92.6
d1v04a_		340	Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory	92.22
d2pqrb1		124	Mitochondria fission protein Fis1 {Baker's yeast (	91.41
d1k3ia3		387	Galactose oxidase, central domain {Fungi (Fusarium	89.9
d1qfma1		430	Prolyl oligopeptidase, N-terminal domain {Pig (Sus	89.79
d2pqrb1		124	Mitochondria fission protein Fis1 {Baker's yeast (	89.54
d3dplr1		88	RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase	89.36
d1qfma1		430	Prolyl oligopeptidase, N-terminal domain {Pig (Sus	89.06
d1xipa_		381	Nucleoporin NUP159 {Baker's yeast (Saccharomyces c	88.89
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	86.7
d1k3ia3		387	Galactose oxidase, central domain {Fungi (Fusarium	86.59
d1crua_		450	Soluble quinoprotein glucose dehydrogenase {Acinet	85.75
d1yuza2		36	Nigerythrin, C-terminal domain {Desulfovibrio vulg	85.42
d1wgma_		98	Ubiquitin conjugation factor E4A {Human (Homo sapi	84.11
d1ur6b_		52	Not-4 N-terminal RING finger domain {Human (Homo s	83.7
d1utca2		327	Clathrin heavy-chain terminal domain {Rat (Rattus	82.73
d1rqga3		35	Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyro	82.19
d2jnea1		71	Hypothetical protein YfgJ {Escherichia coli [TaxId	81.18
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	81.15
d2akla2		38	Hypothetical protein PA0128, N-terminal domain {Ps	80.45

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.93  E-value=3.9e-23  Score=233.97  Aligned_cols=182  Identities=13%  Similarity=0.177  Sum_probs=154.7

Q ss_pred             CCCCCeeEEEEecCCCCEEEEEeCCCcEEEEECCC----cEEEEEe---CCCCEEEEEEcCCCCEEEEEEcCCCeEEEEE
Q psy12365         11 PHGPGDVYVCWQRRTGELLATTGRDSSVSIYNKHG----KLIDKIT---LPGLCIVMDWDSEGDLLGIISSNSSAVNVWN   83 (1324)
Q Consensus        11 ~h~~~i~~~~~sp~~g~~l~~~~~~~~v~v~~~~~----~~~~~~~---~~~~i~~i~~~~d~~~l~~~~~~d~~i~iw~   83 (1324)
                      +|...|.+++|+| +|++|++|+ ||.|+|||+..    ..+....   |.+.|.+++|+|||++|++++. |+.|++||
T Consensus        49 ~H~~~V~~v~fs~-~g~~latg~-dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~dg~~l~s~~~-dg~i~iwd  125 (337)
T d1gxra_          49 NHGEVVCAVTISN-PTRHVYTGG-KGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGE-ASTLSIWD  125 (337)
T ss_dssp             CCSSCCCEEEECS-SSSEEEEEC-BSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTTSSEEEEEES-SSEEEEEE
T ss_pred             CCCCcEEEEEECC-CCCEEEEEE-CCEEEEEEccCCcccceeEEeeecCCCCcEEEEEEcCCCCEEEEeec-cccccccc
Confidence            7999999999999 999999987 79999999732    2223332   7788999999999999999998 99999999


Q ss_pred             cCCC--eEEEEecCCCCCceEEEEecCCCEEEE-----EEEEEeCCC-CeEEEEe-cCCcEEEEEEcCCCCEEEEEEcCC
Q psy12365         84 TYTK--KRTIVDSGLRDPLTCLVWCKQCSMLQL-----SVSIYNKHG-KLIDKIT-LPGLCIVMDWDSEGDLLGIISSNS  154 (1324)
Q Consensus        84 ~~~~--~~~~~~~~~~~~v~~~~~s~~~~~l~~-----~i~v~d~~g-~~~~~~~-~~~~i~~~~~~~~g~~l~~~~~~~  154 (1324)
                      +...  +....+.+|...+..+.|+|++..+++     .+.+|+... +...... +...+.+++|++++..+++ ++.+
T Consensus       126 ~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~d~~i~~~~~~~~~~~~~~~~~~~~v~~l~~s~~~~~~~~-~~~d  204 (337)
T d1gxra_         126 LAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWT-GGLD  204 (337)
T ss_dssp             CCCC--EEEEEEECSSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEECCCSSCEEEEEECTTSSEEEE-EETT
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc-cccc
Confidence            8644  455566789999999999999999987     899999874 4333333 6788999999999999999 9999


Q ss_pred             CcEEEeecccC---------CCeeEEEEcCCCCEEEEEeCCCcEEEEEcCC
Q psy12365        155 SAVNVWTLLTY---------TLGERISWSDDGQLLAVTTSGGSVKIYLSKL  196 (1324)
Q Consensus       155 ~~i~iwd~~~~---------~~i~~~~~s~~~~~l~~~~~dg~i~~~~~~~  196 (1324)
                      +.+++||+++.         ..|.+++|+|+++++++++.||.+++|+.+.
T Consensus       205 ~~v~i~d~~~~~~~~~~~~~~~i~~l~~~~~~~~l~~~~~d~~i~i~d~~~  255 (337)
T d1gxra_         205 NTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNK  255 (337)
T ss_dssp             SEEEEEETTTTEEEEEEECSSCEEEEEECTTSSEEEEEETTSCEEEEETTS
T ss_pred             ccccccccccceeecccccccceEEEEEcccccccceeccccccccccccc
Confidence            99999998732         7889999999999999999999999998643

PyMOL of d1gxra_

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]}	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]}	Back information, alignment and structure

>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]}	Back information, alignment and structure

>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]}	Back information, alignment and structure

>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}	Back information, alignment and structure

>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1rqga3 g.41.1.1 (A:139-173) Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure