Psyllid ID: psy12446


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-------
MAYRALICRTLDYKTVTLYHGVNLENHLHLAYHELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSPE
ccEEEEEEccccccccEEEccccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHcccEEEEEEcccccccccc
cccEEEEEEccccccEEEEccccccccHHHHHHHHHHccccEEEEEccccccHHHHHHcccEEEEcccccccccccc
MAYRALICRTLDYKTVTLYHGVNLENHLHLAYHELKKHQVKNVVrvceptykvedlkteginvkdlayedgtspspe
MAYRALICRTLDYKTVTLYHGVNLENHLHLAYHELKKHQVKNVVRVCEPtykvedlkteginvkdlayedgtspspe
MAYRALICRTLDYKTVTLYHGVNLENHLHLAYHELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSPE
**YRALICRTLDYKTVTLYHGVNLENHLHLAYHELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLA**********
*AYRALICRTLDYKTVTLYHGVNLENHLHLAYHELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYE*GTS****
MAYRALICRTLDYKTVTLYHGVNLENHLHLAYHELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYE********
*AYRALICRTLDYKTVTLYHGVNLENHLHLAYHELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGT*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAYRALICRTLDYKTVTLYHGVNLENHLHLAYHELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSPE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query77 2.2.26 [Sep-21-2011]
Q54DU9166 Probable protein tyrosine yes N/A 0.649 0.301 0.46 6e-07
Q5R7J8173 Protein tyrosine phosphat yes N/A 0.545 0.242 0.5 7e-05
Q78EG7173 Protein tyrosine phosphat yes N/A 0.545 0.242 0.5 8e-05
Q63739173 Protein tyrosine phosphat yes N/A 0.545 0.242 0.5 8e-05
Q9TSM6173 Protein tyrosine phosphat N/A N/A 0.545 0.242 0.5 8e-05
Q93096173 Protein tyrosine phosphat yes N/A 0.545 0.242 0.5 8e-05
>sp|Q54DU9|TP4AA_DICDI Probable protein tyrosine phosphatase type IVA A OS=Dictyostelium discoideum GN=DDB_G0292024 PE=3 SV=1 Back     alignment and function desciption
 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%)

Query: 25 ENHLHLAYHELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSP 74
          +++L L  +ELKK+ V ++VR C+PTY  E L+  GI V D+ + DG SP
Sbjct: 30 DDNLPLYINELKKYNVSHLVRACDPTYSTEPLQAIGIQVHDMPFADGGSP 79





Dictyostelium discoideum (taxid: 44689)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|Q5R7J8|TP4A1_PONAB Protein tyrosine phosphatase type IVA 1 OS=Pongo abelii GN=PTP4A1 PE=2 SV=1 Back     alignment and function description
>sp|Q78EG7|TP4A1_RAT Protein tyrosine phosphatase type IVA 1 OS=Rattus norvegicus GN=Ptp4a1 PE=1 SV=1 Back     alignment and function description
>sp|Q63739|TP4A1_MOUSE Protein tyrosine phosphatase type IVA 1 OS=Mus musculus GN=Ptp4a1 PE=1 SV=1 Back     alignment and function description
>sp|Q9TSM6|TP4A1_MACFA Protein tyrosine phosphatase type IVA 1 OS=Macaca fascicularis GN=PTP4A1 PE=1 SV=1 Back     alignment and function description
>sp|Q93096|TP4A1_HUMAN Protein tyrosine phosphatase type IVA 1 OS=Homo sapiens GN=PTP4A1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query77
350415946175 PREDICTED: protein tyrosine phosphatase 0.649 0.285 0.7 1e-11
340719872175 PREDICTED: protein tyrosine phosphatase 0.649 0.285 0.7 1e-11
322783490175 hypothetical protein SINV_07755 [Solenop 0.649 0.285 0.68 2e-11
307181237172 Protein tyrosine phosphatase type IVA 1 0.649 0.290 0.68 2e-11
345494115175 PREDICTED: protein tyrosine phosphatase 0.649 0.285 0.68 3e-11
332019900 181 Protein tyrosine phosphatase type IVA 1 0.649 0.276 0.68 3e-11
242025542 182 protein tyrosine phosphatase type IVA pr 0.584 0.247 0.711 3e-11
383862800175 PREDICTED: protein tyrosine phosphatase 0.649 0.285 0.68 4e-11
328780636175 PREDICTED: protein tyrosine phosphatase 0.649 0.285 0.66 5e-11
239789910155 hypothetical protein [Acyrthosiphon pisu 0.649 0.322 0.66 7e-11
>gi|350415946|ref|XP_003490800.1| PREDICTED: protein tyrosine phosphatase type IVA 1-like [Bombus impatiens] Back     alignment and taxonomy information
 Score = 73.9 bits (180), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 39/50 (78%)

Query: 28 LHLAYHELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSPE 77
          +H    ELKKH VK VVRVCEPTYKVE+LKTEGINV DL ++DGT P  E
Sbjct: 34 IHTFIQELKKHNVKEVVRVCEPTYKVEELKTEGINVIDLVFDDGTFPPNE 83




Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340719872|ref|XP_003398369.1| PREDICTED: protein tyrosine phosphatase type IVA 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|322783490|gb|EFZ10954.1| hypothetical protein SINV_07755 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307181237|gb|EFN68934.1| Protein tyrosine phosphatase type IVA 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345494115|ref|XP_001603053.2| PREDICTED: protein tyrosine phosphatase type IVA 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332019900|gb|EGI60361.1| Protein tyrosine phosphatase type IVA 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|242025542|ref|XP_002433183.1| protein tyrosine phosphatase type IVA protein, putative [Pediculus humanus corporis] gi|212518724|gb|EEB20445.1| protein tyrosine phosphatase type IVA protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|383862800|ref|XP_003706871.1| PREDICTED: protein tyrosine phosphatase type IVA 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328780636|ref|XP_393167.4| PREDICTED: protein tyrosine phosphatase type IVA 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|239789910|dbj|BAH71551.1| hypothetical protein [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query77
FB|FBgn0024734178 PRL-1 "PRL-1" [Drosophila mela 0.532 0.230 0.658 1.2e-10
DICTYBASE|DDB_G0292024166 DDB_G0292024 "putative protein 0.649 0.301 0.46 6.8e-08
WB|WBGene00004184190 prl-1 [Caenorhabditis elegans 0.571 0.231 0.545 1.1e-07
GENEDB_PFALCIPARUM|PF11_0139218 PF11_0139 "protein tyrosine ph 0.649 0.229 0.38 1.2e-06
UNIPROTKB|Q8IIN1218 PRL "Protein tyrosine phosphat 0.649 0.229 0.38 1.2e-06
UNIPROTKB|Q5ZIQ1173 PTP4A1 "Uncharacterized protei 0.844 0.375 0.409 1.6e-06
UNIPROTKB|I3L887201 PTP4A1 "Uncharacterized protei 0.896 0.343 0.363 2.5e-06
ZFIN|ZDB-GENE-041121-11 269 ptp4a1 "protein tyrosine phosp 0.844 0.241 0.424 3.5e-06
UNIPROTKB|I3LCL5198 I3LCL5 "Uncharacterized protei 0.545 0.212 0.5 4.1e-06
UNIPROTKB|G5E526173 PTP4A1 "Uncharacterized protei 0.545 0.242 0.5 4.3e-06
FB|FBgn0024734 PRL-1 "PRL-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 149 (57.5 bits), Expect = 1.2e-10, P = 1.2e-10
 Identities = 27/41 (65%), Positives = 34/41 (82%)

Query:    34 ELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSP 74
             ELKK+ V  VVRVCEP+Y  ++L+T+GI VKDLA+EDGT P
Sbjct:    41 ELKKNNVNTVVRVCEPSYNTDELETQGITVKDLAFEDGTFP 81




GO:0004727 "prenylated protein tyrosine phosphatase activity" evidence=ISS;NAS
GO:0006470 "protein dephosphorylation" evidence=IEA;NAS
GO:0008138 "protein tyrosine/serine/threonine phosphatase activity" evidence=IEA;NAS
DICTYBASE|DDB_G0292024 DDB_G0292024 "putative protein tyrosine phosphatase, dual specificity" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
WB|WBGene00004184 prl-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF11_0139 PF11_0139 "protein tyrosine phosphatase, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IIN1 PRL "Protein tyrosine phosphatase" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZIQ1 PTP4A1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3L887 PTP4A1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041121-11 ptp4a1 "protein tyrosine phosphatase type IVA, member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|I3LCL5 I3LCL5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G5E526 PTP4A1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query77
PTZ00242166 PTZ00242, PTZ00242, protein tyrosine phosphatase; 3e-13
PTZ00393241 PTZ00393, PTZ00393, protein tyrosine phosphatase; 9e-06
>gnl|CDD|185524 PTZ00242, PTZ00242, protein tyrosine phosphatase; Provisional Back     alignment and domain information
 Score = 60.4 bits (147), Expect = 3e-13
 Identities = 21/48 (43%), Positives = 29/48 (60%)

Query: 28 LHLAYHELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPS 75
          L L   EL+++ V ++VRVC PTY  E L+  GI V D  ++DG  P 
Sbjct: 29 LPLYIKELQRYNVTHLVRVCGPTYDAELLEKNGIEVHDWPFDDGAPPP 76


Length = 166

>gnl|CDD|240399 PTZ00393, PTZ00393, protein tyrosine phosphatase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 77
KOG2836|consensus173 100.0
PTZ00393241 protein tyrosine phosphatase; Provisional 99.84
PTZ00242166 protein tyrosine phosphatase; Provisional 99.74
KOG1720|consensus225 99.29
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 98.46
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 97.24
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 94.99
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 93.89
PF00102 235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 89.89
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 86.14
cd00047 231 PTPc Protein tyrosine phosphatases (PTP) catalyze 85.86
PRK00726 357 murG undecaprenyldiphospho-muramoylpentapeptide be 83.06
smart00194 258 PTPc Protein tyrosine phosphatase, catalytic domai 81.79
>KOG2836|consensus Back     alignment and domain information
Probab=100.00  E-value=1.9e-33  Score=198.87  Aligned_cols=69  Identities=38%  Similarity=0.611  Sum_probs=66.4

Q ss_pred             eeeeccceeEEeec-CCcccHHHHHHHHHhCCCeEEEEeCCCCcCchhhhcCCceEEEeecCCCCCCCCC
Q psy12446          9 RTLDYKTVTLYHGV-NLENHLHLAYHELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSPE   77 (77)
Q Consensus         9 ~~~~y~~~~fli~~-pt~~tl~~yi~elk~~~Vt~VVRvCe~tYd~~~~~~~GI~vhdl~F~DG~~Pp~~   77 (77)
                      -+|+||+|||||++ |||+||+.||+|||+|||+.||||||||||+..+|++||.|.||+|+||++||.+
T Consensus        10 veIsy~~MrFLIThnPtnaTln~fieELkKygvttvVRVCe~TYdt~~lek~GI~Vldw~f~dg~ppp~q   79 (173)
T KOG2836|consen   10 VEISYKNMRFLITHNPTNATLNKFIEELKKYGVTTVVRVCEPTYDTTPLEKEGITVLDWPFDDGAPPPNQ   79 (173)
T ss_pred             eeeeccceEEEEecCCCchhHHHHHHHHHhcCCeEEEEecccccCCchhhhcCceEeecccccCCCCchH
Confidence            47999999999987 6999999999999999999999999999999999999999999999999999963



>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG1720|consensus Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query77
1x24_A180 Prl-1 (Ptp4a) Length = 180 5e-06
1zcl_A180 Prl-1 C104s Mutant In Complex With Sulfate Length = 5e-06
3rz2_A189 Crystal Of Prl-1 Complexed With Peptide Length = 18 5e-06
1zck_A154 Native Structure Prl-1 (Ptp4a1) Length = 154 6e-06
1rxd_A159 Crystal Structure Of Human Protein Tyrosine Phospha 6e-06
1xm2_A173 Crystal Structure Of Human Prl-1 Length = 173 7e-06
3s4o_A167 Protein Tyrosine Phosphatase (Putative) From Leishm 1e-04
1v3a_A173 Structure Of Human Prl-3, The Phosphatase Associate 1e-04
1r6h_A172 Solution Structure Of Human Prl-3 Length = 172 1e-04
>pdb|1X24|A Chain A, Prl-1 (Ptp4a) Length = 180 Back     alignment and structure

Iteration: 1

Score = 46.2 bits (108), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 21/42 (50%), Positives = 28/42 (66%) Query: 34 ELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPS 75 ELKK+ V +VRVCE TY ++ EGI+V D ++DG PS Sbjct: 56 ELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPS 97
>pdb|1ZCL|A Chain A, Prl-1 C104s Mutant In Complex With Sulfate Length = 180 Back     alignment and structure
>pdb|3RZ2|A Chain A, Crystal Of Prl-1 Complexed With Peptide Length = 189 Back     alignment and structure
>pdb|1ZCK|A Chain A, Native Structure Prl-1 (Ptp4a1) Length = 154 Back     alignment and structure
>pdb|1RXD|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase 4a1 Length = 159 Back     alignment and structure
>pdb|1XM2|A Chain A, Crystal Structure Of Human Prl-1 Length = 173 Back     alignment and structure
>pdb|3S4O|A Chain A, Protein Tyrosine Phosphatase (Putative) From Leishmania Major Length = 167 Back     alignment and structure
>pdb|1V3A|A Chain A, Structure Of Human Prl-3, The Phosphatase Associated With Cancer Metastasis Length = 173 Back     alignment and structure
>pdb|1R6H|A Chain A, Solution Structure Of Human Prl-3 Length = 172 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query77
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 2e-10
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 1e-07
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 1e-06
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 4e-06
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 4e-06
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 1e-05
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 1e-04
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 Back     alignment and structure
 Score = 52.7 bits (126), Expect = 2e-10
 Identities = 18/54 (33%), Positives = 30/54 (55%)

Query: 24 LENHLHLAYHELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSPE 77
            ++L     EL+   V+++VRVC PTY    +K+ GI+V    ++DG  P+  
Sbjct: 32 SPSNLPTYIKELQHRGVRHLVRVCGPTYDATLVKSRGIDVHSWPFDDGAPPTRA 85


>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query77
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.45
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.4
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.17
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 98.49
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 98.37
2c46_A 241 MRNA capping enzyme; phosphatase, transferase, hyd 98.27
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 98.04
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase- 97.4
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 97.36
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 97.12
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 96.96
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 96.95
3v0d_A 339 Voltage-sensor containing phosphatase; PTP, hydrol 96.88
1xri_A151 AT1G05000; structural genomics, protein structure 96.33
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 96.32
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 96.13
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 96.07
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 96.03
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 95.83
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 95.82
2esb_A 188 Dual specificity protein phosphatase 18; alpha/bet 95.78
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 95.73
2hxp_A155 Dual specificity protein phosphatase 9; human phos 95.66
2wgp_A 190 Dual specificity protein phosphatase 14; MKP6, DUS 95.59
2oud_A 177 Dual specificity protein phosphatase 10; A central 95.57
2g6z_A 211 Dual specificity protein phosphatase 5; alpha/beta 95.55
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 95.21
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 95.19
3emu_A161 Leucine rich repeat and phosphatase domain contain 95.15
2hcm_A164 Dual specificity protein phosphatase; structural g 95.07
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 94.62
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 93.66
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 93.66
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 92.84
3cm3_A176 Late protein H1, dual specificity protein phosphat 90.93
2f46_A156 Hypothetical protein; structural genomics, joint c 90.7
2q05_A195 Late protein H1, dual specificity protein phosphat 89.5
3mmj_A 314 MYO-inositol hexaphosphate phosphohydrolase; phyta 85.61
2gjt_A 295 Receptor-type tyrosine-protein phosphatase PTPro; 82.07
1fpr_A 284 Protein-tyrosine phosphatase 1C; protein tyrosine 81.17
1jln_A 297 STEP-like ptpase, protein tyrosine phosphatase, re 81.02
1l8k_A 314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 80.75
1p15_A 253 Protein-tyrosine phosphatase alpha; transmembrane, 80.64
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
Probab=99.45  E-value=1.8e-13  Score=92.85  Aligned_cols=67  Identities=36%  Similarity=0.569  Sum_probs=64.0

Q ss_pred             eeeccceeEEee-cCCcccHHHHHHHHHhCCCeEEEEeCCCCcCchhhhcCCceEEEeecCCCCCCCC
Q psy12446         10 TLDYKTVTLYHG-VNLENHLHLAYHELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSP   76 (77)
Q Consensus        10 ~~~y~~~~fli~-~pt~~tl~~yi~elk~~~Vt~VVRvCe~tYd~~~~~~~GI~vhdl~F~DG~~Pp~   76 (77)
                      +++|++.||+++ .|.+.|+.++++.|+++||+.||-+|++.|+.+.++..||++++||++||.+|+.
T Consensus        31 ~~~~~~~r~I~tq~P~~~t~~~~~~~L~~~gi~~Iv~l~~~~~~~~~~~~~~i~~~~~pi~d~~~~~~   98 (189)
T 3rz2_A           31 EVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSN   98 (189)
T ss_dssp             CEEETTEEEEEECCCCTTTHHHHHHHHHTTTEEEEEECSCCCSCCHHHHHSSCEEEECCCCSSSCCCS
T ss_pred             eeecCCCeEEEeCCCCcccHHHHHHHHHHcCCcEEEEeCCCcCCHHHHHHcCcEEEEecCCCCCCCCH
Confidence            689999999996 7999999999999999999999999999999999999999999999999998874



>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 77
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 9e-05
d1ohea2182 c.45.1.1 (A:199-380) Proline directed phosphatase 2e-04
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Protein tyrosine phosphatase type IVa
species: Human (Homo sapiens), pr-1 [TaxId: 9606]
 Score = 36.2 bits (83), Expect = 9e-05
 Identities = 21/45 (46%), Positives = 29/45 (64%)

Query: 33 HELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSPE 77
           ELKK+ V  +VRVCE TY    ++ EGI+V D  ++DG  PS +
Sbjct: 27 EELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQ 71


>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query77
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.75
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 98.93
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 98.32
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 96.58
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 95.41
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 94.98
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 94.7
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 90.69
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 87.55
d1lara2 249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 86.52
d1lara1 317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 82.59
d1p15a_ 245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 80.75
d1rpma_ 278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 80.58
d1l8ka_ 273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 80.55
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Protein tyrosine phosphatase type IVa
species: Human (Homo sapiens), pr-1 [TaxId: 9606]
Probab=99.75  E-value=1.6e-18  Score=112.71  Aligned_cols=68  Identities=35%  Similarity=0.551  Sum_probs=63.1

Q ss_pred             eeeeccceeEEee-cCCcccHHHHHHHHHhCCCeEEEEeCCCCcCchhhhcCCceEEEeecCCCCCCCC
Q psy12446          9 RTLDYKTVTLYHG-VNLENHLHLAYHELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSP   76 (77)
Q Consensus         9 ~~~~y~~~~fli~-~pt~~tl~~yi~elk~~~Vt~VVRvCe~tYd~~~~~~~GI~vhdl~F~DG~~Pp~   76 (77)
                      .+|+||+|||+++ .|+++|+++|++.|+++||+.||.+|+..|+.+.++..||+++++|++|+++|+.
T Consensus         2 ~~~~y~~~rfI~tq~P~~~t~~~f~~~l~~~~i~~Iv~l~e~~y~~~~~~~~~i~~~~~~~~d~~~p~~   70 (152)
T d1rxda_           2 VEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSN   70 (152)
T ss_dssp             EEEEETTEEEEECCCCCGGGHHHHHHHHHHTTEEEEEECSCCCSCCHHHHHTTCEEEECCC--CCCCCH
T ss_pred             eeEeecCceEEEECCCCchhHHHHHHHHHHhCCeEEeecccccCCchheeecceEEEEeeCCCCCCCCH
Confidence            4799999999997 6999999999999999999999999999999999999999999999999999874



>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure