Psyllid ID: psy12446
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 77 | ||||||
| 350415946 | 175 | PREDICTED: protein tyrosine phosphatase | 0.649 | 0.285 | 0.7 | 1e-11 | |
| 340719872 | 175 | PREDICTED: protein tyrosine phosphatase | 0.649 | 0.285 | 0.7 | 1e-11 | |
| 322783490 | 175 | hypothetical protein SINV_07755 [Solenop | 0.649 | 0.285 | 0.68 | 2e-11 | |
| 307181237 | 172 | Protein tyrosine phosphatase type IVA 1 | 0.649 | 0.290 | 0.68 | 2e-11 | |
| 345494115 | 175 | PREDICTED: protein tyrosine phosphatase | 0.649 | 0.285 | 0.68 | 3e-11 | |
| 332019900 | 181 | Protein tyrosine phosphatase type IVA 1 | 0.649 | 0.276 | 0.68 | 3e-11 | |
| 242025542 | 182 | protein tyrosine phosphatase type IVA pr | 0.584 | 0.247 | 0.711 | 3e-11 | |
| 383862800 | 175 | PREDICTED: protein tyrosine phosphatase | 0.649 | 0.285 | 0.68 | 4e-11 | |
| 328780636 | 175 | PREDICTED: protein tyrosine phosphatase | 0.649 | 0.285 | 0.66 | 5e-11 | |
| 239789910 | 155 | hypothetical protein [Acyrthosiphon pisu | 0.649 | 0.322 | 0.66 | 7e-11 |
| >gi|350415946|ref|XP_003490800.1| PREDICTED: protein tyrosine phosphatase type IVA 1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Score = 73.9 bits (180), Expect = 1e-11, Method: Compositional matrix adjust.
Identities = 35/50 (70%), Positives = 39/50 (78%)
Query: 28 LHLAYHELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSPE 77
+H ELKKH VK VVRVCEPTYKVE+LKTEGINV DL ++DGT P E
Sbjct: 34 IHTFIQELKKHNVKEVVRVCEPTYKVEELKTEGINVIDLVFDDGTFPPNE 83
|
Source: Bombus impatiens Species: Bombus impatiens Genus: Bombus Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|340719872|ref|XP_003398369.1| PREDICTED: protein tyrosine phosphatase type IVA 1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|322783490|gb|EFZ10954.1| hypothetical protein SINV_07755 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|307181237|gb|EFN68934.1| Protein tyrosine phosphatase type IVA 1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|345494115|ref|XP_001603053.2| PREDICTED: protein tyrosine phosphatase type IVA 1-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|332019900|gb|EGI60361.1| Protein tyrosine phosphatase type IVA 1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|242025542|ref|XP_002433183.1| protein tyrosine phosphatase type IVA protein, putative [Pediculus humanus corporis] gi|212518724|gb|EEB20445.1| protein tyrosine phosphatase type IVA protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|383862800|ref|XP_003706871.1| PREDICTED: protein tyrosine phosphatase type IVA 1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328780636|ref|XP_393167.4| PREDICTED: protein tyrosine phosphatase type IVA 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|239789910|dbj|BAH71551.1| hypothetical protein [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 77 | ||||||
| FB|FBgn0024734 | 178 | PRL-1 "PRL-1" [Drosophila mela | 0.532 | 0.230 | 0.658 | 1.2e-10 | |
| DICTYBASE|DDB_G0292024 | 166 | DDB_G0292024 "putative protein | 0.649 | 0.301 | 0.46 | 6.8e-08 | |
| WB|WBGene00004184 | 190 | prl-1 [Caenorhabditis elegans | 0.571 | 0.231 | 0.545 | 1.1e-07 | |
| GENEDB_PFALCIPARUM|PF11_0139 | 218 | PF11_0139 "protein tyrosine ph | 0.649 | 0.229 | 0.38 | 1.2e-06 | |
| UNIPROTKB|Q8IIN1 | 218 | PRL "Protein tyrosine phosphat | 0.649 | 0.229 | 0.38 | 1.2e-06 | |
| UNIPROTKB|Q5ZIQ1 | 173 | PTP4A1 "Uncharacterized protei | 0.844 | 0.375 | 0.409 | 1.6e-06 | |
| UNIPROTKB|I3L887 | 201 | PTP4A1 "Uncharacterized protei | 0.896 | 0.343 | 0.363 | 2.5e-06 | |
| ZFIN|ZDB-GENE-041121-11 | 269 | ptp4a1 "protein tyrosine phosp | 0.844 | 0.241 | 0.424 | 3.5e-06 | |
| UNIPROTKB|I3LCL5 | 198 | I3LCL5 "Uncharacterized protei | 0.545 | 0.212 | 0.5 | 4.1e-06 | |
| UNIPROTKB|G5E526 | 173 | PTP4A1 "Uncharacterized protei | 0.545 | 0.242 | 0.5 | 4.3e-06 |
| FB|FBgn0024734 PRL-1 "PRL-1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 149 (57.5 bits), Expect = 1.2e-10, P = 1.2e-10
Identities = 27/41 (65%), Positives = 34/41 (82%)
Query: 34 ELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSP 74
ELKK+ V VVRVCEP+Y ++L+T+GI VKDLA+EDGT P
Sbjct: 41 ELKKNNVNTVVRVCEPSYNTDELETQGITVKDLAFEDGTFP 81
|
|
| DICTYBASE|DDB_G0292024 DDB_G0292024 "putative protein tyrosine phosphatase, dual specificity" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00004184 prl-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| GENEDB_PFALCIPARUM|PF11_0139 PF11_0139 "protein tyrosine phosphatase, putative" [Plasmodium falciparum (taxid:5833)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IIN1 PRL "Protein tyrosine phosphatase" [Plasmodium falciparum 3D7 (taxid:36329)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZIQ1 PTP4A1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L887 PTP4A1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041121-11 ptp4a1 "protein tyrosine phosphatase type IVA, member 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LCL5 I3LCL5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5E526 PTP4A1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 77 | |||
| PTZ00242 | 166 | PTZ00242, PTZ00242, protein tyrosine phosphatase; | 3e-13 | |
| PTZ00393 | 241 | PTZ00393, PTZ00393, protein tyrosine phosphatase; | 9e-06 |
| >gnl|CDD|185524 PTZ00242, PTZ00242, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
Score = 60.4 bits (147), Expect = 3e-13
Identities = 21/48 (43%), Positives = 29/48 (60%)
Query: 28 LHLAYHELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPS 75
L L EL+++ V ++VRVC PTY E L+ GI V D ++DG P
Sbjct: 29 LPLYIKELQRYNVTHLVRVCGPTYDAELLEKNGIEVHDWPFDDGAPPP 76
|
Length = 166 |
| >gnl|CDD|240399 PTZ00393, PTZ00393, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 77 | |||
| KOG2836|consensus | 173 | 100.0 | ||
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 99.84 | |
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 99.74 | |
| KOG1720|consensus | 225 | 99.29 | ||
| PF05706 | 168 | CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) | 98.46 | |
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 97.24 | |
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 94.99 | |
| PF00782 | 133 | DSPc: Dual specificity phosphatase, catalytic doma | 93.89 | |
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 89.89 | |
| COG2453 | 180 | CDC14 Predicted protein-tyrosine phosphatase [Sign | 86.14 | |
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 85.86 | |
| PRK00726 | 357 | murG undecaprenyldiphospho-muramoylpentapeptide be | 83.06 | |
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 81.79 |
| >KOG2836|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-33 Score=198.87 Aligned_cols=69 Identities=38% Similarity=0.611 Sum_probs=66.4
Q ss_pred eeeeccceeEEeec-CCcccHHHHHHHHHhCCCeEEEEeCCCCcCchhhhcCCceEEEeecCCCCCCCCC
Q psy12446 9 RTLDYKTVTLYHGV-NLENHLHLAYHELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSPE 77 (77)
Q Consensus 9 ~~~~y~~~~fli~~-pt~~tl~~yi~elk~~~Vt~VVRvCe~tYd~~~~~~~GI~vhdl~F~DG~~Pp~~ 77 (77)
-+|+||+|||||++ |||+||+.||+|||+|||+.||||||||||+..+|++||.|.||+|+||++||.+
T Consensus 10 veIsy~~MrFLIThnPtnaTln~fieELkKygvttvVRVCe~TYdt~~lek~GI~Vldw~f~dg~ppp~q 79 (173)
T KOG2836|consen 10 VEISYKNMRFLITHNPTNATLNKFIEELKKYGVTTVVRVCEPTYDTTPLEKEGITVLDWPFDDGAPPPNQ 79 (173)
T ss_pred eeeeccceEEEEecCCCchhHHHHHHHHHhcCCeEEEEecccccCCchhhhcCceEeecccccCCCCchH
Confidence 47999999999987 6999999999999999999999999999999999999999999999999999963
|
|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG1720|consensus | Back alignment and domain information |
|---|
| >PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 77 | ||||
| 1x24_A | 180 | Prl-1 (Ptp4a) Length = 180 | 5e-06 | ||
| 1zcl_A | 180 | Prl-1 C104s Mutant In Complex With Sulfate Length = | 5e-06 | ||
| 3rz2_A | 189 | Crystal Of Prl-1 Complexed With Peptide Length = 18 | 5e-06 | ||
| 1zck_A | 154 | Native Structure Prl-1 (Ptp4a1) Length = 154 | 6e-06 | ||
| 1rxd_A | 159 | Crystal Structure Of Human Protein Tyrosine Phospha | 6e-06 | ||
| 1xm2_A | 173 | Crystal Structure Of Human Prl-1 Length = 173 | 7e-06 | ||
| 3s4o_A | 167 | Protein Tyrosine Phosphatase (Putative) From Leishm | 1e-04 | ||
| 1v3a_A | 173 | Structure Of Human Prl-3, The Phosphatase Associate | 1e-04 | ||
| 1r6h_A | 172 | Solution Structure Of Human Prl-3 Length = 172 | 1e-04 |
| >pdb|1X24|A Chain A, Prl-1 (Ptp4a) Length = 180 | Back alignment and structure |
|
| >pdb|1ZCL|A Chain A, Prl-1 C104s Mutant In Complex With Sulfate Length = 180 | Back alignment and structure |
| >pdb|3RZ2|A Chain A, Crystal Of Prl-1 Complexed With Peptide Length = 189 | Back alignment and structure |
| >pdb|1ZCK|A Chain A, Native Structure Prl-1 (Ptp4a1) Length = 154 | Back alignment and structure |
| >pdb|1RXD|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase 4a1 Length = 159 | Back alignment and structure |
| >pdb|1XM2|A Chain A, Crystal Structure Of Human Prl-1 Length = 173 | Back alignment and structure |
| >pdb|3S4O|A Chain A, Protein Tyrosine Phosphatase (Putative) From Leishmania Major Length = 167 | Back alignment and structure |
| >pdb|1V3A|A Chain A, Structure Of Human Prl-3, The Phosphatase Associated With Cancer Metastasis Length = 173 | Back alignment and structure |
| >pdb|1R6H|A Chain A, Solution Structure Of Human Prl-3 Length = 172 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 77 | |||
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 2e-10 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 1e-07 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 1e-06 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 4e-06 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 4e-06 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 1e-05 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 1e-04 |
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 | Back alignment and structure |
|---|
Score = 52.7 bits (126), Expect = 2e-10
Identities = 18/54 (33%), Positives = 30/54 (55%)
Query: 24 LENHLHLAYHELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSPE 77
++L EL+ V+++VRVC PTY +K+ GI+V ++DG P+
Sbjct: 32 SPSNLPTYIKELQHRGVRHLVRVCGPTYDATLVKSRGIDVHSWPFDDGAPPTRA 85
|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 77 | |||
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 99.45 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 99.4 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 99.17 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 98.49 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 98.37 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 98.27 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 98.04 | |
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 97.4 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 97.36 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 97.12 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 96.96 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 96.95 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 96.88 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 96.33 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 96.32 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 96.13 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 96.07 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 96.03 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 95.83 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 95.82 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 95.78 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 95.73 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 95.66 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 95.59 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 95.57 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 95.55 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 95.21 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 95.19 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 95.15 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 95.07 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 94.62 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 93.66 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 93.66 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 92.84 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 90.93 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 90.7 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 89.5 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 85.61 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 82.07 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 81.17 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 81.02 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 80.75 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 80.64 |
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
Probab=99.45 E-value=1.8e-13 Score=92.85 Aligned_cols=67 Identities=36% Similarity=0.569 Sum_probs=64.0
Q ss_pred eeeccceeEEee-cCCcccHHHHHHHHHhCCCeEEEEeCCCCcCchhhhcCCceEEEeecCCCCCCCC
Q psy12446 10 TLDYKTVTLYHG-VNLENHLHLAYHELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSP 76 (77)
Q Consensus 10 ~~~y~~~~fli~-~pt~~tl~~yi~elk~~~Vt~VVRvCe~tYd~~~~~~~GI~vhdl~F~DG~~Pp~ 76 (77)
+++|++.||+++ .|.+.|+.++++.|+++||+.||-+|++.|+.+.++..||++++||++||.+|+.
T Consensus 31 ~~~~~~~r~I~tq~P~~~t~~~~~~~L~~~gi~~Iv~l~~~~~~~~~~~~~~i~~~~~pi~d~~~~~~ 98 (189)
T 3rz2_A 31 EVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSN 98 (189)
T ss_dssp CEEETTEEEEEECCCCTTTHHHHHHHHHTTTEEEEEECSCCCSCCHHHHHSSCEEEECCCCSSSCCCS
T ss_pred eeecCCCeEEEeCCCCcccHHHHHHHHHHcCCcEEEEeCCCcCCHHHHHHcCcEEEEecCCCCCCCCH
Confidence 689999999996 7999999999999999999999999999999999999999999999999998874
|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 77 | ||||
| d1rxda_ | 152 | c.45.1.1 (A:) Protein tyrosine phosphatase type IV | 9e-05 | |
| d1ohea2 | 182 | c.45.1.1 (A:199-380) Proline directed phosphatase | 2e-04 |
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: Protein tyrosine phosphatase type IVa species: Human (Homo sapiens), pr-1 [TaxId: 9606]
Score = 36.2 bits (83), Expect = 9e-05
Identities = 21/45 (46%), Positives = 29/45 (64%)
Query: 33 HELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSPE 77
ELKK+ V +VRVCE TY ++ EGI+V D ++DG PS +
Sbjct: 27 EELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQ 71
|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 77 | |||
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 99.75 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 98.93 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 98.32 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 96.58 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 95.41 | |
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 94.98 | |
| d1vhra_ | 178 | VH1-related dual-specificity phosphatase, VHR {Hum | 94.7 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 90.69 | |
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 87.55 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 86.52 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 82.59 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 80.75 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 80.58 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 80.55 |
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: Protein tyrosine phosphatase type IVa species: Human (Homo sapiens), pr-1 [TaxId: 9606]
Probab=99.75 E-value=1.6e-18 Score=112.71 Aligned_cols=68 Identities=35% Similarity=0.551 Sum_probs=63.1
Q ss_pred eeeeccceeEEee-cCCcccHHHHHHHHHhCCCeEEEEeCCCCcCchhhhcCCceEEEeecCCCCCCCC
Q psy12446 9 RTLDYKTVTLYHG-VNLENHLHLAYHELKKHQVKNVVRVCEPTYKVEDLKTEGINVKDLAYEDGTSPSP 76 (77)
Q Consensus 9 ~~~~y~~~~fli~-~pt~~tl~~yi~elk~~~Vt~VVRvCe~tYd~~~~~~~GI~vhdl~F~DG~~Pp~ 76 (77)
.+|+||+|||+++ .|+++|+++|++.|+++||+.||.+|+..|+.+.++..||+++++|++|+++|+.
T Consensus 2 ~~~~y~~~rfI~tq~P~~~t~~~f~~~l~~~~i~~Iv~l~e~~y~~~~~~~~~i~~~~~~~~d~~~p~~ 70 (152)
T d1rxda_ 2 VEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSN 70 (152)
T ss_dssp EEEEETTEEEEECCCCCGGGHHHHHHHHHHTTEEEEEECSCCCSCCHHHHHTTCEEEECCC--CCCCCH
T ss_pred eeEeecCceEEEECCCCchhHHHHHHHHHHhCCeEEeecccccCCchheeecceEEEEeeCCCCCCCCH
Confidence 4799999999997 6999999999999999999999999999999999999999999999999999874
|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|