Psyllid ID: psy12376


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------9
MNLRYYIFLLQTSQVGQVLAIGTARGNLTVYNHMTSKRVPVLGKHTNTIVGQVLAIGTARGNLTVYNHMTSKRVPVLGKHTKSKPSTET
ccccccEEEEEEcccccEEEEEcccccEEEEEccccEEEEEcccccccEEccEEEEEEcccEEEEEEccccEEEEEEcccccccccccc
cccHcHHHHHHHcccccEEEEEEccccEEEEEcccccEEEEccccccHcHccEEEEEccccEEEEEccccccEcEEEcccccccccccc
MNLRYYIFLLQTSQVGQVLAIGTargnltvynhmtskrvpvlgkhtNTIVGQVLAIGTARgnltvynhmtskrvpvlgkhtkskpstet
MNLRYYIFLLQTSQVGQVLAIGTARGNLTVYNHMTSKRVPVLGKHTNTIVGQVLAIGTARGNLTVYNHmtskrvpvlgkhtkskpstet
MNLRYYIFLLQTSQVGQVLAIGTARGNLTVYNHMTSKRVPVLGKHTNTIVGQVLAIGTARGNLTVYNHMTSKRVPVLGKHTKSKPSTET
**LRYYIFLLQTSQVGQVLAIGTARGNLTVYNHMTSKRVPVLGKHTNTIVGQVLAIGTARGNLTVYNHMTSK*****************
****YYIFLLQTSQVGQVLAIGTARGNLTVYNHMTSKRVPVLGKHTNTIVGQVLAIGTARGNLTVYNHMT*******************
MNLRYYIFLLQTSQVGQVLAIGTARGNLTVYNHMTSKRVPVLGKHTNTIVGQVLAIGTARGNLTVYNHMTSKRVPV*************
*NLRYYIFLLQTSQVGQVLAIGTARGNLTVYNHMTSKRVPVLGKHTNTIVGQVLAIGTARGNLTVYNHMTSKRVPVLGKH*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLRYYIFLLQTSQVGQVLAIGTARGNLTVYNHMTSKRVPVLGKHTNTIVGQVLAIGTARGNLTVYNHMTSKRVPVLGKHTKSKPSTET
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query89 2.2.26 [Sep-21-2011]
Q3UGF1 1341 WD repeat-containing prot yes N/A 0.887 0.058 0.402 6e-10
Q8NEZ3 1342 WD repeat-containing prot yes N/A 0.741 0.049 0.430 3e-09
>sp|Q3UGF1|WDR19_MOUSE WD repeat-containing protein 19 OS=Mus musculus GN=Wdr19 PE=1 SV=1 Back     alignment and function desciption
 Score = 62.8 bits (151), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 53/92 (57%), Gaps = 13/92 (14%)

Query: 3   LRYYIFLLQTSQVGQVLAIGTARGNLTVYNHMTSKRVPVLGKHTNTIV------GQVLAI 56
           +R  +  L  S++G  LA+GT +GNL +YNH TS+++PVLGKHT  I         +LA+
Sbjct: 96  MRDQMSFLLWSKIGSFLAVGTIKGNLLIYNHQTSRKIPVLGKHTKKITCGCWNSENLLAL 155

Query: 57  GTARGNLTVYNHM--TSKRVPVLGKHTKSKPS 86
           G     +TV N    T ++ PV     KS+PS
Sbjct: 156 GGEDKMITVSNQEGDTIRQTPV-----KSEPS 182




May be involved in cilia function and/or assembly.
Mus musculus (taxid: 10090)
>sp|Q8NEZ3|WDR19_HUMAN WD repeat-containing protein 19 OS=Homo sapiens GN=WDR19 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query89
22651381 1282 WD repeat membrane protein [Mus musculus 0.887 0.061 0.402 2e-08
154240688 1341 WD repeat-containing protein 19 [Mus mus 0.887 0.058 0.402 2e-08
26342545 1021 unnamed protein product [Mus musculus] 0.887 0.077 0.402 2e-08
156348545 959 hypothetical protein NEMVEDRAFT_v1g14330 0.730 0.067 0.436 3e-08
330340430 1341 WD repeat-containing protein 19 [Rattus 0.887 0.058 0.402 3e-08
149035370 1035 WD repeat domain 19 (predicted), isoform 0.887 0.076 0.402 3e-08
432844941 1345 PREDICTED: WD repeat-containing protein 0.629 0.041 0.467 3e-08
26335950 438 unnamed protein product [Mus musculus] 0.887 0.180 0.402 3e-08
440904764 1345 WD repeat-containing protein 19, partial 0.887 0.058 0.391 4e-08
329664856 1342 WD repeat-containing protein 19 [Bos tau 0.887 0.058 0.391 4e-08
>gi|22651381|gb|AAK38746.1| WD repeat membrane protein [Mus musculus] Back     alignment and taxonomy information
 Score = 62.8 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 53/92 (57%), Gaps = 13/92 (14%)

Query: 3   LRYYIFLLQTSQVGQVLAIGTARGNLTVYNHMTSKRVPVLGKHTNTIV------GQVLAI 56
           +R  +  L  S++G  LA+GT +GNL +YNH TS+++PVLGKHT  I         +LA+
Sbjct: 37  MRDQMSFLLWSKIGSFLAVGTIKGNLLIYNHQTSRKIPVLGKHTKKITCGCWNSENLLAL 96

Query: 57  GTARGNLTVYNHM--TSKRVPVLGKHTKSKPS 86
           G     +TV N    T ++ PV     KS+PS
Sbjct: 97  GGEDKMITVSNQEGDTIRQTPV-----KSEPS 123




Source: Mus musculus

Species: Mus musculus

Genus: Mus

Family: Muridae

Order: Rodentia

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|154240688|ref|NP_700440.2| WD repeat-containing protein 19 [Mus musculus] gi|94730677|sp|Q3UGF1.1|WDR19_MOUSE RecName: Full=WD repeat-containing protein 19 gi|74190976|dbj|BAE28258.1| unnamed protein product [Mus musculus] gi|148705784|gb|EDL37731.1| WD repeat domain 19, isoform CRA_b [Mus musculus] gi|183396883|gb|AAI66024.1| WD repeat domain 19 [synthetic construct] Back     alignment and taxonomy information
>gi|26342545|dbj|BAC34929.1| unnamed protein product [Mus musculus] Back     alignment and taxonomy information
>gi|156348545|ref|XP_001621888.1| hypothetical protein NEMVEDRAFT_v1g143309 [Nematostella vectensis] gi|156208216|gb|EDO29788.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|330340430|ref|NP_001178608.2| WD repeat-containing protein 19 [Rattus norvegicus] Back     alignment and taxonomy information
>gi|149035370|gb|EDL90074.1| WD repeat domain 19 (predicted), isoform CRA_a [Rattus norvegicus] Back     alignment and taxonomy information
>gi|432844941|ref|XP_004065785.1| PREDICTED: WD repeat-containing protein 19-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|26335950|dbj|BAC31673.1| unnamed protein product [Mus musculus] Back     alignment and taxonomy information
>gi|440904764|gb|ELR55229.1| WD repeat-containing protein 19, partial [Bos grunniens mutus] Back     alignment and taxonomy information
>gi|329664856|ref|NP_001192956.1| WD repeat-containing protein 19 [Bos taurus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query89
UNIPROTKB|D6RE75142 WDR19 "WD repeat-containing pr 0.662 0.415 0.5 8.4e-10
RGD|1306997 1340 Wdr19 "WD repeat domain 19" [R 0.887 0.058 0.431 5.2e-09
MGI|MGI:2443231 1341 Wdr19 "WD repeat domain 19" [M 0.820 0.054 0.448 6.7e-09
UNIPROTKB|E1B7Q4 1342 WDR19 "Uncharacterized protein 0.887 0.058 0.402 1.4e-08
UNIPROTKB|Q8NEZ3 1342 WDR19 "WD repeat-containing pr 0.662 0.043 0.5 2.9e-08
UNIPROTKB|I3LLZ8 1330 WDR19 "Uncharacterized protein 0.820 0.054 0.425 2e-07
UNIPROTKB|E1C1Y1 1342 WDR19 "Uncharacterized protein 0.662 0.043 0.454 2.6e-07
FB|FBgn0034452 1366 Oseg6 "Oseg6" [Drosophila mela 0.775 0.050 0.397 3.1e-06
WB|WBGene00001118 1383 dyf-2 [Caenorhabditis elegans 0.640 0.041 0.419 0.00089
UNIPROTKB|D6RE75 WDR19 "WD repeat-containing protein 19" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 141 (54.7 bits), Expect = 8.4e-10, P = 8.4e-10
 Identities = 33/66 (50%), Positives = 43/66 (65%)

Query:     8 FLLQTSQVGQVLAIGTARGNLTVYNHMTSKRVPVLGKHTNTIV-G-----QVLAIGTARG 61
             FLL  S+VG  LA+GT +GNL +YNH TS+++PVLGKHT  I  G      +LA+G    
Sbjct:    43 FLLW-SKVGSFLAVGTVKGNLLIYNHQTSRKIPVLGKHTKRITCGCWNAENLLALGGEDK 101

Query:    62 NLTVYN 67
              +TV N
Sbjct:   102 MITVSN 107


GO:0001701 "in utero embryonic development" evidence=IEA
GO:0030326 "embryonic limb morphogenesis" evidence=IEA
GO:0031076 "embryonic camera-type eye development" evidence=IEA
GO:0031514 "motile cilium" evidence=IEA
GO:0032391 "photoreceptor connecting cilium" evidence=IEA
GO:0042384 "cilium assembly" evidence=IEA
GO:0042471 "ear morphogenesis" evidence=IEA
GO:0048701 "embryonic cranial skeleton morphogenesis" evidence=IEA
GO:0050877 "neurological system process" evidence=IEA
GO:0055123 "digestive system development" evidence=IEA
GO:0060830 "ciliary receptor clustering involved in smoothened signaling pathway" evidence=IEA
GO:0060831 "smoothened signaling pathway involved in dorsal/ventral neural tube patterning" evidence=IEA
GO:0061055 "myotome development" evidence=IEA
RGD|1306997 Wdr19 "WD repeat domain 19" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2443231 Wdr19 "WD repeat domain 19" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1B7Q4 WDR19 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NEZ3 WDR19 "WD repeat-containing protein 19" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LLZ8 WDR19 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C1Y1 WDR19 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0034452 Oseg6 "Oseg6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00001118 dyf-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 89
KOG0271|consensus 480 99.83
KOG0266|consensus 456 99.73
KOG0272|consensus459 99.73
KOG0263|consensus707 99.71
KOG0266|consensus 456 99.68
KOG0271|consensus480 99.68
KOG0272|consensus459 99.68
PTZ00421 493 coronin; Provisional 99.66
KOG0285|consensus 460 99.63
PTZ00421 493 coronin; Provisional 99.62
KOG0319|consensus 775 99.59
KOG0263|consensus 707 99.58
KOG0265|consensus 338 99.58
KOG0273|consensus524 99.58
KOG0286|consensus 343 99.57
KOG0295|consensus406 99.55
KOG0291|consensus 893 99.55
KOG0286|consensus 343 99.54
KOG0316|consensus 307 99.54
KOG0319|consensus 775 99.54
KOG0265|consensus 338 99.53
KOG0315|consensus311 99.52
KOG0281|consensus499 99.52
PTZ00420 568 coronin; Provisional 99.51
PTZ00420 568 coronin; Provisional 99.51
KOG0285|consensus 460 99.51
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 99.5
KOG0302|consensus440 99.5
KOG0274|consensus 537 99.5
KOG0279|consensus 315 99.5
KOG0284|consensus 464 99.49
KOG0645|consensus 312 99.49
KOG0292|consensus 1202 99.48
KOG0318|consensus603 99.48
KOG0318|consensus 603 99.48
KOG0273|consensus 524 99.47
KOG0279|consensus 315 99.47
KOG0276|consensus 794 99.46
KOG0308|consensus 735 99.46
KOG0973|consensus 942 99.45
KOG0647|consensus 347 99.45
KOG0282|consensus 503 99.43
KOG0643|consensus 327 99.43
KOG0275|consensus 508 99.43
KOG0316|consensus307 99.43
KOG0647|consensus 347 99.42
KOG0277|consensus 311 99.42
KOG0264|consensus422 99.41
KOG0289|consensus506 99.41
KOG0293|consensus519 99.4
KOG0274|consensus 537 99.4
KOG0281|consensus 499 99.4
KOG0264|consensus422 99.39
PLN00181 793 protein SPA1-RELATED; Provisional 99.39
KOG0283|consensus 712 99.38
KOG0292|consensus 1202 99.37
KOG0296|consensus 399 99.36
KOG0299|consensus 479 99.36
KOG0315|consensus 311 99.36
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 99.36
KOG0276|consensus 794 99.36
KOG1407|consensus313 99.36
KOG0306|consensus 888 99.36
KOG0275|consensus 508 99.35
PLN00181 793 protein SPA1-RELATED; Provisional 99.34
KOG0296|consensus 399 99.33
KOG0294|consensus 362 99.33
KOG0284|consensus 464 99.32
KOG0295|consensus406 99.32
KOG0283|consensus 712 99.31
KOG1446|consensus 311 99.31
KOG0310|consensus 487 99.31
KOG1446|consensus311 99.31
KOG0313|consensus423 99.3
KOG0973|consensus 942 99.3
KOG0649|consensus 325 99.3
KOG0305|consensus 484 99.3
KOG0645|consensus 312 99.3
KOG0267|consensus 825 99.29
KOG1273|consensus 405 99.29
KOG0306|consensus 888 99.28
KOG0293|consensus 519 99.27
KOG0641|consensus 350 99.27
KOG0305|consensus484 99.26
KOG0277|consensus311 99.26
KOG0303|consensus 472 99.24
KOG0310|consensus 487 99.23
KOG0300|consensus 481 99.2
KOG0269|consensus 839 99.19
KOG1009|consensus 434 99.19
KOG0640|consensus 430 99.16
KOG0282|consensus 503 99.14
KOG2919|consensus406 99.13
KOG0289|consensus 506 99.12
KOG0639|consensus 705 99.12
KOG0301|consensus 745 99.12
KOG0640|consensus430 99.11
KOG1408|consensus 1080 99.11
KOG0294|consensus 362 99.1
KOG0302|consensus440 99.1
KOG2096|consensus 420 99.09
KOG1310|consensus 758 99.09
KOG0313|consensus423 99.09
KOG0267|consensus 825 99.09
KOG1034|consensus 385 99.07
KOG0291|consensus 893 99.06
KOG1007|consensus 370 99.05
KOG1036|consensus 323 99.05
KOG0278|consensus334 99.04
KOG0303|consensus 472 99.04
KOG0772|consensus 641 99.03
KOG0643|consensus327 99.03
KOG0299|consensus 479 99.03
KOG0644|consensus 1113 99.03
KOG1034|consensus 385 99.03
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.02
KOG0646|consensus 476 99.01
KOG1407|consensus 313 99.01
KOG4283|consensus 397 99.01
KOG0646|consensus 476 99.0
KOG1332|consensus 299 98.99
KOG0301|consensus 745 98.98
KOG1332|consensus 299 98.97
KOG0300|consensus 481 98.97
KOG2048|consensus 691 98.97
KOG1274|consensus 933 98.96
KOG0278|consensus 334 98.95
KOG2394|consensus 636 98.94
KOG1445|consensus 1012 98.93
KOG0268|consensus 433 98.92
KOG0270|consensus 463 98.91
KOG0288|consensus 459 98.91
KOG3914|consensus 390 98.9
KOG2110|consensus 391 98.9
KOG0269|consensus 839 98.89
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.88
KOG0308|consensus 735 98.87
KOG0288|consensus459 98.87
KOG1036|consensus 323 98.86
KOG2394|consensus 636 98.86
KOG1063|consensus764 98.85
KOG0322|consensus323 98.85
KOG1539|consensus 910 98.82
COG2319 466 FOG: WD40 repeat [General function prediction only 98.82
KOG0639|consensus 705 98.8
KOG0268|consensus433 98.79
KOG2445|consensus361 98.77
KOG0641|consensus350 98.77
KOG1274|consensus 933 98.77
KOG4283|consensus 397 98.75
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.75
KOG2055|consensus514 98.75
KOG0290|consensus364 98.75
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.75
KOG0321|consensus 720 98.74
KOG1538|consensus 1081 98.72
KOG1273|consensus 405 98.72
KOG2111|consensus346 98.72
KOG1445|consensus 1012 98.71
KOG2445|consensus 361 98.7
KOG0771|consensus 398 98.7
KOG0270|consensus463 98.68
KOG3881|consensus412 98.64
KOG1539|consensus 910 98.64
KOG0642|consensus 577 98.62
KOG0772|consensus 641 98.62
KOG0307|consensus 1049 98.61
KOG2106|consensus 626 98.59
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.58
KOG0974|consensus 967 98.58
KOG0307|consensus 1049 98.56
KOG1408|consensus 1080 98.56
KOG0642|consensus 577 98.55
COG2319 466 FOG: WD40 repeat [General function prediction only 98.54
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.53
KOG0321|consensus 720 98.53
KOG0650|consensus 733 98.52
KOG1409|consensus 404 98.52
KOG1523|consensus 361 98.51
KOG0649|consensus325 98.5
KOG2695|consensus425 98.49
KOG0290|consensus 364 98.49
KOG2048|consensus 691 98.48
KOG1007|consensus370 98.47
KOG1334|consensus559 98.47
KOG0771|consensus 398 98.43
KOG2096|consensus420 98.42
KOG1009|consensus 434 98.42
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.37
KOG2110|consensus 391 98.36
KOG1063|consensus 764 98.36
KOG0322|consensus323 98.35
KOG4328|consensus 498 98.34
KOG1538|consensus 1081 98.33
KOG2919|consensus 406 98.33
KOG2106|consensus 626 98.32
KOG1587|consensus 555 98.32
KOG4328|consensus 498 98.31
KOG4547|consensus 541 98.3
KOG1188|consensus 376 98.29
KOG4227|consensus 609 98.27
KOG1524|consensus 737 98.26
KOG0974|consensus 967 98.26
KOG4378|consensus 673 98.23
smart0032040 WD40 WD40 repeats. Note that these repeats are per 98.22
KOG4378|consensus 673 98.2
KOG1272|consensus 545 98.2
KOG0280|consensus339 98.18
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 98.16
KOG1963|consensus 792 98.11
KOG1272|consensus 545 98.11
KOG1310|consensus758 98.11
KOG0644|consensus 1113 98.09
PRK05137 435 tolB translocation protein TolB; Provisional 98.06
PRK01742 429 tolB translocation protein TolB; Provisional 98.06
KOG1064|consensus2439 98.06
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.03
KOG4714|consensus319 98.02
KOG2055|consensus 514 98.0
KOG0650|consensus733 98.0
KOG1188|consensus 376 97.99
PRK03629 429 tolB translocation protein TolB; Provisional 97.9
KOG4547|consensus 541 97.9
KOG1517|consensus1387 97.89
KOG3881|consensus 412 97.87
KOG1587|consensus555 97.85
KOG2139|consensus 445 97.85
PRK01742429 tolB translocation protein TolB; Provisional 97.81
KOG0280|consensus 339 97.77
KOG1240|consensus 1431 97.76
KOG2321|consensus 703 97.76
KOG1334|consensus 559 97.73
PRK04922 433 tolB translocation protein TolB; Provisional 97.72
PRK02889 427 tolB translocation protein TolB; Provisional 97.71
KOG4227|consensus 609 97.7
TIGR02800 417 propeller_TolB tol-pal system beta propeller repea 97.58
PRK00178 430 tolB translocation protein TolB; Provisional 97.57
KOG2695|consensus425 97.53
KOG1963|consensus 792 97.53
KOG2111|consensus 346 97.52
PRK11028 330 6-phosphogluconolactonase; Provisional 97.51
KOG1354|consensus 433 97.48
PRK03629429 tolB translocation protein TolB; Provisional 97.47
KOG2079|consensus 1206 97.47
PRK04792 448 tolB translocation protein TolB; Provisional 97.46
KOG2321|consensus 703 97.45
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.44
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.43
KOG1354|consensus433 97.41
KOG4532|consensus344 97.4
KOG1517|consensus1387 97.39
PRK11028 330 6-phosphogluconolactonase; Provisional 97.36
KOG1240|consensus 1431 97.36
KOG1645|consensus 463 97.34
PRK05137435 tolB translocation protein TolB; Provisional 97.23
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.22
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 97.19
KOG4640|consensus 665 97.17
KOG4640|consensus 665 97.11
PF13360 238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.1
KOG4190|consensus 1034 97.08
KOG4532|consensus344 97.08
KOG1912|consensus 1062 97.01
PRK02889427 tolB translocation protein TolB; Provisional 96.99
KOG1064|consensus2439 96.95
KOG1523|consensus 361 96.95
KOG1275|consensus 1118 96.93
PRK04922433 tolB translocation protein TolB; Provisional 96.88
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 96.85
PRK01029428 tolB translocation protein TolB; Provisional 96.84
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 96.79
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 96.77
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 96.76
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 96.75
KOG1832|consensus 1516 96.74
PRK00178430 tolB translocation protein TolB; Provisional 96.69
KOG3914|consensus 390 96.67
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 96.63
KOG1524|consensus 737 96.63
KOG1912|consensus 1062 96.61
PRK01029428 tolB translocation protein TolB; Provisional 96.58
KOG2315|consensus 566 96.55
KOG2314|consensus 698 96.54
KOG2041|consensus 1189 96.52
COG4946 668 Uncharacterized protein related to the periplasmic 96.45
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.44
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 96.41
KOG2066|consensus 846 96.39
COG4946 668 Uncharacterized protein related to the periplasmic 96.38
PF15492 282 Nbas_N: Neuroblastoma-amplified sequence, N termin 96.36
KOG4497|consensus 447 96.34
KOG2315|consensus 566 96.33
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.33
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 96.31
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 96.24
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 96.23
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 96.2
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.19
PRK04792448 tolB translocation protein TolB; Provisional 96.17
KOG4497|consensus 447 96.1
KOG1409|consensus 404 95.99
PRK11138 394 outer membrane biogenesis protein BamB; Provisiona 95.97
KOG2314|consensus 698 95.86
KOG2139|consensus 445 95.86
KOG4714|consensus319 95.85
KOG4649|consensus 354 95.85
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 95.72
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 95.64
KOG0882|consensus 558 95.54
PRK02888 635 nitrous-oxide reductase; Validated 95.53
KOG2114|consensus 933 95.48
KOG0309|consensus 1081 95.37
KOG2066|consensus 846 95.3
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 95.21
KOG3617|consensus 1416 95.13
KOG4190|consensus1034 95.12
PF07569 219 Hira: TUP1-like enhancer of split; InterPro: IPR01 95.02
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 95.02
PRK04043 419 tolB translocation protein TolB; Provisional 94.9
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 94.87
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 94.66
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 94.63
KOG3621|consensus 726 94.35
KOG2444|consensus238 94.29
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 94.16
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 94.02
KOG2395|consensus 644 93.88
KOG3617|consensus 1416 93.71
KOG2444|consensus238 93.68
KOG0309|consensus 1081 93.66
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 93.62
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 93.49
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 93.46
KOG1916|consensus 1283 93.35
KOG1275|consensus 1118 92.94
PRK04043419 tolB translocation protein TolB; Provisional 92.75
KOG3621|consensus 726 92.67
PF0101138 PQQ: PQQ enzyme repeat family.; InterPro: IPR00237 92.65
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 92.65
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 92.44
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 92.38
KOG4460|consensus 741 92.31
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 92.21
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 92.14
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 92.11
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 92.09
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 91.85
KOG2079|consensus 1206 91.55
PF0101138 PQQ: PQQ enzyme repeat family.; InterPro: IPR00237 91.42
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 90.88
KOG1645|consensus 463 90.86
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 90.71
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 90.41
COG3204 316 Uncharacterized protein conserved in bacteria [Fun 90.25
KOG0882|consensus 558 90.2
KOG2041|consensus 1189 90.13
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 89.95
PF14779257 BBS1: Ciliary BBSome complex subunit 1 89.88
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 89.78
PF06977 248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 89.61
KOG2247|consensus 615 89.51
COG3386307 Gluconolactonase [Carbohydrate transport and metab 89.37
KOG4649|consensus 354 89.18
PF02897 414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 89.1
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 89.02
KOG2114|consensus 933 88.55
TIGR03054135 photo_alph_chp1 putative photosynthetic complex as 88.48
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 88.44
KOG4499|consensus310 88.24
KOG2103|consensus 910 87.74
PHA02713557 hypothetical protein; Provisional 87.51
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 87.25
KOG2395|consensus 644 86.9
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 86.72
PF00780 275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 86.66
PF1357040 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A. 86.58
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 86.46
PF14655 415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 86.04
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 85.86
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 85.73
PF07569 219 Hira: TUP1-like enhancer of split; InterPro: IPR01 85.42
PF08450 246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 85.07
KOG4499|consensus310 84.92
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 84.88
COG0823425 TolB Periplasmic component of the Tol biopolymer t 84.66
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 84.06
PF10282 345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 83.73
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 83.62
KOG2727|consensus 1244 83.54
KOG2247|consensus 615 82.78
PRK10115 686 protease 2; Provisional 82.09
PHA03098534 kelch-like protein; Provisional 81.97
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 81.41
COG1520 370 FOG: WD40-like repeat [Function unknown] 81.26
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 80.52
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 80.48
KOG3616|consensus 1636 80.28
>KOG0271|consensus Back     alignment and domain information
Probab=99.83  E-value=2.4e-20  Score=125.02  Aligned_cols=86  Identities=20%  Similarity=0.348  Sum_probs=78.8

Q ss_pred             CcCCcEEEEEEccCCCEEEEEeCCCcEEEEeCCCCeEe-eEecCCcceeec------------cEEEEEeCCCCEEEEeC
Q psy12376          2 NLRYYIFLLQTSQVGQVLAIGTARGNLTVYNHMTSKRV-PVLGKHTNTIVG------------QVLAIGTARGNLTVYNH   68 (89)
Q Consensus         2 ~~~~~i~~~~~spdg~~la~g~~~g~v~iwd~~~~~~~-~~~~~h~~~i~~------------~~las~s~d~~v~iwd~   68 (89)
                      +|..+|.|++|||||+.||+|+.||+|++||..+|+++ +.+.+|+..|.+            .+||++|.||+++|||+
T Consensus       155 gH~~WVlcvawsPDgk~iASG~~dg~I~lwdpktg~~~g~~l~gH~K~It~Lawep~hl~p~~r~las~skDg~vrIWd~  234 (480)
T KOG0271|consen  155 GHKNWVLCVAWSPDGKKIASGSKDGSIRLWDPKTGQQIGRALRGHKKWITALAWEPLHLVPPCRRLASSSKDGSVRIWDT  234 (480)
T ss_pred             CCccEEEEEEECCCcchhhccccCCeEEEecCCCCCcccccccCcccceeEEeecccccCCCccceecccCCCCEEEEEc
Confidence            57889999999999999999999999999999887765 578899999987            79999999999999999


Q ss_pred             CCCEEEeeeCCCCCCCcCC
Q psy12376         69 MTSKRVPVLGKHTKSKPST   87 (89)
Q Consensus        69 ~~~~~~~~l~~h~~~~~~~   87 (89)
                      ..+.++..+-+|+.++.+.
T Consensus       235 ~~~~~~~~lsgHT~~VTCv  253 (480)
T KOG0271|consen  235 KLGTCVRTLSGHTASVTCV  253 (480)
T ss_pred             cCceEEEEeccCccceEEE
Confidence            9999999999999987653



>KOG0266|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF01011 PQQ: PQQ enzyme repeat family Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF01011 PQQ: PQQ enzyme repeat family Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF14779 BBS1: Ciliary BBSome complex subunit 1 Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>TIGR03054 photo_alph_chp1 putative photosynthetic complex assembly protein Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG2103|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF13570 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>KOG2727|consensus Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query89
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.8
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 99.77
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 99.77
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 99.76
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.76
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.75
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.74
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.74
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.74
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 99.74
2pm7_B 297 Protein transport protein SEC13, protein transport 99.73
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.73
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.73
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 99.72
2pbi_B 354 Guanine nucleotide-binding protein subunit beta 5; 99.72
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.72
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 99.71
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 99.7
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 99.7
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.7
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.7
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 99.69
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.69
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.68
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.68
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.68
1got_B 340 GT-beta; complex (GTP-binding/transducer), G prote 99.68
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.68
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.67
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.67
3iz6_a 380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.67
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.67
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.67
4g56_B 357 MGC81050 protein; protein arginine methyltransfera 99.66
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 99.66
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.66
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.65
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 99.65
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.65
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.65
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.65
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.65
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.64
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 99.64
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 99.64
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 99.64
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.63
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 99.63
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.63
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 99.62
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 99.62
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.62
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 99.62
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 99.62
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.61
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.61
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.6
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.59
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 99.59
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.59
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.59
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.59
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.58
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.58
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 99.58
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.57
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.57
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.57
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.57
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.57
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.57
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.56
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.56
3jro_A 753 Fusion protein of protein transport protein SEC13 99.56
2pm7_B297 Protein transport protein SEC13, protein transport 99.56
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 99.56
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.56
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 99.55
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.55
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.55
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.55
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.55
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 99.55
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.54
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.54
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.54
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.54
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 99.53
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.53
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.52
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.52
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 99.52
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.52
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.52
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.52
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 99.51
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.51
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.51
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.51
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.51
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.51
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.51
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.51
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.5
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 99.5
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.49
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.49
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 99.49
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 99.48
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.48
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.48
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 99.48
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 99.47
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.46
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 99.45
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.45
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.45
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.44
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 99.44
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.43
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 99.43
3jro_A 753 Fusion protein of protein transport protein SEC13 99.41
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.35
3vu4_A 355 KMHSV2; beta-propeller fold, protein transport; 2. 99.31
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.25
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.19
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.18
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.18
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.11
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.97
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.94
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.83
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.78
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.77
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 98.77
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.74
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 98.74
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 98.67
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.63
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 98.62
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 98.61
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.61
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.6
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.6
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.59
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.57
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 98.54
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.52
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.51
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 98.48
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.48
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.46
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.45
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.45
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 98.42
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.4
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.39
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.34
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.33
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.31
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.3
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.27
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 98.25
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.2
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 98.19
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.19
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.17
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.14
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.14
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.13
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.09
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.08
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 98.08
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 98.01
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 97.96
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.95
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 97.95
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.93
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 97.9
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 97.87
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.85
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.83
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 97.82
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 97.81
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.78
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 97.74
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.74
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 97.65
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.64
3no2_A 276 Uncharacterized protein; six-bladed beta-propeller 97.63
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.6
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 97.55
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 97.5
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.5
2qe8_A 343 Uncharacterized protein; structural genomics, join 97.47
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 97.43
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.4
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.4
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 97.36
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 97.3
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.29
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.25
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 97.23
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 97.22
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 97.2
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.18
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 97.17
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.15
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.14
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.13
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.12
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.04
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 97.01
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 96.97
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 96.94
3nol_A 262 Glutamine cyclotransferase; beta-propeller, glutam 96.92
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.88
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 96.88
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 96.77
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 96.75
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 96.68
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 96.62
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 96.6
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 96.59
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 96.59
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.57
3mbr_X 243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.56
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 96.55
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 96.48
3nok_A 268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.39
3dr2_A 305 Exported gluconolactonase; gluconolactonase SMP-30 96.36
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.34
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 96.25
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 96.06
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 96.04
2ghs_A 326 AGR_C_1268P; regucalcin, structural genomics, join 95.92
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 95.65
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 95.65
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 95.61
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 95.59
2ece_A 462 462AA long hypothetical selenium-binding protein; 95.46
2qe8_A 343 Uncharacterized protein; structural genomics, join 95.46
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 95.19
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 95.15
3qqz_A 255 Putative uncharacterized protein YJIK; MCSG, PSI-2 95.08
3hxj_A 330 Pyrrolo-quinoline quinone; all beta protein. incom 95.01
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 94.98
3hxj_A 330 Pyrrolo-quinoline quinone; all beta protein. incom 94.87
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 94.86
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 94.83
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 94.67
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 94.64
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 94.58
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 94.25
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 93.54
2be1_A 339 Serine/threonine-protein kinase/endoribonuclease; 93.41
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 93.11
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 91.84
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 91.58
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 90.06
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 89.95
2p4o_A 306 Hypothetical protein; putative lactonase, structur 89.75
2be1_A 339 Serine/threonine-protein kinase/endoribonuclease; 89.64
1npe_A 267 Nidogen, entactin; glycoprotein, basement membrane 89.4
4a2l_A 795 BT_4663, two-component system sensor histidine kin 89.38
2fp8_A 322 Strictosidine synthase; six bladed beta propeller 89.35
3f7f_A 729 Nucleoporin NUP120; nuclear pore complex, macromol 88.98
2p4o_A 306 Hypothetical protein; putative lactonase, structur 88.96
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 87.51
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 87.37
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 85.31
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 85.19
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 84.67
2ece_A 462 462AA long hypothetical selenium-binding protein; 84.61
4a2l_A 795 BT_4663, two-component system sensor histidine kin 83.83
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 83.81
2fp8_A322 Strictosidine synthase; six bladed beta propeller 83.31
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 83.3
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 81.39
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 80.51
3f7f_A 729 Nucleoporin NUP120; nuclear pore complex, macromol 80.36
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
Probab=99.80  E-value=8.9e-19  Score=113.05  Aligned_cols=85  Identities=14%  Similarity=0.121  Sum_probs=78.1

Q ss_pred             CcCCcEEEEEEccCCCEEEEEeCCCcEEEEeCCCCeEeeEecCCcceeec-------cEEEEEeCCCCEEEEeCCCCEEE
Q psy12376          2 NLRYYIFLLQTSQVGQVLAIGTARGNLTVYNHMTSKRVPVLGKHTNTIVG-------QVLAIGTARGNLTVYNHMTSKRV   74 (89)
Q Consensus         2 ~~~~~i~~~~~spdg~~la~g~~~g~v~iwd~~~~~~~~~~~~h~~~i~~-------~~las~s~d~~v~iwd~~~~~~~   74 (89)
                      +|.+.|++++|+|+|++||+++.||.|++||..+++.+..+..|..++.+       ++|++|+.|++|++||+.+++..
T Consensus        11 ~h~~~V~~~~fsp~~~~l~s~~~dg~v~lWd~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~s~d~~i~vwd~~~~~~~   90 (304)
T 2ynn_A           11 NRSDRVKGIDFHPTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKV   90 (304)
T ss_dssp             EECSCEEEEEECSSSSEEEEEETTSEEEEEETTTTEEEEEEECCSSCEEEEEEEGGGTEEEEEETTSEEEEEETTTCCEE
T ss_pred             CCCCceEEEEECCCCCEEEEEcCCCcEEEEECCCCceeEEeeccCCcEEEEEEeCCCCEEEEECCCCEEEEEECCCCcEE
Confidence            46788999999999999999999999999999999999999999888876       79999999999999999999999


Q ss_pred             eeeCCCCCCCcC
Q psy12376         75 PVLGKHTKSKPS   86 (89)
Q Consensus        75 ~~l~~h~~~~~~   86 (89)
                      ..+.+|+..+.+
T Consensus        91 ~~~~~h~~~v~~  102 (304)
T 2ynn_A           91 VDFEAHPDYIRS  102 (304)
T ss_dssp             EEEECCSSCEEE
T ss_pred             EEEeCCCCcEEE
Confidence            999999887643



>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3f7f_A Nucleoporin NUP120; nuclear pore complex, macromolecular assembly, membrane coat, nucleocytoplasmic transport, beta-propeller; 2.60A {Saccharomyces cerevisiae} PDB: 3h7n_A 3hxr_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3f7f_A Nucleoporin NUP120; nuclear pore complex, macromolecular assembly, membrane coat, nucleocytoplasmic transport, beta-propeller; 2.60A {Saccharomyces cerevisiae} PDB: 3h7n_A 3hxr_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query89
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.8
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 99.73
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.71
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.69
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.69
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.68
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.67
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.67
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.67
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.67
d1tbga_ 340 beta1-subunit of the signal-transducing G protein 99.66
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.65
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.65
d2ovrb2 342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.63
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.63
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.62
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.6
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.6
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.56
d1sq9a_ 393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.53
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.52
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.52
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.48
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.47
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.41
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.4
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.39
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.27
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.26
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.22
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.21
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 99.04
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.03
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.03
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.88
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.85
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.82
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.8
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 98.69
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 98.49
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.49
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.47
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.43
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.42
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.31
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.31
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.25
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.93
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 97.74
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 97.68
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 96.35
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 95.6
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.53
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 95.51
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 95.35
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 95.03
d1jofa_ 365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 94.84
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 94.71
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 94.49
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.41
d2hqsa1 269 TolB, C-terminal domain {Escherichia coli [TaxId: 94.2
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 93.99
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 93.73
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.56
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 92.93
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 92.54
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 92.44
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 92.42
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 92.09
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 91.87
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 90.69
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 89.94
d1rwia_ 260 Serine/threonine-protein kinase PknD {Mycobacteriu 89.91
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 89.91
d1pjxa_ 314 Diisopropylfluorophosphatase (phosphotriesterase, 89.03
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 87.06
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 86.88
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 86.2
d2dg1a1 319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 85.38
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 84.16
d1qfma1 430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 83.53
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 81.72
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 80.78
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 80.36
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Antiviral protein Ski8 (Ski8p)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.80  E-value=2.2e-19  Score=117.34  Aligned_cols=85  Identities=22%  Similarity=0.318  Sum_probs=75.4

Q ss_pred             CcCCcEEEEEEccCCCEEEEEeCCCc---EEEEeCCCCeEeeEec-------------CCcceeec-------cEEEEEe
Q psy12376          2 NLRYYIFLLQTSQVGQVLAIGTARGN---LTVYNHMTSKRVPVLG-------------KHTNTIVG-------QVLAIGT   58 (89)
Q Consensus         2 ~~~~~i~~~~~spdg~~la~g~~~g~---v~iwd~~~~~~~~~~~-------------~h~~~i~~-------~~las~s   58 (89)
                      +|.++|.+++|||||++|++|+.|++   |++||.++++.+..+.             +|.+.|.+       ++|+|||
T Consensus       229 ~h~~~V~~l~~spdg~~l~sgs~D~t~~~i~lwd~~~g~~~~~l~~~~~~~~~~~~~~gH~~~V~~l~fspd~~~l~S~s  308 (393)
T d1sq9a_         229 NNSNSIRSVKFSPQGSLLAIAHDSNSFGCITLYETEFGERIGSLSVPTHSSQASLGEFAHSSWVMSLSFNDSGETLCSAG  308 (393)
T ss_dssp             CCCCCEEEEEECSSTTEEEEEEEETTEEEEEEEETTTCCEEEEECBC--------CCBSBSSCEEEEEECSSSSEEEEEE
T ss_pred             cccceEEEcccccccceeeeecCCCCcceeeecccccceeeeeeccccccccceeeeecccCceeeeccCCCCCeeEEEC
Confidence            47788999999999999999998874   9999999988776653             68888877       7999999


Q ss_pred             CCCCEEEEeCCCCEEEeeeCCCCCCCcC
Q psy12376         59 ARGNLTVYNHMTSKRVPVLGKHTKSKPS   86 (89)
Q Consensus        59 ~d~~v~iwd~~~~~~~~~l~~h~~~~~~   86 (89)
                      .|++|+|||+++++++..+.+|...+..
T Consensus       309 ~D~~v~vWd~~~g~~~~~l~gH~~~v~~  336 (393)
T d1sq9a_         309 WDGKLRFWDVKTKERITTLNMHCDDIEI  336 (393)
T ss_dssp             TTSEEEEEETTTTEEEEEEECCGGGCSS
T ss_pred             CCCEEEEEECCCCCEEEEECCcCCcccC
Confidence            9999999999999999999999887653



>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure