Psyllid ID: psy12410

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-----
MVRSRRKRSRSRSPSPSHKRPKESRRDKDRDRRRRSRSHERRSERDRDRDLERRKEKSRGSKRRSRSREAERSKDHSKKEEKDKREKEEEEAAFDPSKLDKEVEATRLELEMQKRRDRIERWRAERKKKDIETIKKDIKSNLSSGLGGSAPMKKWNLEDDSDEDENDNKDENGKTAEEDIDPLDAFMQGVHEEMRKVNKPAVPTTADVKPADSGSKPAGVVIVTGVVKKSVEKAKGELMEENQDGLEYSSEEEQEDLTSTAANLASKQKKELSKVDHSTIEYLPFRKDFYVEVPEIARMTPEEVEKYKEELEGIRVKGKGCPRPIKTWAQCGVSKKILDALKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTVAFVLPLLRHILDQPPLEETDGPMAIIMSPTRELCMQIGKEAKKFTKSLGLRVVCVYGGTGISEQISELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYIVLDEADRMFDMGFEPQVMRIIDNVRPDRQTVMFSATFPRQMEALARRILNKPIEIQVGGRSVVCKEVEQHVIVLDEEQKMLKLLELLGIYQDQGSVIVFVDKQENADSLLFHSMDPCLEFLPLPAGITRFIWQWA
cccccHHHcccccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHcccHHHHHHHHHHccccEEEcccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHcccccccccccEEEEEcccHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHcccccEEEEccHHHHHHHHHccccEEEEcccEEEEEcccccccccccHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHcccEEEEEcccccccccEEEEEEEEccHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHccccccEEEccccccccccccc
ccccccccccccccccccccccccccccHHHHHHccccHccccccccccccccccHHccccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEEEcccccccHHHHcHHHccccccccccccHHHccccHccccHHHHccccccccccccccccccccccEcccHHHHHccHHHHHHHHHHHcccEEEccccccccccHHHccccHHHHHHHHHcccccccHHHHcHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHcccccccccccEEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHcccEEEEEcccHHHHHHHcccccEEcHHEEEEEEHHHHHHHHHccccHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHcccEEEEEcccccccccEEEEEEEcccHHHHHHHHHHHHHHHccccEEEEEccHHcHHHHHHHHHHccccEEEEcccccccccccc
mvrsrrkrsrsrspspshkrpkesrrdkdrdrrrrsrsherrserdrDRDLERRkeksrgskrrsrsreaerskdhskkeeKDKREKeeeeaafdpskldKEVEATRLELEMQKRRDRIERWRAERKKKDIETIKKDIKsnlssglggsapmkkwnleddsdedendnkdengktaeedidpldAFMQGVHEEMrkvnkpavpttadvkpadsgskpagVVIVTGVVKKSVEKAKGELMEEnqdgleysseeeqEDLTSTAANLASKQKKElskvdhstieylpfrkdfyvevpeiarmtPEEVEKYKEELEGIrvkgkgcprpiktwaqcGVSKKILDALKkqnyekptpiqaqaipaimsGRDLigiaktgsgktvAFVLPLLRhildqppleetdgpmaiimsPTRELCMQIGKEAKKFTKSLGLRVVCVYGGTGISEQISELKRGaeiivctpgRMIDMLAAnsgrvtnlRRVTYIVLDEadrmfdmgfepQVMRIIdnvrpdrqtvmfsatFPRQMEALARRILnkpieiqvggrsvVCKEVEQHVIVLDEEQKMLKLLELLGIYQDQGSVIVFVDKqenadsllfhsmdpcleflplpagiTRFIWQWA
mvrsrrkrsrsrspspshkrpkesrrdkdrdrrrrsrsherrserdrdrdlerrkeksrgskrrsrsreaerskdhskkeekdkrekeeeeaafdpskldkeveatrlelemqkrrdrierwraerkkkdietikkdiksnlssglggsapmkkwnleddsdedendnkdengktaeedidpLDAFMQGVHEEMRKVNKPAVPTTadvkpadsgskpagvvIVTGVVKKSVEKAKGELMEENQDGLEYSSEEEQEDLTSTAANLAskqkkelskvdhstieylpfrkdfyvevPEIARMTPEEVEKYKEELEgirvkgkgcprpiktwaqcgVSKKILDALKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTVAFVLPLLRHILDQPPLEETDGPMAIIMSPTRELCMQIGKEAKKFTKSLGLRVVCVYGGTgiseqiselkrGAEIIVCTPGRMIDMLaansgrvtnlrRVTYIVLDEADRMFDMGFEPQVMRIIDNVRPDRQTVMFSATFPRQMEALARRILNKPIEIQVGGRSVVCKEVEQHVIVLDEEQKMLKLLELLGIYQDQGSVIVFVDKQENADSLLFHSMDPCLEFLPLPAGITRFIWQWA
MVrsrrkrsrsrspspshkrpkesrrdkdrdrrrrsrsherrserdrdrdlerrkeksrgskrrsrsreaerskdhskkeekdkrekeeeeAAFDPSKLDKEVEATRLELEMQKrrdrierwraerkkkdietikkdikSNLSSGLGGSAPMKKWnleddsdedendnkdenGKTAEEDIDPLDAFMQGVHEEMRKVNKPAVPTTADVKPADSGSKPAgvvivtgvvkksvEKAKGELMEENQDGLEYSSEEEQEDLTSTAANLASKQKKELSKVDHSTIEYLPFRKDFYVEVPEIARMTPeevekykeeleGIRVKGKGCPRPIKTWAQCGVSKKILDALKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTVAFVLPLLRHILDQPPLEETDGPMAIIMSPTRELCMQIGKEAKKFTKSLGLRVVCVYGGTGISEQISELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYIVLDEADRMFDMGFEPQVMRIIDNVRPDRQTVMFSATFPRQMEALARRILNKPIEIQVGGRSVVCKEVEQHVIVldeeqkmlkllellGIYQDQGSVIVFVDKQENADSLLFHSMDPCLEFLPLPAGITRFIWQWA
**************************************************************************************************************************************************************************************************************************GVVIVTGVV**************************************************STIEYLPFRKDFYVEVPEIARMTPEEVEKYKEELEGIRVKGKGCPRPIKTWAQCGVSKKILDALKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTVAFVLPLLRHILDQPPLEETDGPMAIIMSPTRELCMQIGKEAKKFTKSLGLRVVCVYGGTGISEQISELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYIVLDEADRMFDMGFEPQVMRIIDNVRPDRQTVMFSATFPRQMEALARRILNKPIEIQVGGRSVVCKEVEQHVIVLDEEQKMLKLLELLGIYQDQGSVIVFVDKQENADSLLFHSMDPCLEFLPLPAGITRFIWQW*
**************************************************************************************************************************************************************************************LDAFMQG**************************************************************************************DHSTIEYLPFRKDFYVEVPEIARMTPEEVEKYKEELEGIRVKGKGCPRPIKTWAQCGVSKKILDALKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTVAFVLPLLRHILDQPPLEETDGPMAIIMSPTRELCMQIGKEAKKFTKSLGLRVVCVYGGTGISEQISELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYIVLDEADRMFDMGFEPQVMRIIDNVRPDRQTVMFSATFPRQMEALARRILNKPIEIQVGGRSVVCKEVEQHVIVLDEEQKMLKLLELLGIYQDQGSVIVFVDKQENADSLLFHSMDPCLEFLPLPAGIT*******
*************************************************************************************************KLDKEVEATRLELEMQKRRDRIERWRAERKKKDIETIKKDIKSNLSSGLGGSAPMKKWNLE***************KTAEEDIDPLDAFMQGVHEEMRKVNKPAVP***********SKPAGVVIVTGVVKKSVEKAKGELME*******************TAAN************DHSTIEYLPFRKDFYVEVPEIARMTPEEVEKYKEELEGIRVKGKGCPRPIKTWAQCGVSKKILDALKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTVAFVLPLLRHILDQPPLEETDGPMAIIMSPTRELCMQIGKEAKKFTKSLGLRVVCVYGGTGISEQISELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYIVLDEADRMFDMGFEPQVMRIIDNVRPDRQTVMFSATFPRQMEALARRILNKPIEIQVGGRSVVCKEVEQHVIVLDEEQKMLKLLELLGIYQDQGSVIVFVDKQENADSLLFHSMDPCLEFLPLPAGITRFIWQWA
*********************************************************************************************************TRLELEMQKRRDRIERWRAER****************************************************DIDPLDAFMQGVHEEMRKVNK*****************PAGVVIVTGVVKKSVEKAKGELMEENQDGLEYSSEEE*EDLTSTAANLASKQKKELSKVDHSTIEYLPFRKDFYVEVPEIARMTPEEVEKYKEELEGIRVKGKGCPRPIKTWAQCGVSKKILDALKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTVAFVLPLLRHILDQPPLEETDGPMAIIMSPTRELCMQIGKEAKKFTKSLGLRVVCVYGGTGISEQISELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYIVLDEADRMFDMGFEPQVMRIIDNVRPDRQTVMFSATFPRQMEALARRILNKPIEIQVGGRSVVCKEVEQHVIVLDEEQKMLKLLELLGIYQDQGSVIVFVDKQENADSLLFHSMDPCLEFLPLPAG*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRSRRKRSRSRSPSPSHKRPKESRRDKDRDRRRRSRSHERRSERDRDRDLERRKEKSRGSKRRSRSRExxxxxxxxxxxxxxxxxxxxxEAAFDPSKLDKEVExxxxxxxxxxxxxxxxxxxxxRKKKDIETIKKDIKSNLSSGLGGSAPMKKWNLEDDSDEDENDNKDENGKTAEEDIDPLDAFMQGVHEEMRKVNKPAVPTTADVKPADSGSKPAGVVIVTGVVKKSVEKAKGELMEENQDGLEYSSEEEQEDLTSTAANLASKQKKELSKVDHSTIEYLPFRKDFYVEVPEIARMTPEEVEKYKEELEGIRVKGKGCPRPIKTWAQCGVSKKILDALKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTVAFVLPLLRHILDQPPLEETDGPMAIIMSPTRELCMQIGKEAKKFTKSLGLRVVCVYGGTGISEQISELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYIVLDEADRMFDMGFEPQVMRIIDNVRPDRQTVMFSATFPRQMEALARRILNKPIEIQVGGRSVVCKEVEQHVIVLDEEQKMLKLLELLGIYQDQGSVIVFVDKQENADSLLFHSMDPCLEFLPLPAGITRFIWQWA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query615 2.2.26 [Sep-21-2011]
Q4TVV3 1018 Probable ATP-dependent RN yes N/A 0.819 0.495 0.637 0.0
Q569Z5 1032 Probable ATP-dependent RN yes N/A 0.873 0.520 0.606 1e-175
Q62780 1032 Probable ATP-dependent RN yes N/A 0.808 0.481 0.636 1e-175
Q7L014 1031 Probable ATP-dependent RN yes N/A 0.808 0.482 0.634 1e-174
Q5R6D8 1032 Probable ATP-dependent RN yes N/A 0.808 0.481 0.632 1e-173
Q8H0U8 1166 DEAD-box ATP-dependent RN yes N/A 0.879 0.463 0.452 1e-137
Q84UQ1 1049 DEAD-box ATP-dependent RN yes N/A 0.788 0.462 0.469 1e-129
Q9SF41 989 DEAD-box ATP-dependent RN no N/A 0.760 0.473 0.476 1e-128
Q1DHB2 1197 Pre-mRNA-processing ATP-d N/A N/A 0.655 0.336 0.524 1e-128
Q0J7Y8 947 DEAD-box ATP-dependent RN no N/A 0.808 0.524 0.476 1e-126
>sp|Q4TVV3|DDX46_DANRE Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio GN=ddx46 PE=2 SV=1 Back     alignment and function desciption
 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/516 (63%), Positives = 402/516 (77%), Gaps = 12/516 (2%)

Query: 100 DKEVEATRLELEMQKRRDRIERWRAERKKKDIETIKKDIKSNLSSGLGGSAPMKKWNLED 159
           D++ +   LE EM+KR++R+E+WR E++K  +E I  +IK  L     G    KKW+LED
Sbjct: 116 DQDFDQNTLEEEMRKRKERVEKWREEQRKTAMENIG-EIKKELEEMKQG----KKWSLED 170

Query: 160 DSDEDENDNKDENGKTAEED-----IDPLDAFMQGVHEEMRKVNKPAVPTTADVKPADSG 214
           D +E +   + E  +  EE+     +DPLDA+M+ V EE++K N   +    D K   S 
Sbjct: 171 DDEEQDKAAEAEESERMEEEEVGEEVDPLDAYMEEVKEEVKKFNMGTMKGANDKKGGMSV 230

Query: 215 SKPAGVVIVTGVVKKSVEKAKGELMEENQDGLEYSSEEEQEDLTSTAANLASKQKKELSK 274
           +K   VV    +   +  K KGELME +QD +EYSSEEE+ DL +      +KQ+K L  
Sbjct: 231 TKVVTVVKTKKMPHAT--KKKGELMENDQDAMEYSSEEEEVDLQTALTGFQTKQRKVLEP 288

Query: 275 VDHSTIEYLPFRKDFYVEVPEIARMTPEEVEKYKEELEGIRVKGKGCPRPIKTWAQCGVS 334
           VDH  I+Y PFRK+FYVEVPE+ARM+PEEV +Y+ ELEGI VKGKGCP+PIKTW QCG+S
Sbjct: 289 VDHQKIQYEPFRKNFYVEVPELARMSPEEVSEYRLELEGISVKGKGCPKPIKTWVQCGIS 348

Query: 335 KKILDALKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTVAFVLPLLRHILDQPPL 394
            K+L+ALKK NYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKT+AF+LP+ RHILDQ P+
Sbjct: 349 MKVLNALKKHNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHILDQRPV 408

Query: 395 EETDGPMAIIMSPTRELCMQIGKEAKKFTKSLGLRVVCVYGGTGISEQISELKRGAEIIV 454
            E +GP+A+IM+PTREL +QI KE KKF+KSL LRVVCVYGGTGISEQI+ELKRGAEIIV
Sbjct: 409 GEAEGPLAVIMTPTRELALQITKECKKFSKSLALRVVCVYGGTGISEQIAELKRGAEIIV 468

Query: 455 CTPGRMIDMLAANSGRVTNLRRVTYIVLDEADRMFDMGFEPQVMRIIDNVRPDRQTVMFS 514
           CTPGRMIDML AN+GRVTNLRRVTY+V+DEADRMFDMGFEPQVMRI+DNVRPDRQTVMFS
Sbjct: 469 CTPGRMIDMLGANNGRVTNLRRVTYVVIDEADRMFDMGFEPQVMRIVDNVRPDRQTVMFS 528

Query: 515 ATFPRQMEALARRILNKPIEIQVGGRSVVCKEVEQHVIVLDEEQKMLKLLELLGIYQDQG 574
           ATFPR MEALARRIL+KP+E+QVGGRSVVC +VEQHVIV++EE+K LKLLE+LG YQ++G
Sbjct: 529 ATFPRTMEALARRILSKPVEVQVGGRSVVCSDVEQHVIVIEEEKKFLKLLEILGHYQEKG 588

Query: 575 SVIVFVDKQENADSLLFHSMDPCLEFLPLPAGITRF 610
           SVI+FVDKQE+AD LL   M      + L  GI ++
Sbjct: 589 SVIIFVDKQEHADGLLKDLMKASYPCMSLHGGIDQY 624
Plays an essential role in splicing, either prior to, or during A complex formation.
Danio rerio (taxid: 7955)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q569Z5|DDX46_MOUSE Probable ATP-dependent RNA helicase DDX46 OS=Mus musculus GN=Ddx46 PE=1 SV=2 Back     alignment and function description
>sp|Q62780|DDX46_RAT Probable ATP-dependent RNA helicase DDX46 OS=Rattus norvegicus GN=Ddx46 PE=1 SV=1 Back     alignment and function description
>sp|Q7L014|DDX46_HUMAN Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens GN=DDX46 PE=1 SV=2 Back     alignment and function description
>sp|Q5R6D8|DDX46_PONAB Probable ATP-dependent RNA helicase DDX46 OS=Pongo abelii GN=DDX46 PE=2 SV=1 Back     alignment and function description
>sp|Q8H0U8|RH42_ARATH DEAD-box ATP-dependent RNA helicase 42 OS=Arabidopsis thaliana GN=RH42 PE=1 SV=2 Back     alignment and function description
>sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 Back     alignment and function description
>sp|Q9SF41|RH45_ARATH DEAD-box ATP-dependent RNA helicase 45 OS=Arabidopsis thaliana GN=RH45 PE=2 SV=1 Back     alignment and function description
>sp|Q1DHB2|PRP5_COCIM Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Coccidioides immitis (strain RS) GN=PRP5 PE=3 SV=1 Back     alignment and function description
>sp|Q0J7Y8|RH45_ORYSJ DEAD-box ATP-dependent RNA helicase 45 OS=Oryza sativa subsp. japonica GN=Os08g0154200 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query615
307202910 1034 Probable ATP-dependent RNA helicase DDX4 0.850 0.505 0.706 0.0
383854537 1035 PREDICTED: probable ATP-dependent RNA he 0.852 0.506 0.703 0.0
193683325 985 PREDICTED: probable ATP-dependent RNA he 0.816 0.509 0.704 0.0
345482984 1039 PREDICTED: probable ATP-dependent RNA he 0.884 0.523 0.680 0.0
340724160 1030 PREDICTED: LOW QUALITY PROTEIN: probable 0.852 0.508 0.698 0.0
350408906 1030 PREDICTED: probable ATP-dependent RNA he 0.852 0.508 0.702 0.0
242009038 1014 DEAD box ATP-dependent RNA helicase, put 0.957 0.580 0.676 0.0
307189252 1028 Probable ATP-dependent RNA helicase DDX4 0.926 0.554 0.648 0.0
328786029 1030 PREDICTED: probable ATP-dependent RNA he 0.852 0.508 0.705 0.0
380022024713 PREDICTED: probable ATP-dependent RNA he 0.884 0.762 0.686 0.0
>gi|307202910|gb|EFN82130.1| Probable ATP-dependent RNA helicase DDX46 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/546 (70%), Positives = 449/546 (82%), Gaps = 23/546 (4%)

Query: 82  KDKREKEEEEAAFDPSKLDKEVEATRLELEMQKRRDRIERWRAERKKKDIETIKKDIKSN 141
           KDK + + EE  FD +KLDKE E  RLELEMQKRR+RIERWRAERKKK++E  KKD K++
Sbjct: 111 KDKEKGDNEELPFDHTKLDKEEEQKRLELEMQKRRERIERWRAERKKKELEATKKDGKAS 170

Query: 142 LSSGLGGSAPMKKWNLEDDSDED----ENDNKD--------------ENGKTAEEDIDPL 183
           + + L    PMKKW+LEDDSDE+    +N+ K+              E  K  EE++DPL
Sbjct: 171 ILANL--QLPMKKWSLEDDSDEETPVVQNNTKEAKEEGVKEEVEEVKEEVKDEEEEVDPL 228

Query: 184 DAFMQGVHEEMRKVNK--PAVPTTADVKPADSGSKPAGVVIVTGVVKKSVEKAKGELMEE 241
           DAFM  V EE+RKVNK     P  A+     S ++  GVVIVTGV KK ++K KGEL+E+
Sbjct: 229 DAFMAEVQEEVRKVNKLDNKAPKNAN-NGTSSATQSGGVVIVTGVAKKKIQKQKGELIEQ 287

Query: 242 NQDGLEYSSEEEQEDLTSTAANLASKQKKELSKVDHSTIEYLPFRKDFYVEVPEIARMTP 301
           NQDGLEYSSEEE E+L  TAA +A+KQK+EL+KVDH+T +Y PFRK FYVEVPEIARMTP
Sbjct: 288 NQDGLEYSSEEEGENLHETAAGIANKQKRELAKVDHATTDYQPFRKSFYVEVPEIARMTP 347

Query: 302 EEVEKYKEELEGIRVKGKGCPRPIKTWAQCGVSKKILDALKKQNYEKPTPIQAQAIPAIM 361
           EEVE YKEELEGIRVKGKGCP+PIK+WAQCGV+KK L+ LKK  YEKPTPIQ QAIPAIM
Sbjct: 348 EEVEIYKEELEGIRVKGKGCPKPIKSWAQCGVTKKELEVLKKLGYEKPTPIQCQAIPAIM 407

Query: 362 SGRDLIGIAKTGSGKTVAFVLPLLRHILDQPPLEETDGPMAIIMSPTRELCMQIGKEAKK 421
           SGRDLIGIAKTGSGKT+AF+LP+ RHILDQPPL + DGP+A+IM+PTRELCMQIG+++KK
Sbjct: 408 SGRDLIGIAKTGSGKTLAFLLPMFRHILDQPPLADGDGPIALIMTPTRELCMQIGRDSKK 467

Query: 422 FTKSLGLRVVCVYGGTGISEQISELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYIV 481
           FTKSLGL  VCVYGGTGISEQI+ELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTY+V
Sbjct: 468 FTKSLGLSHVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVV 527

Query: 482 LDEADRMFDMGFEPQVMRIIDNVRPDRQTVMFSATFPRQMEALARRILNKPIEIQVGGRS 541
           LDEADRMFDMGFEPQVMRI++NVRPDRQTV+FSATFPRQMEALARRIL +P+E+QVGGRS
Sbjct: 528 LDEADRMFDMGFEPQVMRIMENVRPDRQTVLFSATFPRQMEALARRILTRPVEVQVGGRS 587

Query: 542 VVCKEVEQHVIVLDEEQKMLKLLELLGIYQDQGSVIVFVDKQENADSLLFHSMDPCLEFL 601
           VVCK+VEQHV+VL+E+QK  KLLE+LG YQD+GS I+FVDKQENAD+LL   M      +
Sbjct: 588 VVCKDVEQHVVVLEEDQKFYKLLEILGHYQDKGSAIIFVDKQENADTLLKDLMKASYSCM 647

Query: 602 PLPAGI 607
            L  GI
Sbjct: 648 SLHGGI 653

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383854537|ref|XP_003702777.1| PREDICTED: probable ATP-dependent RNA helicase DDX46-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|193683325|ref|XP_001948746.1| PREDICTED: probable ATP-dependent RNA helicase DDX46-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|345482984|ref|XP_001603634.2| PREDICTED: probable ATP-dependent RNA helicase DDX46-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340724160|ref|XP_003400452.1| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase DDX46-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350408906|ref|XP_003488552.1| PREDICTED: probable ATP-dependent RNA helicase DDX46-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|242009038|ref|XP_002425300.1| DEAD box ATP-dependent RNA helicase, putative [Pediculus humanus corporis] gi|212509065|gb|EEB12562.1| DEAD box ATP-dependent RNA helicase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307189252|gb|EFN73695.1| Probable ATP-dependent RNA helicase DDX46 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328786029|ref|XP_001122722.2| PREDICTED: probable ATP-dependent RNA helicase DDX46-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380022024|ref|XP_003694855.1| PREDICTED: probable ATP-dependent RNA helicase DDX46-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query615
FB|FBgn0030631 1224 CG6227 [Drosophila melanogaste 0.691 0.347 0.672 1e-152
ZFIN|ZDB-GENE-030131-667 1035 ddx46 "DEAD (Asp-Glu-Ala-Asp) 0.700 0.416 0.651 6.4e-147
UNIPROTKB|E1BSC0 1031 DDX46 "Uncharacterized protein 0.704 0.419 0.651 9.3e-146
MGI|MGI:1920895 1032 Ddx46 "DEAD (Asp-Glu-Ala-Asp) 0.704 0.419 0.644 3.6e-144
RGD|708480 1032 Ddx46 "DEAD (Asp-Glu-Ala-Asp) 0.704 0.419 0.644 3.6e-144
UNIPROTKB|Q62780 1032 Ddx46 "Probable ATP-dependent 0.704 0.419 0.644 3.6e-144
UNIPROTKB|I3LR20 1032 DDX46 "Uncharacterized protein 0.710 0.423 0.639 1.2e-143
UNIPROTKB|F1PK90 1032 DDX46 "Uncharacterized protein 0.702 0.418 0.643 1.6e-143
UNIPROTKB|Q7L014 1031 DDX46 "Probable ATP-dependent 0.702 0.419 0.643 1.6e-143
UNIPROTKB|F1MX40 1032 DDX46 "Uncharacterized protein 0.702 0.418 0.643 2.6e-143
FB|FBgn0030631 CG6227 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1470 (522.5 bits), Expect = 1.0e-152, Sum P(2) = 1.0e-152
 Identities = 292/434 (67%), Positives = 335/434 (77%)

Query:   177 EEDIDPLDAFMQGVHEEMRKVNKPAVPTTADVKPADSGSKPAXXXXXXXXXXXXXEKAKG 236
             E++IDPLDA+MQ V+ EMR+VN    P      PA S                     KG
Sbjct:   370 EDEIDPLDAYMQEVNNEMRRVNNFVNP------PAKS---QGVVILTGVAKKKTTTLKKG 420

Query:   237 ELMEENQDGLEYSSEEEQEDLTSTAANLASKQKKELSKVDHSTIEYLPFRKDFYVEVPEI 296
             E++E+N D LEYSSE+E ED+  TA NLA K +KEL+K+DHS++ Y PFRK+FYVEVPE+
Sbjct:   421 EVIEQNMDSLEYSSEDELEDIRDTAVNLAMKHRKELAKIDHSSVTYAPFRKNFYVEVPEL 480

Query:   297 ARMTPXXXXXXXXXXXGIRVKGKGCPRPIKTWAQCGVSKKILDALKKQNYEKPTPIQAQA 356
              RMT            GI+VKGKGCP+PIKTWAQCGVSKK ++ L++  +EKPTPIQ QA
Sbjct:   481 TRMTAADVEKYRSDLEGIQVKGKGCPKPIKTWAQCGVSKKEMEVLRRLGFEKPTPIQCQA 540

Query:   357 IPAIMSGRDLIGIAKTGSGKTVAFVLPLLRHILDQPPLEETDGPMAIIMSPTRELCMQIG 416
             IPAIMSGRDLIGIAKTGSGKT+AF+LP+ RHILDQP +E+ DG +AIIM+PTRELCMQIG
Sbjct:   541 IPAIMSGRDLIGIAKTGSGKTLAFILPMFRHILDQPSMEDGDGAIAIIMAPTRELCMQIG 600

Query:   417 KEAKKFTKSLGLRVVCVYGGTGISEQISELKRGAEIIVCTPGRMIDMLAANSGRVTNLRR 476
             K+ +KF+KSLGLR VCVYGGTGISEQI+ELKRGAEIIVCTPGRMIDMLAANSGRVTNLRR
Sbjct:   601 KDIRKFSKSLGLRPVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRR 660

Query:   477 VTYIVLDEADRMFDMGFEPQVMRIIDNVRPDRQTVMFSATFPRQMEALARRILNKPIEIQ 536
             VTY+VLDEADRMFDMGFEPQVMRIIDNVRPDRQTVMFSATFPRQMEALARRIL KPIE+ 
Sbjct:   661 VTYVVLDEADRMFDMGFEPQVMRIIDNVRPDRQTVMFSATFPRQMEALARRILKKPIEVI 720

Query:   537 VGGRSVVCKEVEQHVIVXXXXXXXXXXXXXXGIYQDQGSVIVFVDKQENADSLLFHSMDP 596
             VGGRSVVCKEVEQHV++              GIYQ+ GS+IVFVDKQENAD LL   M  
Sbjct:   721 VGGRSVVCKEVEQHVVILNDDAKFFKLLELLGIYQEAGSIIVFVDKQENADILLRDLMKA 780

Query:   597 CLEFLPLPAGITRF 610
                 + L  GI +F
Sbjct:   781 SYPCMSLHGGIDQF 794
GO:0003729 "mRNA binding" evidence=ISS
GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS
GO:0003724 "RNA helicase activity" evidence=ISS
GO:0005681 "spliceosomal complex" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=IMP
GO:0005634 "nucleus" evidence=IC
ZFIN|ZDB-GENE-030131-667 ddx46 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 46" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BSC0 DDX46 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1920895 Ddx46 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 46" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|708480 Ddx46 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 46" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q62780 Ddx46 "Probable ATP-dependent RNA helicase DDX46" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LR20 DDX46 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PK90 DDX46 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q7L014 DDX46 "Probable ATP-dependent RNA helicase DDX46" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MX40 DDX46 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9P7C7PRP11_SCHPO3, ., 6, ., 4, ., 1, 30.520.66990.4063yesN/A
Q4TVV3DDX46_DANRE3, ., 6, ., 4, ., 1, 30.63750.81950.4950yesN/A
Q4WT99PRP5_ASPFU3, ., 6, ., 4, ., 1, 30.51080.68940.3501yesN/A
Q5BDW4PRP5_EMENI3, ., 6, ., 4, ., 1, 30.52080.64710.3393yesN/A
Q62780DDX46_RAT3, ., 6, ., 4, ., 1, 30.63600.80810.4815yesN/A
Q6BML1PRP5_DEBHA3, ., 6, ., 4, ., 1, 30.55670.56420.3800yesN/A
P0CQ98PRP5_CRYNJ3, ., 6, ., 4, ., 1, 30.58050.52520.3013yesN/A
A2QQA8PRP5_ASPNC3, ., 6, ., 4, ., 1, 30.60050.53650.2796yesN/A
Q553B1DDX46_DICDI3, ., 6, ., 4, ., 1, 30.58250.53490.2858yesN/A
Q5R6D8DDX46_PONAB3, ., 6, ., 4, ., 1, 30.63200.80810.4815yesN/A
Q4IP34PRP5_GIBZE3, ., 6, ., 4, ., 1, 30.51020.63250.3222yesN/A
Q7L014DDX46_HUMAN3, ., 6, ., 4, ., 1, 30.63400.80810.4820yesN/A
Q569Z5DDX46_MOUSE3, ., 6, ., 4, ., 1, 30.60630.87310.5203yesN/A
A3LQ55PRP5_PICST3, ., 6, ., 4, ., 1, 30.5250.55930.3931yesN/A
Q2U2J6PRP5_ASPOR3, ., 6, ., 4, ., 1, 30.51850.65040.3372yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query615
PTZ00110 545 PTZ00110, PTZ00110, helicase; Provisional 1e-110
cd00268203 cd00268, DEADc, DEAD-box helicases 4e-97
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 2e-85
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 7e-66
PRK11776 460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 8e-61
PRK10590 456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 1e-60
PLN00206 518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 2e-60
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-57
PRK11192 434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 9e-48
PRK04837 423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 3e-47
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 3e-44
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 8e-44
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 1e-41
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 2e-41
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 2e-33
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 2e-14
COG1205 851 COG1205, COG1205, Distinct helicase family with a 2e-11
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 5e-11
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 5e-09
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 1e-08
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 1e-06
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 2e-06
PRK12678672 PRK12678, PRK12678, transcription termination fact 6e-06
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 1e-05
PRK12678672 PRK12678, PRK12678, transcription termination fact 1e-05
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-05
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 2e-05
TIGR03817 742 TIGR03817, DECH_helic, helicase/secretion neighbor 3e-05
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 4e-05
TIGR04121 803 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA 6e-05
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-04
pfam1287197 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 3 1e-04
PRK12678672 PRK12678, PRK12678, transcription termination fact 2e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-04
pfam1287197 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 3 2e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 9e-04
COG1061 442 COG1061, SSL2, DNA or RNA helicases of superfamily 9e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.001
PRK12678672 PRK12678, PRK12678, transcription termination fact 0.002
PRK12678672 PRK12678, PRK12678, transcription termination fact 0.003
pfam1287197 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 3 0.003
PRK108111068 PRK10811, rne, ribonuclease E; Reviewed 0.003
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 0.003
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 0.004
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information 
 Score =  341 bits (877), Expect = e-110
 Identities = 144/328 (43%), Positives = 216/328 (65%), Gaps = 6/328 (1%)

Query: 265 ASKQKKELSKVDHSTIEYLPFRKDFYVEVPEIARMTPEEVEKYKEELEGIRVKGKGCPRP 324
           +S   K L  +D  +I  +PF K+FY E PE++ ++ +EV++ ++E E   + G+  P+P
Sbjct: 69  SSTLGKRLQPIDWKSINLVPFEKNFYKEHPEVSALSSKEVDEIRKEKEITIIAGENVPKP 128

Query: 325 IKTWAQCGVSKKILDALKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTVAFVLPL 384
           + ++        IL +LK   + +PTPIQ Q  P  +SGRD+IGIA+TGSGKT+AF+LP 
Sbjct: 129 VVSFEYTSFPDYILKSLKNAGFTEPTPIQVQGWPIALSGRDMIGIAETGSGKTLAFLLPA 188

Query: 385 LRHILDQPPLEETDGPMAIIMSPTRELCMQIGKEAKKFTKSLGLRVVCVYGGTGISEQIS 444
           + HI  QP L   DGP+ ++++PTREL  QI ++  KF  S  +R    YGG     QI 
Sbjct: 189 IVHINAQPLLRYGDGPIVLVLAPTRELAEQIREQCNKFGASSKIRNTVAYGGVPKRGQIY 248

Query: 445 ELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYIVLDEADRMFDMGFEPQVMRIIDNV 504
            L+RG EI++  PGR+ID L +N   VTNLRRVTY+VLDEADRM DMGFEPQ+ +I+  +
Sbjct: 249 ALRRGVEILIACPGRLIDFLESN---VTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQI 305

Query: 505 RPDRQTVMFSATFPRQMEALARRIL-NKPIEIQVGGRSV-VCKEVEQHVIVLDEEQKMLK 562
           RPDRQT+M+SAT+P+++++LAR +   +P+ + VG   +  C  ++Q V V++E +K  K
Sbjct: 306 RPDRQTLMWSATWPKEVQSLARDLCKEEPVHVNVGSLDLTACHNIKQEVFVVEEHEKRGK 365

Query: 563 LLELLG-IYQDQGSVIVFVDKQENADSL 589
           L  LL  I +D   +++FV+ ++ AD L
Sbjct: 366 LKMLLQRIMRDGDKILIFVETKKGADFL 393

Length = 545
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|221821 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 38-associated hydrophilic C-term Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|221821 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 38-associated hydrophilic C-term Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|221821 pfam12871, PRP38_assoc, Pre-mRNA-splicing factor 38-associated hydrophilic C-term Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 615
KOG0334|consensus 997 100.0
KOG0339|consensus 731 100.0
KOG0331|consensus 519 100.0
KOG0336|consensus 629 100.0
PTZ00110 545 helicase; Provisional 100.0
KOG0333|consensus 673 100.0
KOG0341|consensus 610 100.0
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
KOG0330|consensus 476 100.0
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0338|consensus 691 100.0
KOG0335|consensus 482 100.0
KOG0328|consensus400 100.0
KOG0343|consensus 758 100.0
KOG0342|consensus 543 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
KOG0345|consensus 567 100.0
KOG0326|consensus459 100.0
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 100.0
KOG0346|consensus 569 100.0
KOG0340|consensus 442 100.0
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0348|consensus 708 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0347|consensus 731 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0337|consensus 529 100.0
KOG0327|consensus397 100.0
KOG4284|consensus 980 100.0
KOG0332|consensus 477 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0344|consensus 593 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
KOG0329|consensus387 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 100.0
KOG0350|consensus 620 99.98
PRK01172 674 ski2-like helicase; Provisional 99.97
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.97
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.97
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.97
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.97
PRK10689 1147 transcription-repair coupling factor; Provisional 99.97
PRK14701 1638 reverse gyrase; Provisional 99.97
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.97
COG1202 830 Superfamily II helicase, archaea-specific [General 99.96
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 99.96
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 99.96
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.95
PHA02653 675 RNA helicase NPH-II; Provisional 99.95
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.95
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.95
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.95
PHA02558 501 uvsW UvsW helicase; Provisional 99.95
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.94
COG1205 851 Distinct helicase family with a unique C-terminal 99.94
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.94
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 99.94
KOG0349|consensus 725 99.93
COG1204 766 Superfamily II helicase [General function predicti 99.93
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.93
KOG0952|consensus 1230 99.92
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.92
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.91
PRK13766 773 Hef nuclease; Provisional 99.9
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 99.9
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.9
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.9
KOG0351|consensus 941 99.89
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.89
KOG0352|consensus 641 99.88
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.87
KOG0353|consensus 695 99.87
PRK09694 878 helicase Cas3; Provisional 99.87
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.87
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.86
smart00487201 DEXDc DEAD-like helicases superfamily. 99.86
KOG0951|consensus 1674 99.85
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.85
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.85
PRK05580 679 primosome assembly protein PriA; Validated 99.83
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.82
KOG0354|consensus 746 99.81
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.81
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.8
KOG2340|consensus 698 99.8
KOG0922|consensus 674 99.8
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.78
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.78
TIGR00595 505 priA primosomal protein N'. All proteins in this f 99.77
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.77
KOG0948|consensus 1041 99.76
KOG0923|consensus 902 99.76
KOG0947|consensus 1248 99.76
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.75
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.72
KOG0924|consensus 1042 99.72
KOG0950|consensus 1008 99.71
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 99.71
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.7
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.68
PRK04914 956 ATP-dependent helicase HepA; Validated 99.68
KOG0926|consensus 1172 99.67
KOG0925|consensus 699 99.66
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.65
KOG0920|consensus 924 99.63
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.62
COG4096 875 HsdR Type I site-specific restriction-modification 99.62
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 99.61
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.61
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.59
KOG0385|consensus 971 99.52
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.51
COG1198 730 PriA Primosomal protein N' (replication factor Y) 99.42
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.4
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 99.39
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.36
KOG1123|consensus 776 99.34
KOG0384|consensus 1373 99.34
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.32
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.3
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.29
KOG0949|consensus 1330 99.28
KOG0387|consensus 923 99.25
KOG0951|consensus 1674 99.24
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.24
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.2
smart00488289 DEXDc2 DEAD-like helicases superfamily. 99.18
smart00489289 DEXDc3 DEAD-like helicases superfamily. 99.18
KOG0390|consensus 776 99.12
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.1
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 99.07
COG4889 1518 Predicted helicase [General function prediction on 99.07
KOG1000|consensus 689 99.06
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 99.05
PRK14873 665 primosome assembly protein PriA; Provisional 99.04
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.04
KOG0391|consensus 1958 98.98
KOG0389|consensus 941 98.95
KOG1002|consensus 791 98.91
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 98.89
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 98.8
PRK15483 986 type III restriction-modification system StyLTI en 98.79
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 98.79
KOG0386|consensus 1157 98.78
KOG0392|consensus 1549 98.76
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 98.7
COG0610 962 Type I site-specific restriction-modification syst 98.67
KOG0388|consensus 1185 98.64
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 98.62
KOG0952|consensus1230 98.62
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 98.59
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 98.59
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.55
KOG4150|consensus 1034 98.51
KOG4439|consensus 901 98.47
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 98.46
PRK05298 652 excinuclease ABC subunit B; Provisional 98.4
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.39
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 98.38
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 98.33
KOG0953|consensus 700 98.33
PRK10536262 hypothetical protein; Provisional 98.32
KOG1802|consensus 935 98.31
KOG0921|consensus 1282 98.24
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 98.19
TIGR00376 637 DNA helicase, putative. The gene product may repre 98.18
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 98.13
PRK10875 615 recD exonuclease V subunit alpha; Provisional 98.08
KOG1803|consensus 649 98.05
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 98.01
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 98.0
COG3587 985 Restriction endonuclease [Defense mechanisms] 98.0
KOG1015|consensus 1567 97.92
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.85
KOG1132|consensus 945 97.85
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 97.82
TIGR02768 744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.71
PRK08181269 transposase; Validated 97.69
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 97.69
PRK14974336 cell division protein FtsY; Provisional 97.68
PF1324576 AAA_19: Part of AAA domain 97.67
PRK13889 988 conjugal transfer relaxase TraA; Provisional 97.62
PRK04296190 thymidine kinase; Provisional 97.6
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.6
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.59
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.57
KOG1805|consensus 1100 97.56
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.55
PRK06526254 transposase; Provisional 97.54
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.5
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.47
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.46
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 97.44
PRK13826 1102 Dtr system oriT relaxase; Provisional 97.43
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 97.43
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 97.36
PF03354 477 Terminase_1: Phage Terminase ; InterPro: IPR005021 97.27
KOG4368|consensus757 97.26
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.23
KOG1016|consensus 1387 97.19
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.19
PRK06921266 hypothetical protein; Provisional 97.18
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 97.17
PHA02533 534 17 large terminase protein; Provisional 97.16
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.16
PRK07952244 DNA replication protein DnaC; Validated 97.13
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 97.04
PRK06835329 DNA replication protein DnaC; Validated 97.04
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 97.04
PRK08116268 hypothetical protein; Validated 97.03
KOG1131|consensus 755 97.0
KOG1001|consensus 674 97.0
TIGR01547 396 phage_term_2 phage terminase, large subunit, PBSX 97.0
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 96.99
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 96.98
PHA03333 752 putative ATPase subunit of terminase; Provisional 96.95
PRK00771 437 signal recognition particle protein Srp54; Provisi 96.95
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 96.9
smart00382148 AAA ATPases associated with a variety of cellular 96.88
PRK08727233 hypothetical protein; Validated 96.87
PRK14087 450 dnaA chromosomal replication initiation protein; P 96.87
PRK05642234 DNA replication initiation factor; Validated 96.86
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 96.81
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.8
PRK06893229 DNA replication initiation factor; Validated 96.78
TIGR00064272 ftsY signal recognition particle-docking protein F 96.77
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 96.74
PRK10867433 signal recognition particle protein; Provisional 96.73
PRK00149450 dnaA chromosomal replication initiation protein; R 96.73
PRK12377248 putative replication protein; Provisional 96.68
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 96.68
PRK09183259 transposase/IS protein; Provisional 96.68
cd01124187 KaiC KaiC is a circadian clock protein primarily f 96.67
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.66
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 96.65
PRK08084235 DNA replication initiation factor; Provisional 96.65
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.6
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 96.56
TIGR00362405 DnaA chromosomal replication initiator protein Dna 96.54
KOG0989|consensus346 96.53
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 96.53
TIGR00959428 ffh signal recognition particle protein. This mode 96.45
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 96.44
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 96.43
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 96.42
PRK11054 684 helD DNA helicase IV; Provisional 96.4
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 96.4
KOG0298|consensus 1394 96.39
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 96.36
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 96.35
PRK12422 445 chromosomal replication initiation protein; Provis 96.35
PRK14088 440 dnaA chromosomal replication initiation protein; P 96.31
PRK14086617 dnaA chromosomal replication initiation protein; P 96.3
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.29
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 96.27
PRK08903227 DnaA regulatory inactivator Hda; Validated 96.27
PRK05707328 DNA polymerase III subunit delta'; Validated 96.26
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 96.23
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 96.2
COG2109198 BtuR ATP:corrinoid adenosyltransferase [Coenzyme m 96.2
PHA03368 738 DNA packaging terminase subunit 1; Provisional 96.18
COG4626 546 Phage terminase-like protein, large subunit [Gener 96.17
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 96.16
PTZ00112 1164 origin recognition complex 1 protein; Provisional 96.13
COG0593408 DnaA ATPase involved in DNA replication initiation 96.08
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 96.08
PF13173128 AAA_14: AAA domain 96.05
cd03115173 SRP The signal recognition particle (SRP) mediates 96.05
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 96.04
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 96.04
PHA02544316 44 clamp loader, small subunit; Provisional 96.03
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 96.03
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 95.99
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 95.97
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 95.97
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 95.95
PRK12402337 replication factor C small subunit 2; Reviewed 95.94
PRK10416318 signal recognition particle-docking protein FtsY; 95.93
PF00004132 AAA: ATPase family associated with various cellula 95.91
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 95.86
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.85
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 95.85
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 95.84
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 95.82
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 95.82
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 95.81
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 95.81
COG2256 436 MGS1 ATPase related to the helicase subunit of the 95.81
PRK08769319 DNA polymerase III subunit delta'; Validated 95.8
PRK11331459 5-methylcytosine-specific restriction enzyme subun 95.75
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 95.74
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 95.73
PF02572172 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase 95.69
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 95.67
PRK08533230 flagellar accessory protein FlaH; Reviewed 95.61
PRK04195 482 replication factor C large subunit; Provisional 95.6
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 95.58
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 95.53
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 95.45
PRK13894319 conjugal transfer ATPase TrbB; Provisional 95.44
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 95.44
PTZ00293211 thymidine kinase; Provisional 95.43
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 95.42
PRK08939306 primosomal protein DnaI; Reviewed 95.42
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 95.41
PRK13833323 conjugal transfer protein TrbB; Provisional 95.4
COG0552340 FtsY Signal recognition particle GTPase [Intracell 95.38
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 95.38
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 95.38
KOG0733|consensus802 95.36
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 95.36
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 95.34
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 95.33
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 95.31
PRK11823 446 DNA repair protein RadA; Provisional 95.27
PRK13342 413 recombination factor protein RarA; Reviewed 95.26
KOG0742|consensus630 95.25
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 95.25
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 95.24
PLN03025319 replication factor C subunit; Provisional 95.21
PF05876 557 Terminase_GpA: Phage terminase large subunit (GpA) 95.19
PRK09112351 DNA polymerase III subunit delta'; Validated 95.18
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 95.14
CHL00181287 cbbX CbbX; Provisional 95.06
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 95.06
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 95.01
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 94.99
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; 94.97
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 94.96
PRK00411394 cdc6 cell division control protein 6; Reviewed 94.93
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 94.92
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 94.91
PRK13341 725 recombination factor protein RarA/unknown domain f 94.88
PHA02244383 ATPase-like protein 94.86
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 94.86
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 94.82
COG0470325 HolB ATPase involved in DNA replication [DNA repli 94.81
PRK05973237 replicative DNA helicase; Provisional 94.81
PRK06871325 DNA polymerase III subunit delta'; Validated 94.8
COG3972 660 Superfamily I DNA and RNA helicases [General funct 94.77
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 94.71
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 94.69
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 94.68
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 94.67
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 94.64
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 94.64
PF03237 384 Terminase_6: Terminase-like family; InterPro: IPR0 94.63
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 94.58
PHA00729226 NTP-binding motif containing protein 94.57
PRK06964342 DNA polymerase III subunit delta'; Validated 94.55
COG3973 747 Superfamily I DNA and RNA helicases [General funct 94.52
TIGR02928365 orc1/cdc6 family replication initiation protein. M 94.52
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 94.51
PRK06067234 flagellar accessory protein FlaH; Validated 94.46
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 94.43
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 94.39
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 94.37
PRK07940 394 DNA polymerase III subunit delta'; Validated 94.34
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 94.32
PRK08699325 DNA polymerase III subunit delta'; Validated 94.32
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 94.26
KOG2543|consensus 438 94.24
PRK07471365 DNA polymerase III subunit delta'; Validated 94.14
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 94.14
PRK06090319 DNA polymerase III subunit delta'; Validated 94.13
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 94.13
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 94.12
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 94.12
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 94.05
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 94.03
PRK07993334 DNA polymerase III subunit delta'; Validated 94.0
PRK10689 1147 transcription-repair coupling factor; Provisional 93.92
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 93.91
PRK06904472 replicative DNA helicase; Validated 93.87
KOG0733|consensus 802 93.86
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 93.85
PRK07413382 hypothetical protein; Validated 93.85
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 93.84
cd03239178 ABC_SMC_head The structural maintenance of chromos 93.76
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 93.75
PF05729166 NACHT: NACHT domain 93.75
KOG0738|consensus491 93.72
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 93.64
PRK04841 903 transcriptional regulator MalT; Provisional 93.56
KOG1133|consensus 821 93.54
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 93.53
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 93.53
PRK13851344 type IV secretion system protein VirB11; Provision 93.47
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 93.43
PRK04328249 hypothetical protein; Provisional 93.42
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 93.4
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 93.38
TIGR00665434 DnaB replicative DNA helicase. This model describe 93.34
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 93.31
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 93.29
PRK00440319 rfc replication factor C small subunit; Reviewed 93.28
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 93.26
PRK07004460 replicative DNA helicase; Provisional 93.25
PRK03992389 proteasome-activating nucleotidase; Provisional 93.23
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 93.16
COG2255332 RuvB Holliday junction resolvasome, helicase subun 93.15
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 93.13
KOG0333|consensus673 93.13
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 93.1
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 93.07
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 93.06
PRK08506472 replicative DNA helicase; Provisional 93.06
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 93.02
PRK07413 382 hypothetical protein; Validated 93.01
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 92.94
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 92.85
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 92.85
CHL00176 638 ftsH cell division protein; Validated 92.84
COG1485367 Predicted ATPase [General function prediction only 92.83
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 92.67
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 92.62
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 92.6
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 92.57
KOG0741|consensus 744 92.49
PRK10436462 hypothetical protein; Provisional 92.46
PHA00012 361 I assembly protein 92.45
PRK08840464 replicative DNA helicase; Provisional 92.42
PF08648180 DUF1777: Protein of unknown function (DUF1777); In 92.37
PRK08006471 replicative DNA helicase; Provisional 92.3
PRK13764602 ATPase; Provisional 92.23
KOG0652|consensus424 92.21
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 92.17
PHA03372 668 DNA packaging terminase subunit 1; Provisional 92.17
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 92.17
PRK05595444 replicative DNA helicase; Provisional 92.15
PRK08760476 replicative DNA helicase; Provisional 92.12
TIGR00767415 rho transcription termination factor Rho. Members 92.06
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 92.03
PRK06321472 replicative DNA helicase; Provisional 91.98
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 91.97
PRK05636505 replicative DNA helicase; Provisional 91.95
cd01126 384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 91.94
KOG0739|consensus439 91.94
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 91.93
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 91.82
PRK09165497 replicative DNA helicase; Provisional 91.7
KOG0737|consensus386 91.65
KOG2028|consensus 554 91.65
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 91.65
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 91.64
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 91.6
PRK09354349 recA recombinase A; Provisional 91.6
PRK07399314 DNA polymerase III subunit delta'; Validated 91.59
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 91.58
KOG0741|consensus744 91.57
KOG2036|consensus 1011 91.56
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 91.54
KOG0991|consensus333 91.53
PF02534 469 T4SS-DNA_transf: Type IV secretory system Conjugat 91.53
PRK10865 857 protein disaggregation chaperone; Provisional 91.52
KOG2227|consensus 529 91.52
KOG0344|consensus593 91.47
PF12846304 AAA_10: AAA-like domain 91.43
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 91.35
TIGR02012321 tigrfam_recA protein RecA. This model describes or 91.34
COG4152300 ABC-type uncharacterized transport system, ATPase 91.32
PHA00350 399 putative assembly protein 91.2
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 91.16
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 91.15
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 91.11
cd00983325 recA RecA is a bacterial enzyme which has roles in 91.09
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 91.06
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 91.03
PRK06620214 hypothetical protein; Validated 90.98
COG4098441 comFA Superfamily II DNA/RNA helicase required for 90.97
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 90.65
cd01393226 recA_like RecA is a bacterial enzyme which has rol 90.61
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 90.59
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 90.57
PRK13897 606 type IV secretion system component VirD4; Provisio 90.56
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 90.54
cd01128249 rho_factor Transcription termination factor rho is 90.52
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 90.5
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 90.42
COG1221403 PspF Transcriptional regulators containing an AAA- 90.41
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 90.39
KOG0732|consensus 1080 90.33
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 90.28
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 90.17
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 90.13
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 90.09
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 90.03
KOG1513|consensus 1300 89.92
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 89.9
CHL00095 821 clpC Clp protease ATP binding subunit 89.9
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 89.84
>KOG0334|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.5e-71  Score=600.48  Aligned_cols=493  Identities=56%  Similarity=0.894  Sum_probs=413.7

Q ss_pred             HHHHHHHHHHhhhhhHHHHHHHhhhhhHHHhhhhcccccCCCCCCCCCCccCCCCCCCcccccc--------------cc
Q psy12410        104 EATRLELEMQKRRDRIERWRAERKKKDIETIKKDIKSNLSSGLGGSAPMKKWNLEDDSDEDEND--------------NK  169 (615)
Q Consensus       104 ~~~~~e~~~~~r~~r~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kk~~~~~~~~~~~~~--------------~~  169 (615)
                      .+..+.+++.+++.+.+.|.+.+++++........+..++    ....++.|+++++.++....              ..
T Consensus       142 ~~~~l~e~l~~rr~~~e~~~e~k~k~e~~~~~t~~~~~~~----~~~s~k~~~l~~~~d~~~~~~~~~~~s~q~~~~~~~  217 (997)
T KOG0334|consen  142 IQARLAEELRKRRERVEKWKELKRKEEKEKVVTLMLNVSD----EKNSKKLWELEDEDDDDSANPAELGWSEQDVPELMK  217 (997)
T ss_pred             hhhhHHHHHHHHHHHHHHHHHhhhcchHHhhhhhhccccc----ccccccceEecCCCCccccCccccchhhccchhhcc
Confidence            3456778889999999999999888775544221221222    56678999999765544311              00


Q ss_pred             ccCCCCCCCCCChHHHHHhhhHHhhhh-cCCCCCCCCCCCCCCCCCCCCCceeEEeccccchhhh-hccccccc---ccC
Q psy12410        170 DENGKTAEEDIDPLDAFMQGVHEEMRK-VNKPAVPTTADVKPADSGSKPAGVVIVTGVVKKSVEK-AKGELMEE---NQD  244 (615)
Q Consensus       170 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~---~~~  244 (615)
                      ......-+++.+|+|+||..+...... .......        +..     .+............ ..+...+.   +.|
T Consensus       218 ~p~~~~~dd~~d~ld~~m~~~~~~~~~~~~~~~~~--------~~~-----~~~~s~~~~~~~~~~~~g~v~e~~~~~~D  284 (997)
T KOG0334|consen  218 APNLMLVDDEEDPLDAFMEQMVGKVLAKFSNSSHS--------KAQ-----VVEVSKDARKGLNPKLSGFVIEPGLVNGD  284 (997)
T ss_pred             CccccccccccchHHHHHHHHHHHHHHHhcCCCcc--------ccc-----ccccchhhhccCCccccceeccCCcCCcc
Confidence            111123477899999999998755322 2211110        000     00000111111111 22333332   223


Q ss_pred             CCCCCchhhhhhhHHHHHHHHHHhhccCCCCCCCccccCCccccccccChhhhcCCHHHHHHHHhhhcCeEecCCCCCCc
Q psy12410        245 GLEYSSEEEQEDLTSTAANLASKQKKELSKVDHSTIEYLPFRKDFYVEVPEIARMTPEEVEKYKEELEGIRVKGKGCPRP  324 (615)
Q Consensus       245 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~r~~~~~i~~~~~~~p~~  324 (615)
                      ..++..+++ .+....+..+..+.++.+..++|+.+.|.||+++||.+..++..|+..++..|+..+.+|.+.|..+|.|
T Consensus       285 ~~e~~~~~~-~d~~~~~~~~~~~~~~~~~~~~~S~~~~epFRknfy~e~~di~~ms~~eV~~yr~~l~~i~v~g~~~pkp  363 (997)
T KOG0334|consen  285 NEEVELNGS-FDNRNAAKNMNLKAKKNLIQVDHSKISYEPFRKNFYIEVRDIKRMSAAEVDEYRCELDGIKVKGKECPKP  363 (997)
T ss_pred             hhhhhhccc-cchHHHHHHhccccccceeecccccccchhhhhcccccchhHHHHHHHHHHHhhcCccceeeccCCCCcc
Confidence            333333332 4445555566666666788999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHcCCCEEEEccCCCchhHHhHHHHHHHHhcCCCCCCCCCCeEEE
Q psy12410        325 IKTWAQCGVSKKILDALKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTVAFVLPLLRHILDQPPLEETDGPMAII  404 (615)
Q Consensus       325 ~~~~~~~~l~~~l~~~l~~~~~~~~~~~Q~~~i~~i~~~~~~i~~a~TGsGKT~~~~l~~l~~~~~~~~~~~~~~~~~li  404 (615)
                      +++|.++|+...|+..++++||..|+|||.+|||+|++|+|+|++|.||||||++|+||++.|+..|++...+.||.+||
T Consensus       364 v~sW~q~gl~~~il~tlkkl~y~k~~~IQ~qAiP~ImsGrdvIgvakTgSGKT~af~LPmirhi~dQr~~~~gdGPi~li  443 (997)
T KOG0334|consen  364 VTSWTQCGLSSKILETLKKLGYEKPTPIQAQAIPAIMSGRDVIGVAKTGSGKTLAFLLPMIRHIKDQRPLEEGDGPIALI  443 (997)
T ss_pred             cchHhhCCchHHHHHHHHHhcCCCCcchhhhhcchhccCcceEEeeccCCccchhhhcchhhhhhcCCChhhCCCceEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999899999999


Q ss_pred             EcCcHHHHHHHHHHHHHhhhhcCcEEEEEEcCCChhHHHHHHhcCCcEEEEChHHHHHHHHhcCCCcccCCCccEEEEcc
Q psy12410        405 MSPTRELCMQIGKEAKKFTKSLGLRVVCVYGGTGISEQISELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYIVLDE  484 (615)
Q Consensus       405 l~Ptr~La~q~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~l~~~~~Iiv~Tp~~l~~~l~~~~~~~~~l~~~~~lVvDE  484 (615)
                      |+|||+||.||++++..|+..+++.++|+|||.....++..++.|+.|+|||||++++++..+.+++.+|.++.|||+||
T Consensus       444 ~aPtrela~QI~r~~~kf~k~l~ir~v~vygg~~~~~qiaelkRg~eIvV~tpGRmiD~l~~n~grvtnlrR~t~lv~de  523 (997)
T KOG0334|consen  444 LAPTRELAMQIHREVRKFLKLLGIRVVCVYGGSGISQQIAELKRGAEIVVCTPGRMIDILCANSGRVTNLRRVTYLVLDE  523 (997)
T ss_pred             EcCCHHHHHHHHHHHHHHHhhcCceEEEecCCccHHHHHHHHhcCCceEEeccchhhhhHhhcCCccccccccceeeech
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccCCcHHHHHHHHHhcCCCCcEEEEeccCChHHHHHHHHHcCCCEEEEECCcccccCCeEEEEEecC-hhHHHHHH
Q psy12410        485 ADRMFDMGFEPQVMRIIDNVRPDRQTVMFSATFPRQMEALARRILNKPIEIQVGGRSVVCKEVEQHVIVLD-EEQKMLKL  563 (615)
Q Consensus       485 ah~~~~~~~~~~~~~i~~~~~~~~q~l~~SAT~~~~~~~~~~~~~~~p~~i~~~~~~~~~~~i~~~~~~~~-~~~k~~~l  563 (615)
                      ||+|++++|.+++..|+.++++.+|+++||||+|..|+.+++..++.|+.+.++..+..+..|.|.+.++. ...|+..|
T Consensus       524 aDrmfdmgfePq~~~Ii~nlrpdrQtvlfSatfpr~m~~la~~vl~~Pveiiv~~~svV~k~V~q~v~V~~~e~eKf~kL  603 (997)
T KOG0334|consen  524 ADRMFDMGFEPQITRILQNLRPDRQTVLFSATFPRSMEALARKVLKKPVEIIVGGRSVVCKEVTQVVRVCAIENEKFLKL  603 (997)
T ss_pred             hhhhheeccCcccchHHhhcchhhhhhhhhhhhhHHHHHHHHHhhcCCeeEEEccceeEeccceEEEEEecCchHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999998 89999999


Q ss_pred             HHHHhccCCCCcEEEEeCCcchHHHHHHHhhcCCCcEEEEcCCCChhhhhc
Q psy12410        564 LELLGIYQDQGSVIVFVDKQENADSLLFHSMDPCLEFLPLPAGITRFIWQW  614 (615)
Q Consensus       564 ~~~l~~~~~~~~~LIF~~s~~~a~~l~~~L~~~g~~~~~lhg~~~~~eR~~  614 (615)
                      +++|..+...+++||||.++..|+.|...|.+.||.|..|||+.+|.+|++
T Consensus       604 ~eLl~e~~e~~~tiiFv~~qe~~d~l~~~L~~ag~~~~slHGgv~q~dR~s  654 (997)
T KOG0334|consen  604 LELLGERYEDGKTIIFVDKQEKADALLRDLQKAGYNCDSLHGGVDQHDRSS  654 (997)
T ss_pred             HHHHHHHhhcCCEEEEEcCchHHHHHHHHHHhcCcchhhhcCCCchHHHHh
Confidence            999999999999999999999999999999999999999999999999986

>KOG0339|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>KOG4368|consensus Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG2543|consensus Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07413 hypothetical protein; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1133|consensus Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK07413 hypothetical protein; Validated Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PHA00012 I assembly protein Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>PF08648 DUF1777: Protein of unknown function (DUF1777); InterPro: IPR013957 This entry shows eukaryotic proteins of unknown function Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>KOG0652|consensus Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>KOG2036|consensus Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG2227|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>KOG1513|consensus Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query615
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 2e-65
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 3e-62
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 2e-50
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 2e-49
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 4e-46
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 2e-45
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 3e-41
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 9e-41
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 7e-39
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 3e-34
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 1e-32
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 5e-30
3dkp_A245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 4e-29
3ly5_A262 Ddx18 Dead-Domain Length = 262 7e-29
2hyi_C413 Structure Of The Human Exon Junction Complex With A 1e-28
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 1e-28
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 1e-28
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 2e-28
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 2e-28
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 4e-28
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 5e-28
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 3e-26
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 4e-26
3sqw_A 579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 2e-25
3i5x_A 563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 2e-25
3sqx_A 512 Structure Of Mss116p (Nte And C-Tail Double Deletio 3e-25
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 4e-25
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 2e-24
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 7e-24
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 7e-24
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 9e-24
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 9e-24
2vso_A395 Crystal Structure Of A Translation Initiation Compl 2e-23
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 3e-23
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 4e-23
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 4e-22
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 5e-22
1fuu_A394 Yeast Initiation Factor 4a Length = 394 5e-22
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 1e-19
3pey_A 395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 2e-19
3pew_A 395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 2e-19
3fho_B 508 Structure Of S. Pombe Dbp5 Length = 508 2e-17
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 4e-17
3fmp_B 479 Crystal Structure Of The Nucleoporin Nup214 In Comp 9e-16
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 1e-15
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 1e-15
3fht_A 412 Crystal Structure Of Human Dbp5 In Complex With Amp 1e-15
3fmo_B300 Crystal Structure Of The Nucleoporin Nup214 In Comp 2e-15
3fhc_B235 Crystal Structure Of Human Dbp5 In Complex With Nup 3e-15
4f92_B 1724 Brr2 Helicase Region S1087l Length = 1724 3e-06
4f91_B 1724 Brr2 Helicase Region Length = 1724 3e-06
2p6r_A 702 Crystal Structure Of Superfamily 2 Helicase Hel308 4e-04
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure 
Iteration: 1

 Score =  246 bits (629), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 114/255 (44%), Positives = 167/255 (65%), Gaps = 4/255 (1%)
Query: 285 FRKDFYVEVPEIARMTPXXXXXXXXXXXGIRVKGKGCPRPIKTWAQCGVSKKILDALKKQ 344
           F K+FY E P++AR T             I V+G  CP+P+  + +      ++D + +Q
Sbjct: 3   FEKNFYQEHPDLARRTAQEVETYRRSKE-ITVRGHNCPKPVLNFYEANFPANVMDVIARQ 61
Query: 345 NYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTVAFVLPLLRHILDQPPLEETDGPMAII 404
           N+ +PT IQAQ  P  +SG D++G+A+TGSGKT++++LP + HI  QP LE  DGP+ ++
Sbjct: 62  NFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLV 121
Query: 405 MSPTRELCMQIGKEAKKFTKSLGLRVVCVYGGTGISEQISELKRGAEIIVCTPGRMIDML 464
           ++PTREL  Q+ + A ++ ++  L+  C+YGG     QI +L+RG EI + TPGR+ID L
Sbjct: 122 LAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFL 181
Query: 465 AANSGRVTNLRRVTYIVLDEADRMFDMGFEPQVMRIIDNVRPDRQTVMFSATFPRQMEAL 524
                  TNLRR TY+VLDEADRM DMGFEPQ+ +I+D +RPDRQT+M+SAT+P+++  L
Sbjct: 182 ECGK---TNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQL 238
Query: 525 ARRILNKPIEIQVGG 539
           A   L   I I +G 
Sbjct: 239 AEDFLKDYIHINIGA 253
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|4F92|B Chain B, Brr2 Helicase Region S1087l Length = 1724 Back     alignment and structure
>pdb|4F91|B Chain B, Brr2 Helicase Region Length = 1724 Back     alignment and structure
>pdb|2P6R|A Chain A, Crystal Structure Of Superfamily 2 Helicase Hel308 In Complex With Unwound Dna Length = 702 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query615
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 1e-165
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 1e-157
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 1e-152
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 1e-143
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 1e-129
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 1e-129
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 3e-86
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 1e-82
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 2e-82
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 6e-82
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 3e-81
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 7e-81
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 2e-80
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 2e-80
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 2e-79
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 4e-79
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 1e-78
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 7e-77
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 4e-76
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 2e-75
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 4e-75
3bor_A237 Human initiation factor 4A-II; translation initiat 6e-74
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 2e-73
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 2e-72
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 8e-72
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 1e-71
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 3e-71
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 6e-71
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 2e-70
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 3e-69
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-68
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 1e-18
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 6e-15
3b6e_A216 Interferon-induced helicase C domain-containing P; 1e-13
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 1e-13
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 9e-13
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 2e-11
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 2e-11
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 3e-11
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 7e-11
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 5e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 3e-08
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 3e-08
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 8e-08
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 1e-04
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 7e-08
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 1e-07
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 4e-07
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 9e-07
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 2e-06
1yks_A 440 Genome polyprotein [contains: flavivirin protease 1e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-05
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 7e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 9e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-04
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 2e-04
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
 Score =  476 bits (1228), Expect = e-165
 Identities = 112/315 (35%), Positives = 169/315 (53%), Gaps = 14/315 (4%)

Query: 284 PFRKDFYVEVPEIARMTPEEVEKYKEELE-------GIRVKGKGCPRPIKTWAQCGVSKK 336
            F  +FY+                   +         ++V G   P+PI+ +    +   
Sbjct: 7   EFPGEFYIPPEPSNDAIEIFSSGIASGIHFSKYNNIPVKVTGSDVPQPIQHFTSADLRDI 66

Query: 337 ILDALKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTVAFVLPLLRHILDQPPLEE 396
           I+D + K  Y+ PTPIQ  +IP I SGRDL+  A+TGSGKT AF+LP+L  +L+ P   E
Sbjct: 67  IIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHELE 126

Query: 397 TDGPMAIIMSPTRELCMQIGKEAKKFTKSLGLRVVCVYGGTGISEQISELKRGAEIIVCT 456
              P  +I+SPTREL +QI  EA+KF     L++  VYGGT    Q   + RG  +++ T
Sbjct: 127 LGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIAT 186

Query: 457 PGRMIDMLAANSGRVTNLRRVTYIVLDEADRMFDMGFEPQVMRIIDNV--RPDRQTVMFS 514
           PGR++D +              ++VLDEADRM DMGF   + RI+ +V  RP+ QT+MFS
Sbjct: 187 PGRLLDFVDR---TFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFS 243

Query: 515 ATFPRQMEALARRILNKPIEIQVGGRSVVCKEVEQHVIVLDEEQKMLKLLELLGIYQDQG 574
           ATFP +++ +A   L   + + +G     C +V+Q +  +++  K  KL+E+L   +   
Sbjct: 244 ATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILS--EQAD 301

Query: 575 SVIVFVDKQENADSL 589
             IVFV+ +  AD L
Sbjct: 302 GTIVFVETKRGADFL 316
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Length = 1054 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query615
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 100.0
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 100.0
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 100.0
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 100.0
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3bor_A237 Human initiation factor 4A-II; translation initiat 100.0
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 100.0
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 100.0
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 100.0
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 100.0
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 100.0
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 100.0
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 100.0
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.98
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.97
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.97
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 99.97
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.97
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.97
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.97
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 99.97
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.97
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 99.97
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.97
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.97
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.96
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.96
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.96
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.96
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.96
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.96
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 99.95
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.95
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.94
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.94
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.93
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.93
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.92
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.92
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.91
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.9
3h1t_A 590 Type I site-specific restriction-modification syst 99.9
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.89
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.89
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.89
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.89
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.89
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.88
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.86
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.84
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.84
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.84
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.82
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.81
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.81
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.79
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.62
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.53
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.51
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.42
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.35
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.97
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 98.77
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 98.51
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 98.45
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 98.45
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 98.41
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 98.37
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 98.33
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 98.32
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 98.31
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 98.31
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.31
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 98.22
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 98.2
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 98.07
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 97.18
3eaq_A 212 Heat resistant RNA dependent ATPase; DEAD box RNA 97.93
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 97.86
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 97.69
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 97.47
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.15
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 97.09
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.94
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 96.89
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.86
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 96.84
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 96.81
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.71
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.59
1z5z_A 271 Helicase of the SNF2/RAD54 family; hydrolase, reco 96.53
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 96.52
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 96.49
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 96.43
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 96.21
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.19
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.19
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.16
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 96.12
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.1
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.09
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 96.06
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 95.9
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 95.88
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 95.84
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 95.83
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.8
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 95.67
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 95.58
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.56
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 95.46
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 95.45
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 95.41
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 95.4
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 95.37
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 95.35
2qgz_A308 Helicase loader, putative primosome component; str 95.33
2v1u_A387 Cell division control protein 6 homolog; DNA repli 95.27
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 95.27
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 95.24
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 95.21
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 95.16
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 95.03
3bos_A242 Putative DNA replication factor; P-loop containing 95.02
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 94.97
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 94.8
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 94.75
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 94.69
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 94.62
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 94.51
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 94.49
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 94.38
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 94.38
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 94.38
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 94.29
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 94.27
2r6a_A454 DNAB helicase, replicative helicase; replication, 94.23
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 94.23
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 94.22
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 94.14
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 94.07
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 93.93
3pvs_A 447 Replication-associated recombination protein A; ma 93.84
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 93.81
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 93.76
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 93.74
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 93.7
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 93.53
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 93.47
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 93.4
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 93.33
1vma_A306 Cell division protein FTSY; TM0570, structural gen 93.27
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 93.17
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 93.06
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 93.06
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 92.91
2gno_A305 DNA polymerase III, gamma subunit-related protein; 92.86
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 92.76
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 92.68
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 92.59
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 92.52
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 92.5
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 92.47
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 92.46
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 92.36
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 91.94
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 91.81
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 91.78
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 91.72
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 91.7
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 91.69
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 91.6
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 91.46
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 91.3
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 91.21
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 90.92
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 90.86
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 90.74
3hjh_A 483 Transcription-repair-coupling factor; MFD, mutatio 90.74
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 90.72
2fna_A357 Conserved hypothetical protein; structural genomic 90.48
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 90.45
2xxa_A433 Signal recognition particle protein; protein trans 90.44
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 90.22
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 90.0
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 90.0
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 89.91
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 89.81
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 89.57
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 89.22
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 89.19
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 89.06
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 88.79
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 88.7
3co5_A143 Putative two-component system transcriptional RES 88.4
1xp8_A366 RECA protein, recombinase A; recombination, radior 88.35
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 87.67
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 87.64
2z43_A324 DNA repair and recombination protein RADA; archaea 87.46
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 87.13
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 86.89
2l8b_A189 Protein TRAI, DNA helicase I; RECD, hydrolase; NMR 86.8
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 86.64
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 86.61
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 86.54
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 86.51
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 86.35
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 86.31
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 85.85
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 85.41
2eyu_A261 Twitching motility protein PILT; pilus retraction 85.33
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 85.21
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 85.06
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 84.87
1yks_A440 Genome polyprotein [contains: flavivirin protease 84.68
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 84.51
3foj_A100 Uncharacterized protein; protein SSP1007, structur 84.45
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 84.42
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 84.01
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 83.98
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 83.4
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 82.84
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 82.78
3h75_A 350 Periplasmic sugar-binding domain protein; protein 82.66
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 82.61
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 82.03
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 81.84
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 81.77
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 81.69
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 81.67
2jtq_A85 Phage shock protein E; solution structure rhodanes 81.23
1p9r_A418 General secretion pathway protein E; bacterial typ 81.04
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 80.98
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 80.93
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 80.92
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 80.78
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 80.49
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=1.4e-48  Score=417.91  Aligned_cols=297  Identities=37%  Similarity=0.617  Sum_probs=274.9

Q ss_pred             CeEecCCCCCCccccccccCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHcCCCEEEEccCCCchhHHhHHHHHHHHhcCC
Q psy12410        313 GIRVKGKGCPRPIKTWAQCGVSKKILDALKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTVAFVLPLLRHILDQP  392 (615)
Q Consensus       313 ~i~~~~~~~p~~~~~~~~~~l~~~l~~~l~~~~~~~~~~~Q~~~i~~i~~~~~~i~~a~TGsGKT~~~~l~~l~~~~~~~  392 (615)
                      .+.+.|..+|.|+.+|.+++|++.++++|...||..|||+|.++||.+++|+|++++||||||||++|++|++.+++...
T Consensus        43 ~~~~~~~~~p~~~~~f~~~~l~~~l~~~l~~~g~~~pt~iQ~~ai~~i~~g~d~i~~a~TGsGKT~a~~lpil~~l~~~~  122 (434)
T 2db3_A           43 PVKVTGSDVPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDP  122 (434)
T ss_dssp             CEEEESSSCCCCCCCGGGSCCCHHHHHHHHHTTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHHHHHSC
T ss_pred             eeEecCCCCCCCcCChhhcCCCHHHHHHHHHcCCCCCCHHHHHHHHHHhcCCCEEEECCCCCCchHHHHHHHHHHHHhcc
Confidence            37889999999999999999999999999999999999999999999999999999999999999999999999998765


Q ss_pred             CCCCCCCCeEEEEcCcHHHHHHHHHHHHHhhhhcCcEEEEEEcCCChhHHHHHHhcCCcEEEEChHHHHHHHHhcCCCcc
Q psy12410        393 PLEETDGPMAIIMSPTRELCMQIGKEAKKFTKSLGLRVVCVYGGTGISEQISELKRGAEIIVCTPGRMIDMLAANSGRVT  472 (615)
Q Consensus       393 ~~~~~~~~~~lil~Ptr~La~q~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~l~~~~~Iiv~Tp~~l~~~l~~~~~~~~  472 (615)
                      ......++++|||+||++||.|+++.+.+++...++.+++++||.....+...+..+++|+|+||++|.+++....   .
T Consensus       123 ~~~~~~~~~~lil~PtreLa~Q~~~~~~~~~~~~~~~~~~~~gg~~~~~~~~~l~~~~~Ivv~Tp~~l~~~l~~~~---~  199 (434)
T 2db3_A          123 HELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTF---I  199 (434)
T ss_dssp             CCCCTTCCSEEEECSSHHHHHHHHHHHHHHTTTSSCCCCEECTTSCHHHHHHHHTTCCSEEEECHHHHHHHHHTTS---C
T ss_pred             cccccCCccEEEEecCHHHHHHHHHHHHHHhccCCcEEEEEECCCCHHHHHHHhhcCCCEEEEChHHHHHHHHhCC---c
Confidence            4334568899999999999999999999999988899999999999988888888899999999999999998653   5


Q ss_pred             cCCCccEEEEccccccccCCcHHHHHHHHHhc--CCCCcEEEEeccCChHHHHHHHHHcCCCEEEEECCcccccCCeEEE
Q psy12410        473 NLRRVTYIVLDEADRMFDMGFEPQVMRIIDNV--RPDRQTVMFSATFPRQMEALARRILNKPIEIQVGGRSVVCKEVEQH  550 (615)
Q Consensus       473 ~l~~~~~lVvDEah~~~~~~~~~~~~~i~~~~--~~~~q~l~~SAT~~~~~~~~~~~~~~~p~~i~~~~~~~~~~~i~~~  550 (615)
                      .+..+.+|||||||+|++++|...+..|+..+  ++.+|+|+||||+++.+..++..++.+|+.+.++........+.+.
T Consensus       200 ~l~~~~~lVlDEah~~~~~gf~~~~~~i~~~~~~~~~~q~l~~SAT~~~~~~~~~~~~l~~~~~i~~~~~~~~~~~i~~~  279 (434)
T 2db3_A          200 TFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQT  279 (434)
T ss_dssp             CCTTCCEEEEETHHHHTSTTTHHHHHHHHHCTTSCSSCEEEEEESCCCHHHHHHHHTTCSSCEEEEESSTTCCCTTEEEE
T ss_pred             ccccCCeEEEccHhhhhccCcHHHHHHHHHhcCCCCCceEEEEeccCCHHHHHHHHHhccCCEEEEeccccccccccceE
Confidence            68899999999999999999999999999885  6789999999999999999999999999999998877778889999


Q ss_pred             EEecChhHHHHHHHHHHhccCCCCcEEEEeCCcchHHHHHHHhhcCCCcEEEEcCCCChhhhhc
Q psy12410        551 VIVLDEEQKMLKLLELLGIYQDQGSVIVFVDKQENADSLLFHSMDPCLEFLPLPAGITRFIWQW  614 (615)
Q Consensus       551 ~~~~~~~~k~~~l~~~l~~~~~~~~~LIF~~s~~~a~~l~~~L~~~g~~~~~lhg~~~~~eR~~  614 (615)
                      +..+....+...|..++....  .++||||+++..|+.|+..|...|+.+..+||++++.+|+.
T Consensus       280 ~~~~~~~~k~~~l~~~l~~~~--~~~lVF~~t~~~a~~l~~~L~~~~~~~~~lhg~~~~~~R~~  341 (434)
T 2db3_A          280 IYEVNKYAKRSKLIEILSEQA--DGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQ  341 (434)
T ss_dssp             EEECCGGGHHHHHHHHHHHCC--TTEEEECSSHHHHHHHHHHHHHTTCCEEEESTTSCHHHHHH
T ss_pred             EEEeCcHHHHHHHHHHHHhCC--CCEEEEEeCcHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHH
Confidence            999999999999999998763  35999999999999999999999999999999999999975
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 615
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 8e-58
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 4e-55
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 7e-52
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 1e-51
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 2e-51
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 2e-47
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 5e-45
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 4e-43
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 6e-39
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 5e-38
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 5e-30
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 1e-29
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 7e-23
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 2e-18
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 2e-05
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 2e-04
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

 Score =  191 bits (485), Expect = 8e-58
 Identities = 75/212 (35%), Positives = 125/212 (58%), Gaps = 11/212 (5%)

Query: 327 TWAQCGVSKKILDALKKQNYEKPTPIQAQAIPAIMSGR-DLIGIAKTGSGKTVAFVLPLL 385
            + +  +S  IL+A++ + +EKPT IQ + IP  ++   +++  A+TGSGKT +F +PL+
Sbjct: 5   NFNELNLSDNILNAIRNKGFEKPTDIQMKVIPLFLNDEYNIVAQARTGSGKTASFAIPLI 64

Query: 386 RHILDQPPLEETDGPMAIIMSPTRELCMQIGKEAKKFTKSLGLRVVCVYGGTGISEQISE 445
             + +        G  AII++PTREL +Q+  E +    +  L++  +YGG  I  QI  
Sbjct: 65  ELVNENN------GIEAIILTPTRELAIQVADEIESLKGNKNLKIAKIYGGKAIYPQIKA 118

Query: 446 LKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYIVLDEADRMFDMGFEPQVMRIIDNVR 505
           LK  A I+V TPGR++D +   +    NL+ V Y +LDEAD M +MGF   V +I++   
Sbjct: 119 LK-NANIVVGTPGRILDHI---NRGTLNLKNVKYFILDEADEMLNMGFIKDVEKILNACN 174

Query: 506 PDRQTVMFSATFPRQMEALARRILNKPIEIQV 537
            D++ ++FSAT PR++  LA++ +     I+ 
Sbjct: 175 KDKRILLFSATMPREILNLAKKYMGDYSFIKA 206
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query615
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 100.0
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 100.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 100.0
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 100.0
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.94
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.94
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.94
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.91
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.91
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.83
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.82
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.77
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.75
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.73
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.68
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.39
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.18
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 99.0
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.96
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.69
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 98.63
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 98.55
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 98.54
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 98.47
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 98.44
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 98.42
d1c4oa2 174 Nucleotide excision repair enzyme UvrB {Thermus th 98.29
d1oywa3 200 RecQ helicase domain {Escherichia coli [TaxId: 562 98.0
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 97.95
d1t5la2 181 Nucleotide excision repair enzyme UvrB {Bacillus c 97.9
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.51
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.51
d2qy9a2211 GTPase domain of the signal recognition particle r 97.36
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 97.33
d1okkd2207 GTPase domain of the signal recognition particle r 97.27
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 97.15
d1vmaa2213 GTPase domain of the signal recognition particle r 97.1
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.96
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.92
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.83
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 96.51
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 96.32
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 96.29
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 96.24
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 96.21
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 96.17
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 96.04
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 96.04
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 95.88
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.76
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 95.53
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.49
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 95.32
d1z5za1 244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 95.26
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 95.04
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 94.91
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 94.85
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 94.84
d2eyqa5 211 Transcription-repair coupling factor, TRCF {Escher 94.67
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 94.66
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 94.55
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 94.54
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 94.43
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 94.33
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 94.33
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 94.3
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 94.13
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 94.03
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 93.91
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 93.91
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 93.88
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 93.56
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 93.5
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 93.44
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 93.41
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 93.29
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 93.19
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 93.16
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 93.15
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 93.01
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 92.79
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 92.71
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.69
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 92.5
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 92.5
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 92.26
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 90.33
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 90.03
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 89.48
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 89.35
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 89.06
d1w36b1 485 Exodeoxyribonuclease V beta chain (RecB), N-termin 88.95
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 88.68
d1nkta4 219 Translocation ATPase SecA, nucleotide-binding doma 88.47
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 88.39
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 88.38
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 88.2
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 88.17
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 87.66
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 87.0
d1gm5a4 206 RecG helicase domain {Thermotoga maritima [TaxId: 86.56
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 86.41
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 86.2
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 86.18
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 85.79
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 85.72
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 83.65
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 83.06
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 82.92
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 82.23
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 81.67
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 81.23
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 80.35
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.6e-43  Score=338.44  Aligned_cols=211  Identities=32%  Similarity=0.567  Sum_probs=197.2

Q ss_pred             CCCCccccccccCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHcCCCEEEEccCCCchhHHhHHHHHHHHhcCCCCCCCCC
Q psy12410        320 GCPRPIKTWAQCGVSKKILDALKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTVAFVLPLLRHILDQPPLEETDG  399 (615)
Q Consensus       320 ~~p~~~~~~~~~~l~~~l~~~l~~~~~~~~~~~Q~~~i~~i~~~~~~i~~a~TGsGKT~~~~l~~l~~~~~~~~~~~~~~  399 (615)
                      .......+|.+|+|++.|+++|.++||..|||+|..+||.++.|+|++++|+||||||++|++|+++++...     ...
T Consensus        11 ~~~~~~~sF~~l~L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~-----~~~   85 (222)
T d2j0sa1          11 EEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQ-----VRE   85 (222)
T ss_dssp             TTCCCCCSGGGGCCCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTT-----SCS
T ss_pred             CCCCCCCCHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhccccccccccc-----ccC
Confidence            334556689999999999999999999999999999999999999999999999999999999999988654     457


Q ss_pred             CeEEEEcCcHHHHHHHHHHHHHhhhhcCcEEEEEEcCCChhHHHHHHhcCCcEEEEChHHHHHHHHhcCCCcccCCCccE
Q psy12410        400 PMAIIMSPTRELCMQIGKEAKKFTKSLGLRVVCVYGGTGISEQISELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTY  479 (615)
Q Consensus       400 ~~~lil~Ptr~La~q~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~l~~~~~Iiv~Tp~~l~~~l~~~~~~~~~l~~~~~  479 (615)
                      +++||++||++||.|+++.+..++...++++.+++||.....+...+..+++|+|+||++|.+++....   ..++++.+
T Consensus        86 ~~~lil~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~~~---~~~~~l~~  162 (222)
T d2j0sa1          86 TQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRS---LRTRAIKM  162 (222)
T ss_dssp             CCEEEECSSHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHTTS---SCCTTCCE
T ss_pred             ceeEEecchHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHhccCCeEEeCCCCcHHhcccccc---ccccccee
Confidence            899999999999999999999999999999999999999999999999999999999999999987653   67899999


Q ss_pred             EEEccccccccCCcHHHHHHHHHhcCCCCcEEEEeccCChHHHHHHHHHcCCCEEEEEC
Q psy12410        480 IVLDEADRMFDMGFEPQVMRIIDNVRPDRQTVMFSATFPRQMEALARRILNKPIEIQVG  538 (615)
Q Consensus       480 lVvDEah~~~~~~~~~~~~~i~~~~~~~~q~l~~SAT~~~~~~~~~~~~~~~p~~i~~~  538 (615)
                      |||||||+|++.+|...+..|+..++..+|+++||||+++.+..++..++.+|+.|.++
T Consensus       163 lVlDEaD~ll~~~f~~~i~~I~~~l~~~~Q~ilfSAT~~~~v~~l~~~~l~~Pv~I~V~  221 (222)
T d2j0sa1         163 LVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVK  221 (222)
T ss_dssp             EEEETHHHHTSTTTHHHHHHHHTTSCTTCEEEEEESCCCHHHHTTGGGTCSSCEEECCC
T ss_pred             eeecchhHhhhcCcHHHHHHHHHhCCCCCEEEEEEEeCCHHHHHHHHHHCCCCEEEEEe
Confidence            99999999999999999999999999999999999999999999999999999988764
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure