Psyllid ID: psy12461
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 294 | ||||||
| 242002940 | 458 | pre-mRNA-splicing factor, putative [Pedi | 0.445 | 0.286 | 0.684 | 3e-45 | |
| 91090784 | 500 | PREDICTED: similar to wd-repeat protein | 0.431 | 0.254 | 0.708 | 4e-45 | |
| 328723776 | 513 | PREDICTED: pre-mRNA-processing factor 19 | 0.431 | 0.247 | 0.677 | 7e-45 | |
| 332024009 | 503 | Pre-mRNA-processing factor 19 [Acromyrme | 0.465 | 0.272 | 0.652 | 7e-44 | |
| 239791755 | 353 | ACYPI005525 [Acyrthosiphon pisum] | 0.418 | 0.348 | 0.674 | 1e-43 | |
| 307178212 | 504 | Pre-mRNA-processing factor 19 [Camponotu | 0.462 | 0.269 | 0.649 | 1e-43 | |
| 340711277 | 504 | PREDICTED: pre-mRNA-processing factor 19 | 0.431 | 0.251 | 0.692 | 2e-43 | |
| 66513511 | 504 | PREDICTED: pre-mRNA-processing factor 19 | 0.431 | 0.251 | 0.692 | 2e-43 | |
| 380030253 | 504 | PREDICTED: pre-mRNA-processing factor 19 | 0.431 | 0.251 | 0.692 | 2e-43 | |
| 383852262 | 504 | PREDICTED: pre-mRNA-processing factor 19 | 0.431 | 0.251 | 0.692 | 2e-43 |
| >gi|242002940|ref|XP_002422550.1| pre-mRNA-splicing factor, putative [Pediculus humanus corporis] gi|212505340|gb|EEB09812.1| pre-mRNA-splicing factor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 187 bits (476), Expect = 3e-45, Method: Compositional matrix adjust.
Identities = 91/133 (68%), Positives = 107/133 (80%), Gaps = 2/133 (1%)
Query: 161 VPHANAIAAEAA-GTPNQPVEQIGISEEVQAKLQDKATILTQERKKRSRAAPEDLSTADN 219
+PH A+ AEA G PNQP E+ G++E+V KLQDKATILTQERKK+ R PEDL AD+
Sbjct: 97 IPHP-AVGAEAGPGLPNQPTEEAGMTEDVIQKLQDKATILTQERKKKGRTIPEDLVPADS 155
Query: 220 LRAFRNVSSQAGLHSASVPGILAMDIQVEDTSKILTGGNDCQATVFNKDTEQVVAILKGH 279
+R FR +SS GLHSAS+PGIL++D+ DTSKILTGGND AT+FNKDTEQVVAILKGH
Sbjct: 156 IRNFRTLSSHPGLHSASIPGILSLDVHAADTSKILTGGNDKNATIFNKDTEQVVAILKGH 215
Query: 280 RKKVTRVVYHPSE 292
KKVTRV+YHP E
Sbjct: 216 TKKVTRVIYHPEE 228
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|91090784|ref|XP_970005.1| PREDICTED: similar to wd-repeat protein [Tribolium castaneum] gi|270013971|gb|EFA10419.1| hypothetical protein TcasGA2_TC012659 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|328723776|ref|XP_003247938.1| PREDICTED: pre-mRNA-processing factor 19-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|332024009|gb|EGI64227.1| Pre-mRNA-processing factor 19 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|239791755|dbj|BAH72302.1| ACYPI005525 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|307178212|gb|EFN66997.1| Pre-mRNA-processing factor 19 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|340711277|ref|XP_003394205.1| PREDICTED: pre-mRNA-processing factor 19-like [Bombus terrestris] gi|350411998|ref|XP_003489512.1| PREDICTED: pre-mRNA-processing factor 19-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|66513511|ref|XP_392284.2| PREDICTED: pre-mRNA-processing factor 19 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380030253|ref|XP_003698766.1| PREDICTED: pre-mRNA-processing factor 19 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|383852262|ref|XP_003701647.1| PREDICTED: pre-mRNA-processing factor 19 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 294 | ||||||
| FB|FBgn0261119 | 505 | Prp19 "Prp19" [Drosophila mela | 0.431 | 0.251 | 0.677 | 4.6e-41 | |
| ZFIN|ZDB-GENE-030131-263 | 505 | prp19 "PRP19/PSO4 homolog (S. | 0.445 | 0.259 | 0.519 | 6e-32 | |
| MGI|MGI:106247 | 504 | Prpf19 "PRP19/PSO4 pre-mRNA pr | 0.411 | 0.240 | 0.561 | 9.8e-32 | |
| RGD|708496 | 504 | Prpf19 "PRP19/PSO4 pre-mRNA pr | 0.411 | 0.240 | 0.561 | 9.8e-32 | |
| UNIPROTKB|Q9JMJ4 | 504 | Prpf19 "Pre-mRNA-processing fa | 0.411 | 0.240 | 0.561 | 9.8e-32 | |
| UNIPROTKB|E2R8L3 | 513 | PRPF19 "Uncharacterized protei | 0.445 | 0.255 | 0.530 | 2.1e-31 | |
| UNIPROTKB|Q08E38 | 504 | PRPF19 "Pre-mRNA-processing fa | 0.411 | 0.240 | 0.553 | 2.9e-31 | |
| UNIPROTKB|Q9UMS4 | 504 | PRPF19 "Pre-mRNA-processing fa | 0.411 | 0.240 | 0.553 | 2.9e-31 | |
| UNIPROTKB|B2CCY7 | 504 | PRPF19 "Nuclear matrix protein | 0.411 | 0.240 | 0.553 | 2.9e-31 | |
| UNIPROTKB|Q5ZMA2 | 505 | PRPF19 "Pre-mRNA-processing fa | 0.445 | 0.259 | 0.496 | 1.3e-25 |
| FB|FBgn0261119 Prp19 "Prp19" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 436 (158.5 bits), Expect = 4.6e-41, P = 4.6e-41
Identities = 86/127 (67%), Positives = 100/127 (78%)
Query: 166 AIAAEAAGTPNQPVEQIGISEEVQAKLQDKATILTQERKKRSRAAPEDLSTADNLRAFRN 225
A+A+EA G P+EQ G+S EV KLQDKAT+LTQERKKR R PEDL T D ++ F
Sbjct: 151 ALASEAGGAAAHPMEQAGMSAEVIQKLQDKATVLTQERKKRGRTVPEDLVTTDQVKNFLT 210
Query: 226 VSSQAGLHSASVPGILAMDIQVEDTSKILTGGNDCQATVFNKDTEQVVAILKGHRKKVTR 285
V+S GLHSASVPGILA+DI D SKILTGGND ATVFNKDTEQ+VAILKGH KK+T+
Sbjct: 211 VASHPGLHSASVPGILALDINSADHSKILTGGNDKNATVFNKDTEQMVAILKGHTKKITK 270
Query: 286 VVYHPSE 292
V+YHP+E
Sbjct: 271 VIYHPNE 277
|
|
| ZFIN|ZDB-GENE-030131-263 prp19 "PRP19/PSO4 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:106247 Prpf19 "PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|708496 Prpf19 "PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9JMJ4 Prpf19 "Pre-mRNA-processing factor 19" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R8L3 PRPF19 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q08E38 PRPF19 "Pre-mRNA-processing factor 19" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UMS4 PRPF19 "Pre-mRNA-processing factor 19" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B2CCY7 PRPF19 "Nuclear matrix protein 200" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZMA2 PRPF19 "Pre-mRNA-processing factor 19" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 294 | |||
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 0.001 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 0.002 | |
| cd00200 | 289 | cd00200, WD40, WD40 domain, found in a number of e | 0.004 |
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
Score = 39.6 bits (93), Expect = 0.001
Identities = 14/59 (23%), Positives = 27/59 (45%), Gaps = 4/59 (6%)
Query: 233 HSASVPGILAMDIQVEDTSKILTGGNDCQATVFNKDTEQVVAILKGHRKKVTRVVYHPS 291
H+ V + A D + + +G +D +++ +T + V L GH V+ V + P
Sbjct: 50 HTGPVRDVAASA----DGTYLASGSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPD 104
|
Length = 289 |
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
| >gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 294 | |||
| KOG0289|consensus | 506 | 99.77 | ||
| KOG0272|consensus | 459 | 98.88 | ||
| KOG0271|consensus | 480 | 98.87 | ||
| KOG0263|consensus | 707 | 98.73 | ||
| KOG0286|consensus | 343 | 98.71 | ||
| KOG0276|consensus | 794 | 98.68 | ||
| KOG0266|consensus | 456 | 98.68 | ||
| KOG0279|consensus | 315 | 98.6 | ||
| KOG0264|consensus | 422 | 98.57 | ||
| KOG0270|consensus | 463 | 98.54 | ||
| KOG0266|consensus | 456 | 98.49 | ||
| PTZ00421 | 493 | coronin; Provisional | 98.45 | |
| KOG0271|consensus | 480 | 98.39 | ||
| KOG0279|consensus | 315 | 98.38 | ||
| PTZ00421 | 493 | coronin; Provisional | 98.36 | |
| KOG0285|consensus | 460 | 98.35 | ||
| KOG0263|consensus | 707 | 98.34 | ||
| KOG0275|consensus | 508 | 98.28 | ||
| PTZ00420 | 568 | coronin; Provisional | 98.28 | |
| KOG0319|consensus | 775 | 98.27 | ||
| KOG0319|consensus | 775 | 98.24 | ||
| KOG0291|consensus | 893 | 98.22 | ||
| KOG0272|consensus | 459 | 98.21 | ||
| KOG0302|consensus | 440 | 98.21 | ||
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 98.19 | |
| KOG0285|consensus | 460 | 98.17 | ||
| KOG0318|consensus | 603 | 98.06 | ||
| KOG0284|consensus | 464 | 98.05 | ||
| KOG0284|consensus | 464 | 98.04 | ||
| KOG0282|consensus | 503 | 98.01 | ||
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 98.0 | |
| PTZ00420 | 568 | coronin; Provisional | 97.99 | |
| KOG0322|consensus | 323 | 97.99 | ||
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 97.98 | |
| KOG0283|consensus | 712 | 97.98 | ||
| KOG1007|consensus | 370 | 97.96 | ||
| KOG0650|consensus | 733 | 97.95 | ||
| KOG0276|consensus | 794 | 97.95 | ||
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 97.94 | |
| KOG0316|consensus | 307 | 97.94 | ||
| KOG2394|consensus | 636 | 97.94 | ||
| KOG0299|consensus | 479 | 97.93 | ||
| KOG0267|consensus | 825 | 97.93 | ||
| KOG0645|consensus | 312 | 97.92 | ||
| KOG0295|consensus | 406 | 97.91 | ||
| KOG0289|consensus | 506 | 97.91 | ||
| KOG0315|consensus | 311 | 97.91 | ||
| KOG0295|consensus | 406 | 97.9 | ||
| KOG0283|consensus | 712 | 97.9 | ||
| KOG0277|consensus | 311 | 97.88 | ||
| KOG0288|consensus | 459 | 97.87 | ||
| KOG0286|consensus | 343 | 97.81 | ||
| KOG0293|consensus | 519 | 97.81 | ||
| KOG1034|consensus | 385 | 97.8 | ||
| KOG0277|consensus | 311 | 97.8 | ||
| KOG0273|consensus | 524 | 97.79 | ||
| KOG1273|consensus | 405 | 97.76 | ||
| KOG0282|consensus | 503 | 97.74 | ||
| KOG0269|consensus | 839 | 97.73 | ||
| KOG0292|consensus | 1202 | 97.72 | ||
| KOG0267|consensus | 825 | 97.72 | ||
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 97.71 | |
| KOG0313|consensus | 423 | 97.71 | ||
| KOG0315|consensus | 311 | 97.68 | ||
| KOG1445|consensus | 1012 | 97.68 | ||
| KOG0294|consensus | 362 | 97.68 | ||
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 97.68 | |
| KOG0273|consensus | 524 | 97.66 | ||
| KOG0281|consensus | 499 | 97.66 | ||
| KOG0293|consensus | 519 | 97.66 | ||
| KOG0294|consensus | 362 | 97.65 | ||
| KOG0973|consensus | 942 | 97.65 | ||
| KOG1407|consensus | 313 | 97.65 | ||
| KOG0292|consensus | 1202 | 97.64 | ||
| KOG0305|consensus | 484 | 97.62 | ||
| KOG0300|consensus | 481 | 97.62 | ||
| KOG0296|consensus | 399 | 97.61 | ||
| KOG0313|consensus | 423 | 97.6 | ||
| KOG0265|consensus | 338 | 97.6 | ||
| KOG0269|consensus | 839 | 97.6 | ||
| KOG0318|consensus | 603 | 97.59 | ||
| KOG0296|consensus | 399 | 97.58 | ||
| KOG0316|consensus | 307 | 97.58 | ||
| KOG0643|consensus | 327 | 97.57 | ||
| KOG0645|consensus | 312 | 97.56 | ||
| KOG0281|consensus | 499 | 97.55 | ||
| KOG4283|consensus | 397 | 97.55 | ||
| KOG0274|consensus | 537 | 97.54 | ||
| KOG0303|consensus | 472 | 97.52 | ||
| KOG0288|consensus | 459 | 97.52 | ||
| KOG0265|consensus | 338 | 97.5 | ||
| KOG0306|consensus | 888 | 97.48 | ||
| KOG1273|consensus | 405 | 97.45 | ||
| KOG0647|consensus | 347 | 97.45 | ||
| KOG0302|consensus | 440 | 97.44 | ||
| KOG0275|consensus | 508 | 97.43 | ||
| KOG4328|consensus | 498 | 97.4 | ||
| KOG0310|consensus | 487 | 97.4 | ||
| KOG0973|consensus | 942 | 97.39 | ||
| KOG0640|consensus | 430 | 97.38 | ||
| KOG0291|consensus | 893 | 97.37 | ||
| KOG0310|consensus | 487 | 97.36 | ||
| KOG1539|consensus | 910 | 97.34 | ||
| KOG0639|consensus | 705 | 97.33 | ||
| KOG0278|consensus | 334 | 97.31 | ||
| KOG0646|consensus | 476 | 97.3 | ||
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 97.29 | |
| KOG1332|consensus | 299 | 97.28 | ||
| KOG0647|consensus | 347 | 97.23 | ||
| KOG0268|consensus | 433 | 97.23 | ||
| KOG1310|consensus | 758 | 97.23 | ||
| KOG0308|consensus | 735 | 97.21 | ||
| KOG0308|consensus | 735 | 97.2 | ||
| KOG0640|consensus | 430 | 97.14 | ||
| KOG0264|consensus | 422 | 97.13 | ||
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 97.13 | |
| KOG0303|consensus | 472 | 97.13 | ||
| KOG0274|consensus | 537 | 97.12 | ||
| KOG1446|consensus | 311 | 97.11 | ||
| KOG0268|consensus | 433 | 97.09 | ||
| KOG0772|consensus | 641 | 97.07 | ||
| KOG2394|consensus | 636 | 97.06 | ||
| smart00320 | 40 | WD40 WD40 repeats. Note that these repeats are per | 97.04 | |
| KOG0771|consensus | 398 | 97.03 | ||
| KOG2110|consensus | 391 | 97.01 | ||
| KOG0307|consensus | 1049 | 96.98 | ||
| KOG2111|consensus | 346 | 96.97 | ||
| KOG1274|consensus | 933 | 96.95 | ||
| KOG0641|consensus | 350 | 96.93 | ||
| KOG1408|consensus | 1080 | 96.87 | ||
| KOG1524|consensus | 737 | 96.86 | ||
| KOG0771|consensus | 398 | 96.77 | ||
| KOG0649|consensus | 325 | 96.75 | ||
| KOG0642|consensus | 577 | 96.73 | ||
| KOG1036|consensus | 323 | 96.71 | ||
| KOG0290|consensus | 364 | 96.71 | ||
| KOG1009|consensus | 434 | 96.69 | ||
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 96.65 | |
| KOG1332|consensus | 299 | 96.65 | ||
| KOG0305|consensus | 484 | 96.52 | ||
| KOG1407|consensus | 313 | 96.51 | ||
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 96.48 | |
| KOG0306|consensus | 888 | 96.46 | ||
| KOG4328|consensus | 498 | 96.45 | ||
| KOG1009|consensus | 434 | 96.45 | ||
| KOG0772|consensus | 641 | 96.44 | ||
| KOG0278|consensus | 334 | 96.43 | ||
| KOG1538|consensus | 1081 | 96.4 | ||
| KOG4283|consensus | 397 | 96.38 | ||
| KOG1188|consensus | 376 | 96.31 | ||
| KOG4714|consensus | 319 | 96.29 | ||
| KOG0643|consensus | 327 | 96.28 | ||
| KOG2445|consensus | 361 | 96.28 | ||
| KOG1408|consensus | 1080 | 96.25 | ||
| KOG0290|consensus | 364 | 96.2 | ||
| KOG1063|consensus | 764 | 96.19 | ||
| KOG0641|consensus | 350 | 96.18 | ||
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 96.1 | |
| KOG4547|consensus | 541 | 95.94 | ||
| KOG0300|consensus | 481 | 95.94 | ||
| KOG0644|consensus | 1113 | 95.93 | ||
| KOG2096|consensus | 420 | 95.92 | ||
| KOG0301|consensus | 745 | 95.9 | ||
| KOG1445|consensus | 1012 | 95.89 | ||
| KOG0646|consensus | 476 | 95.85 | ||
| KOG0974|consensus | 967 | 95.78 | ||
| KOG0321|consensus | 720 | 95.78 | ||
| KOG1240|consensus | 1431 | 95.73 | ||
| KOG1274|consensus | 933 | 95.63 | ||
| KOG0307|consensus | 1049 | 95.61 | ||
| KOG1036|consensus | 323 | 95.58 | ||
| KOG1272|consensus | 545 | 95.5 | ||
| KOG0642|consensus | 577 | 95.46 | ||
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 95.44 | |
| KOG0301|consensus | 745 | 95.4 | ||
| KOG1538|consensus | 1081 | 95.32 | ||
| KOG1446|consensus | 311 | 95.22 | ||
| KOG2055|consensus | 514 | 95.1 | ||
| KOG0299|consensus | 479 | 95.03 | ||
| KOG2919|consensus | 406 | 95.02 | ||
| KOG1587|consensus | 555 | 94.98 | ||
| KOG2110|consensus | 391 | 94.9 | ||
| KOG1063|consensus | 764 | 94.75 | ||
| PRK01742 | 429 | tolB translocation protein TolB; Provisional | 94.69 | |
| KOG0650|consensus | 733 | 94.62 | ||
| KOG2919|consensus | 406 | 94.62 | ||
| KOG0644|consensus | 1113 | 94.62 | ||
| KOG1539|consensus | 910 | 94.61 | ||
| KOG4378|consensus | 673 | 94.49 | ||
| KOG0270|consensus | 463 | 94.4 | ||
| KOG1587|consensus | 555 | 94.26 | ||
| KOG2106|consensus | 626 | 94.26 | ||
| KOG0649|consensus | 325 | 94.24 | ||
| KOG1334|consensus | 559 | 94.21 | ||
| KOG0639|consensus | 705 | 94.2 | ||
| KOG4378|consensus | 673 | 94.1 | ||
| KOG1523|consensus | 361 | 94.04 | ||
| KOG3914|consensus | 390 | 93.94 | ||
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 93.9 | |
| PF11768 | 545 | DUF3312: Protein of unknown function (DUF3312); In | 93.9 | |
| PRK01742 | 429 | tolB translocation protein TolB; Provisional | 93.62 | |
| PF12894 | 47 | Apc4_WD40: Anaphase-promoting complex subunit 4 WD | 93.46 | |
| KOG2055|consensus | 514 | 93.36 | ||
| KOG2048|consensus | 691 | 93.35 | ||
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 93.08 | |
| KOG2096|consensus | 420 | 92.88 | ||
| KOG1523|consensus | 361 | 92.83 | ||
| KOG2139|consensus | 445 | 92.59 | ||
| KOG1188|consensus | 376 | 92.47 | ||
| KOG2079|consensus | 1206 | 92.2 | ||
| KOG1963|consensus | 792 | 92.1 | ||
| KOG1524|consensus | 737 | 91.86 | ||
| TIGR02800 | 417 | propeller_TolB tol-pal system beta propeller repea | 91.8 | |
| KOG2321|consensus | 703 | 91.78 | ||
| PRK02889 | 427 | tolB translocation protein TolB; Provisional | 91.54 | |
| KOG0280|consensus | 339 | 91.53 | ||
| KOG0322|consensus | 323 | 91.15 | ||
| KOG2445|consensus | 361 | 90.69 | ||
| KOG2041|consensus | 1189 | 90.62 | ||
| KOG2106|consensus | 626 | 90.54 | ||
| KOG1034|consensus | 385 | 90.38 | ||
| KOG1645|consensus | 463 | 90.06 | ||
| KOG1064|consensus | 2439 | 89.47 | ||
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 89.35 | |
| KOG2315|consensus | 566 | 89.18 | ||
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 89.09 | |
| KOG2139|consensus | 445 | 89.06 | ||
| KOG0321|consensus | 720 | 88.96 | ||
| KOG4532|consensus | 344 | 88.87 | ||
| PRK02889 | 427 | tolB translocation protein TolB; Provisional | 88.87 | |
| PRK00178 | 430 | tolB translocation protein TolB; Provisional | 88.46 | |
| KOG1963|consensus | 792 | 88.19 | ||
| KOG4547|consensus | 541 | 88.11 | ||
| KOG4227|consensus | 609 | 87.88 | ||
| PRK04922 | 433 | tolB translocation protein TolB; Provisional | 87.69 | |
| PRK05137 | 435 | tolB translocation protein TolB; Provisional | 87.17 | |
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 86.92 | |
| PRK00178 | 430 | tolB translocation protein TolB; Provisional | 86.86 | |
| KOG1272|consensus | 545 | 86.69 | ||
| KOG1310|consensus | 758 | 86.62 | ||
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 86.12 | |
| KOG3881|consensus | 412 | 86.11 | ||
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 85.23 | |
| PRK01029 | 428 | tolB translocation protein TolB; Provisional | 84.5 | |
| KOG3881|consensus | 412 | 83.92 | ||
| KOG2048|consensus | 691 | 83.64 | ||
| KOG1007|consensus | 370 | 83.63 | ||
| KOG2695|consensus | 425 | 83.61 | ||
| PRK04792 | 448 | tolB translocation protein TolB; Provisional | 83.46 | |
| KOG2314|consensus | 698 | 83.42 | ||
| KOG1334|consensus | 559 | 83.18 | ||
| smart00320 | 40 | WD40 WD40 repeats. Note that these repeats are per | 83.06 | |
| KOG2066|consensus | 846 | 82.6 | ||
| KOG0280|consensus | 339 | 81.69 | ||
| KOG1832|consensus | 1516 | 81.24 | ||
| KOG4190|consensus | 1034 | 80.77 | ||
| KOG1409|consensus | 404 | 80.75 |
| >KOG0289|consensus | Back alignment and domain information |
|---|
Probab=99.77 E-value=5.5e-19 Score=173.59 Aligned_cols=118 Identities=51% Similarity=0.765 Sum_probs=110.8
Q ss_pred cCCCCCCcccCCCCCHHHHHHHHHHHHHHhhhhcccCCCCCCCCCChhhhccccccccccCCcCCCCCCEEEEEeccCCC
Q psy12461 171 AAGTPNQPVEQIGISEEVQAKLQDKATILTQERKKRSRAAPEDLSTADNLRAFRNVSSQAGLHSASVPGILAMDIQVEDT 250 (294)
Q Consensus 171 ~~g~aMev~ee~GLPeeVI~kL~etak~LSs~RKKRgK~vPe~LAS~E~Iksyk~tsS~p~lHSas~pGIlSLdfSpsDg 250 (294)
++|+.|+ ..||.++++++++++++.|++.||||||+.|++|++.+++..|.+.++++++|++..++|++++..++ .
T Consensus 156 a~ge~~d---~~g~s~~i~~~l~~~aq~ls~~rKkrg~k~p~~la~~d~~~~~~q~ash~gLH~t~~pgi~ald~~~s-~ 231 (506)
T KOG0289|consen 156 AAGESED---QPGLSPEIIQKLEDKAQVLSQERKKRGKKLPEKLATTDELSCLLQVASHTGLHSTSTPGITALDIIPS-S 231 (506)
T ss_pred hcCCccc---cccCCHHHHHHHHHHHHHHHHHhhhccccCCcccccHHHHHHHHhcCCCcceeccCCCCeeEEeecCC-C
Confidence 3455554 57999999999999999999999999999999999999999999999999999999999999999985 7
Q ss_pred CEEEEecCCCcEEEEeCCCcceEEEeccCCCcEEEEEECCCC
Q psy12461 251 SKILTGGNDCQATVFNKDTEQVVAILKGHRKKVTRVVYHPSE 292 (294)
Q Consensus 251 nlLATGG~DGTVkVWDleTgKvV~TLkGHTkkVtSVaFhPd~ 292 (294)
+.++|||.|+++.|||..+++++.+|+||+++|++|.|||+.
T Consensus 232 ~~ilTGG~d~~av~~d~~s~q~l~~~~Gh~kki~~v~~~~~~ 273 (506)
T KOG0289|consen 232 SKILTGGEDKTAVLFDKPSNQILATLKGHTKKITSVKFHKDL 273 (506)
T ss_pred CcceecCCCCceEEEecchhhhhhhccCcceEEEEEEeccch
Confidence 899999999999999999999999999999999999999975
|
|
| >KOG0272|consensus | Back alignment and domain information |
|---|
| >KOG0271|consensus | Back alignment and domain information |
|---|
| >KOG0263|consensus | Back alignment and domain information |
|---|
| >KOG0286|consensus | Back alignment and domain information |
|---|
| >KOG0276|consensus | Back alignment and domain information |
|---|
| >KOG0266|consensus | Back alignment and domain information |
|---|
| >KOG0279|consensus | Back alignment and domain information |
|---|
| >KOG0264|consensus | Back alignment and domain information |
|---|
| >KOG0270|consensus | Back alignment and domain information |
|---|
| >KOG0266|consensus | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0271|consensus | Back alignment and domain information |
|---|
| >KOG0279|consensus | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0285|consensus | Back alignment and domain information |
|---|
| >KOG0263|consensus | Back alignment and domain information |
|---|
| >KOG0275|consensus | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0319|consensus | Back alignment and domain information |
|---|
| >KOG0319|consensus | Back alignment and domain information |
|---|
| >KOG0291|consensus | Back alignment and domain information |
|---|
| >KOG0272|consensus | Back alignment and domain information |
|---|
| >KOG0302|consensus | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0285|consensus | Back alignment and domain information |
|---|
| >KOG0318|consensus | Back alignment and domain information |
|---|
| >KOG0284|consensus | Back alignment and domain information |
|---|
| >KOG0284|consensus | Back alignment and domain information |
|---|
| >KOG0282|consensus | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0322|consensus | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >KOG0283|consensus | Back alignment and domain information |
|---|
| >KOG1007|consensus | Back alignment and domain information |
|---|
| >KOG0650|consensus | Back alignment and domain information |
|---|
| >KOG0276|consensus | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0316|consensus | Back alignment and domain information |
|---|
| >KOG2394|consensus | Back alignment and domain information |
|---|
| >KOG0299|consensus | Back alignment and domain information |
|---|
| >KOG0267|consensus | Back alignment and domain information |
|---|
| >KOG0645|consensus | Back alignment and domain information |
|---|
| >KOG0295|consensus | Back alignment and domain information |
|---|
| >KOG0289|consensus | Back alignment and domain information |
|---|
| >KOG0315|consensus | Back alignment and domain information |
|---|
| >KOG0295|consensus | Back alignment and domain information |
|---|
| >KOG0283|consensus | Back alignment and domain information |
|---|
| >KOG0277|consensus | Back alignment and domain information |
|---|
| >KOG0288|consensus | Back alignment and domain information |
|---|
| >KOG0286|consensus | Back alignment and domain information |
|---|
| >KOG0293|consensus | Back alignment and domain information |
|---|
| >KOG1034|consensus | Back alignment and domain information |
|---|
| >KOG0277|consensus | Back alignment and domain information |
|---|
| >KOG0273|consensus | Back alignment and domain information |
|---|
| >KOG1273|consensus | Back alignment and domain information |
|---|
| >KOG0282|consensus | Back alignment and domain information |
|---|
| >KOG0269|consensus | Back alignment and domain information |
|---|
| >KOG0292|consensus | Back alignment and domain information |
|---|
| >KOG0267|consensus | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG0313|consensus | Back alignment and domain information |
|---|
| >KOG0315|consensus | Back alignment and domain information |
|---|
| >KOG1445|consensus | Back alignment and domain information |
|---|
| >KOG0294|consensus | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0273|consensus | Back alignment and domain information |
|---|
| >KOG0281|consensus | Back alignment and domain information |
|---|
| >KOG0293|consensus | Back alignment and domain information |
|---|
| >KOG0294|consensus | Back alignment and domain information |
|---|
| >KOG0973|consensus | Back alignment and domain information |
|---|
| >KOG1407|consensus | Back alignment and domain information |
|---|
| >KOG0292|consensus | Back alignment and domain information |
|---|
| >KOG0305|consensus | Back alignment and domain information |
|---|
| >KOG0300|consensus | Back alignment and domain information |
|---|
| >KOG0296|consensus | Back alignment and domain information |
|---|
| >KOG0313|consensus | Back alignment and domain information |
|---|
| >KOG0265|consensus | Back alignment and domain information |
|---|
| >KOG0269|consensus | Back alignment and domain information |
|---|
| >KOG0318|consensus | Back alignment and domain information |
|---|
| >KOG0296|consensus | Back alignment and domain information |
|---|
| >KOG0316|consensus | Back alignment and domain information |
|---|
| >KOG0643|consensus | Back alignment and domain information |
|---|
| >KOG0645|consensus | Back alignment and domain information |
|---|
| >KOG0281|consensus | Back alignment and domain information |
|---|
| >KOG4283|consensus | Back alignment and domain information |
|---|
| >KOG0274|consensus | Back alignment and domain information |
|---|
| >KOG0303|consensus | Back alignment and domain information |
|---|
| >KOG0288|consensus | Back alignment and domain information |
|---|
| >KOG0265|consensus | Back alignment and domain information |
|---|
| >KOG0306|consensus | Back alignment and domain information |
|---|
| >KOG1273|consensus | Back alignment and domain information |
|---|
| >KOG0647|consensus | Back alignment and domain information |
|---|
| >KOG0302|consensus | Back alignment and domain information |
|---|
| >KOG0275|consensus | Back alignment and domain information |
|---|
| >KOG4328|consensus | Back alignment and domain information |
|---|
| >KOG0310|consensus | Back alignment and domain information |
|---|
| >KOG0973|consensus | Back alignment and domain information |
|---|
| >KOG0640|consensus | Back alignment and domain information |
|---|
| >KOG0291|consensus | Back alignment and domain information |
|---|
| >KOG0310|consensus | Back alignment and domain information |
|---|
| >KOG1539|consensus | Back alignment and domain information |
|---|
| >KOG0639|consensus | Back alignment and domain information |
|---|
| >KOG0278|consensus | Back alignment and domain information |
|---|
| >KOG0646|consensus | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1332|consensus | Back alignment and domain information |
|---|
| >KOG0647|consensus | Back alignment and domain information |
|---|
| >KOG0268|consensus | Back alignment and domain information |
|---|
| >KOG1310|consensus | Back alignment and domain information |
|---|
| >KOG0308|consensus | Back alignment and domain information |
|---|
| >KOG0308|consensus | Back alignment and domain information |
|---|
| >KOG0640|consensus | Back alignment and domain information |
|---|
| >KOG0264|consensus | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG0303|consensus | Back alignment and domain information |
|---|
| >KOG0274|consensus | Back alignment and domain information |
|---|
| >KOG1446|consensus | Back alignment and domain information |
|---|
| >KOG0268|consensus | Back alignment and domain information |
|---|
| >KOG0772|consensus | Back alignment and domain information |
|---|
| >KOG2394|consensus | Back alignment and domain information |
|---|
| >smart00320 WD40 WD40 repeats | Back alignment and domain information |
|---|
| >KOG0771|consensus | Back alignment and domain information |
|---|
| >KOG2110|consensus | Back alignment and domain information |
|---|
| >KOG0307|consensus | Back alignment and domain information |
|---|
| >KOG2111|consensus | Back alignment and domain information |
|---|
| >KOG1274|consensus | Back alignment and domain information |
|---|
| >KOG0641|consensus | Back alignment and domain information |
|---|
| >KOG1408|consensus | Back alignment and domain information |
|---|
| >KOG1524|consensus | Back alignment and domain information |
|---|
| >KOG0771|consensus | Back alignment and domain information |
|---|
| >KOG0649|consensus | Back alignment and domain information |
|---|
| >KOG0642|consensus | Back alignment and domain information |
|---|
| >KOG1036|consensus | Back alignment and domain information |
|---|
| >KOG0290|consensus | Back alignment and domain information |
|---|
| >KOG1009|consensus | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG1332|consensus | Back alignment and domain information |
|---|
| >KOG0305|consensus | Back alignment and domain information |
|---|
| >KOG1407|consensus | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG0306|consensus | Back alignment and domain information |
|---|
| >KOG4328|consensus | Back alignment and domain information |
|---|
| >KOG1009|consensus | Back alignment and domain information |
|---|
| >KOG0772|consensus | Back alignment and domain information |
|---|
| >KOG0278|consensus | Back alignment and domain information |
|---|
| >KOG1538|consensus | Back alignment and domain information |
|---|
| >KOG4283|consensus | Back alignment and domain information |
|---|
| >KOG1188|consensus | Back alignment and domain information |
|---|
| >KOG4714|consensus | Back alignment and domain information |
|---|
| >KOG0643|consensus | Back alignment and domain information |
|---|
| >KOG2445|consensus | Back alignment and domain information |
|---|
| >KOG1408|consensus | Back alignment and domain information |
|---|
| >KOG0290|consensus | Back alignment and domain information |
|---|
| >KOG1063|consensus | Back alignment and domain information |
|---|
| >KOG0641|consensus | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4547|consensus | Back alignment and domain information |
|---|
| >KOG0300|consensus | Back alignment and domain information |
|---|
| >KOG0644|consensus | Back alignment and domain information |
|---|
| >KOG2096|consensus | Back alignment and domain information |
|---|
| >KOG0301|consensus | Back alignment and domain information |
|---|
| >KOG1445|consensus | Back alignment and domain information |
|---|
| >KOG0646|consensus | Back alignment and domain information |
|---|
| >KOG0974|consensus | Back alignment and domain information |
|---|
| >KOG0321|consensus | Back alignment and domain information |
|---|
| >KOG1240|consensus | Back alignment and domain information |
|---|
| >KOG1274|consensus | Back alignment and domain information |
|---|
| >KOG0307|consensus | Back alignment and domain information |
|---|
| >KOG1036|consensus | Back alignment and domain information |
|---|
| >KOG1272|consensus | Back alignment and domain information |
|---|
| >KOG0642|consensus | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >KOG0301|consensus | Back alignment and domain information |
|---|
| >KOG1538|consensus | Back alignment and domain information |
|---|
| >KOG1446|consensus | Back alignment and domain information |
|---|
| >KOG2055|consensus | Back alignment and domain information |
|---|
| >KOG0299|consensus | Back alignment and domain information |
|---|
| >KOG2919|consensus | Back alignment and domain information |
|---|
| >KOG1587|consensus | Back alignment and domain information |
|---|
| >KOG2110|consensus | Back alignment and domain information |
|---|
| >KOG1063|consensus | Back alignment and domain information |
|---|
| >PRK01742 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0650|consensus | Back alignment and domain information |
|---|
| >KOG2919|consensus | Back alignment and domain information |
|---|
| >KOG0644|consensus | Back alignment and domain information |
|---|
| >KOG1539|consensus | Back alignment and domain information |
|---|
| >KOG4378|consensus | Back alignment and domain information |
|---|
| >KOG0270|consensus | Back alignment and domain information |
|---|
| >KOG1587|consensus | Back alignment and domain information |
|---|
| >KOG2106|consensus | Back alignment and domain information |
|---|
| >KOG0649|consensus | Back alignment and domain information |
|---|
| >KOG1334|consensus | Back alignment and domain information |
|---|
| >KOG0639|consensus | Back alignment and domain information |
|---|
| >KOG4378|consensus | Back alignment and domain information |
|---|
| >KOG1523|consensus | Back alignment and domain information |
|---|
| >KOG3914|consensus | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats | Back alignment and domain information |
|---|
| >PRK01742 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain | Back alignment and domain information |
|---|
| >KOG2055|consensus | Back alignment and domain information |
|---|
| >KOG2048|consensus | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >KOG2096|consensus | Back alignment and domain information |
|---|
| >KOG1523|consensus | Back alignment and domain information |
|---|
| >KOG2139|consensus | Back alignment and domain information |
|---|
| >KOG1188|consensus | Back alignment and domain information |
|---|
| >KOG2079|consensus | Back alignment and domain information |
|---|
| >KOG1963|consensus | Back alignment and domain information |
|---|
| >KOG1524|consensus | Back alignment and domain information |
|---|
| >TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB | Back alignment and domain information |
|---|
| >KOG2321|consensus | Back alignment and domain information |
|---|
| >PRK02889 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG0280|consensus | Back alignment and domain information |
|---|
| >KOG0322|consensus | Back alignment and domain information |
|---|
| >KOG2445|consensus | Back alignment and domain information |
|---|
| >KOG2041|consensus | Back alignment and domain information |
|---|
| >KOG2106|consensus | Back alignment and domain information |
|---|
| >KOG1034|consensus | Back alignment and domain information |
|---|
| >KOG1645|consensus | Back alignment and domain information |
|---|
| >KOG1064|consensus | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG2315|consensus | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG2139|consensus | Back alignment and domain information |
|---|
| >KOG0321|consensus | Back alignment and domain information |
|---|
| >KOG4532|consensus | Back alignment and domain information |
|---|
| >PRK02889 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK00178 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1963|consensus | Back alignment and domain information |
|---|
| >KOG4547|consensus | Back alignment and domain information |
|---|
| >KOG4227|consensus | Back alignment and domain information |
|---|
| >PRK04922 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK05137 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >PRK00178 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG1272|consensus | Back alignment and domain information |
|---|
| >KOG1310|consensus | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >KOG3881|consensus | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PRK01029 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG3881|consensus | Back alignment and domain information |
|---|
| >KOG2048|consensus | Back alignment and domain information |
|---|
| >KOG1007|consensus | Back alignment and domain information |
|---|
| >KOG2695|consensus | Back alignment and domain information |
|---|
| >PRK04792 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >KOG2314|consensus | Back alignment and domain information |
|---|
| >KOG1334|consensus | Back alignment and domain information |
|---|
| >smart00320 WD40 WD40 repeats | Back alignment and domain information |
|---|
| >KOG2066|consensus | Back alignment and domain information |
|---|
| >KOG0280|consensus | Back alignment and domain information |
|---|
| >KOG1832|consensus | Back alignment and domain information |
|---|
| >KOG4190|consensus | Back alignment and domain information |
|---|
| >KOG1409|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 294 | |||
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 99.12 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 99.02 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 98.96 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 98.96 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 98.91 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 98.88 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 98.87 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 98.81 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 98.8 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 98.8 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 98.8 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 98.79 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 98.78 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 98.77 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 98.77 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 98.76 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 98.75 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 98.75 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 98.75 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 98.74 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 98.74 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 98.74 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 98.73 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 98.73 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 98.72 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 98.71 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 98.71 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 98.71 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 98.71 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 98.7 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 98.69 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 98.69 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 98.68 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 98.68 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 98.67 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 98.66 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 98.66 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 98.66 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 98.64 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 98.63 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 98.63 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 98.62 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 98.62 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 98.62 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 98.61 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 98.6 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 98.6 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 98.59 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 98.59 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 98.58 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 98.56 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 98.56 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 98.55 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 98.54 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 98.54 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 98.54 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 98.53 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 98.53 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 98.52 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 98.52 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 98.51 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 98.51 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 98.48 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 98.47 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 98.47 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 98.47 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 98.46 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 98.44 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 98.44 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 98.44 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 98.43 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 98.43 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 98.43 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 98.42 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 98.42 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 98.42 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 98.41 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 98.41 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 98.41 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 98.4 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 98.4 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 98.4 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 98.39 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 98.39 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 98.39 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 98.38 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 98.38 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 98.38 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 98.35 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 98.34 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 98.32 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 98.32 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 98.31 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 98.31 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 98.31 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 98.31 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 98.28 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 98.28 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 98.26 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 98.26 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 98.26 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 98.25 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 98.25 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 98.24 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 98.23 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 98.23 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 98.22 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 98.22 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 98.21 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 98.19 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 98.16 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 98.14 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 98.12 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 98.12 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 98.08 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 98.03 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 98.01 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 98.01 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 98.0 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 97.99 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 97.99 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 97.96 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 97.94 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.88 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 97.87 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 97.7 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 97.66 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 97.48 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 97.46 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 97.43 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 97.38 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 97.28 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 97.27 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 97.25 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 97.0 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 96.98 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 96.95 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 96.87 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 96.85 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 96.84 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 96.84 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 96.77 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 96.76 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 96.74 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 96.7 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 96.69 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 96.66 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 96.57 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 96.55 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 96.53 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 96.47 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 96.47 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 96.44 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 96.3 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 96.29 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 96.27 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 96.25 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 96.21 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 96.2 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 96.02 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 95.96 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 95.94 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 95.88 | |
| 2gop_A | 347 | Trilobed protease; beta propeller, open velcro, hy | 95.87 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 95.86 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 95.77 | |
| 1xip_A | 388 | Nucleoporin NUP159; beta-propeller, transport prot | 95.68 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 95.67 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 95.64 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 95.55 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 95.46 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 95.37 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 95.26 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 95.06 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 95.02 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 94.86 | |
| 2gop_A | 347 | Trilobed protease; beta propeller, open velcro, hy | 94.81 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 94.65 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 94.5 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 94.36 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 94.24 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 94.17 | |
| 3fvz_A | 329 | Peptidyl-glycine alpha-amidating monooxygenase; be | 94.0 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 93.97 | |
| 2dg1_A | 333 | DRP35, lactonase; beta propeller, hydrolase; 1.72A | 93.75 | |
| 1q7f_A | 286 | NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL | 93.6 | |
| 1xip_A | 388 | Nucleoporin NUP159; beta-propeller, transport prot | 93.46 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 92.87 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 92.84 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 92.23 | |
| 3c5m_A | 396 | Oligogalacturonate lyase; blade-shaped beta-propel | 92.17 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 91.98 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 91.68 | |
| 1pjx_A | 314 | Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries | 90.01 | |
| 2ghs_A | 326 | AGR_C_1268P; regucalcin, structural genomics, join | 89.87 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 88.43 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 88.35 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 88.26 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 87.68 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 87.03 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 86.99 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 86.64 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 86.62 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 86.07 | |
| 2z2n_A | 299 | Virginiamycin B lyase; seven-bladed beta-propeller | 85.63 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 84.56 | |
| 1mda_H | 368 | Methylamine dehydrogenase (heavy subunit); electro | 83.88 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 82.69 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 82.47 | |
| 3g4e_A | 297 | Regucalcin; six bladed beta-propeller, gluconolcat | 82.32 | |
| 1yiq_A | 689 | Quinohemoprotein alcohol dehydrogenase; electron t | 81.97 | |
| 2qe8_A | 343 | Uncharacterized protein; structural genomics, join | 81.55 | |
| 3no2_A | 276 | Uncharacterized protein; six-bladed beta-propeller | 81.35 | |
| 2qc5_A | 300 | Streptogramin B lactonase; beta propeller, lyase; | 81.18 | |
| 3dr2_A | 305 | Exported gluconolactonase; gluconolactonase SMP-30 | 80.95 | |
| 3sjl_D | 386 | Methylamine dehydrogenase heavy chain; MAUG, C-hem | 80.33 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 80.13 |
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
Probab=99.12 E-value=1.3e-10 Score=104.37 Aligned_cols=56 Identities=20% Similarity=0.296 Sum_probs=52.5
Q ss_pred CCCEEEEEeccCCCCEEEEecCCCcEEEEeCCCcceEEE-eccCCCcEEEEEECCCCC
Q psy12461 237 VPGILAMDIQVEDTSKILTGGNDCQATVFNKDTEQVVAI-LKGHRKKVTRVVYHPSEL 293 (294)
Q Consensus 237 ~pGIlSLdfSpsDgnlLATGG~DGTVkVWDleTgKvV~T-LkGHTkkVtSVaFhPd~~ 293 (294)
...|++|+|+| ++++||+|+.|++|+|||+++++++.+ +++|+.+|++|+|+||++
T Consensus 269 ~~~V~~~~~Sp-dg~~lasgs~D~~V~iwd~~~~~~~~~~~~gH~~~V~~v~fSpdg~ 325 (365)
T 4h5i_A 269 FKGITSMDVDM-KGELAVLASNDNSIALVKLKDLSMSKIFKQAHSFAITEVTISPDST 325 (365)
T ss_dssp CSCEEEEEECT-TSCEEEEEETTSCEEEEETTTTEEEEEETTSSSSCEEEEEECTTSC
T ss_pred CCCeEeEEECC-CCCceEEEcCCCEEEEEECCCCcEEEEecCcccCCEEEEEECCCCC
Confidence 46799999999 799999999999999999999999988 589999999999999986
|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A | Back alignment and structure |
|---|
| >1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 | Back alignment and structure |
|---|
| >1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... | Back alignment and structure |
|---|
| >2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B | Back alignment and structure |
|---|
| >1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} | Back alignment and structure |
|---|
| >2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} | Back alignment and structure |
|---|
| >3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 294 | ||||
| d1p22a2 | 293 | b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be | 2e-05 | |
| d1tbga_ | 340 | b.69.4.1 (A:) beta1-subunit of the signal-transduc | 2e-04 | |
| d1nexb2 | 355 | b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' | 2e-04 | |
| d1vyhc1 | 317 | b.69.4.1 (C:92-408) Platelet-activating factor ace | 3e-04 | |
| d1k8kc_ | 371 | b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 | 0.001 | |
| d2ovrb2 | 342 | b.69.4.1 (B:2365-2706) F-box/WD repeat-containing | 0.001 | |
| d1erja_ | 388 | b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea | 0.001 |
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: WD40 repeat-like family: WD40-repeat domain: F-box/WD-repeat protein 1 (beta-TRCP1) species: Human (Homo sapiens) [TaxId: 9606]
Score = 43.3 bits (100), Expect = 2e-05
Identities = 15/58 (25%), Positives = 26/58 (44%), Gaps = 3/58 (5%)
Query: 233 HSASVPGILAMDIQVEDTSKILTGGNDCQATVFNKDTEQVVAILKGHRKKVTRVVYHP 290
S + G+ + D KI++G D +++K+T + IL GH V + Y
Sbjct: 11 RSETSKGVYCLQY---DDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDE 65
|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 294 | |||
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 99.22 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 99.21 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 99.08 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 99.05 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 99.01 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 98.98 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 98.97 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 98.96 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 98.95 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.93 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 98.83 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 98.81 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 98.76 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 98.64 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 98.62 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 98.61 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 98.56 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 98.56 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.51 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 98.5 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 98.46 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 98.46 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 98.45 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 98.36 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 98.35 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 98.18 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 98.14 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 98.01 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 97.96 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 97.83 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 97.8 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 97.62 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 97.53 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 97.51 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 97.5 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 97.49 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 97.46 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 97.33 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 97.26 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 97.2 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 97.12 | |
| d2bgra1 | 470 | Dipeptidyl peptidase IV/CD26, N-terminal domain {P | 97.03 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 96.99 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 96.76 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 96.2 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 95.93 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 95.57 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 94.99 | |
| d2bgra1 | 470 | Dipeptidyl peptidase IV/CD26, N-terminal domain {P | 93.05 | |
| d1pjxa_ | 314 | Diisopropylfluorophosphatase (phosphotriesterase, | 91.2 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 90.33 | |
| d2p4oa1 | 302 | Hypothetical protein All0351 homologue {Nostoc pun | 89.43 | |
| d2hqsa1 | 269 | TolB, C-terminal domain {Escherichia coli [TaxId: | 86.04 | |
| d1qnia2 | 441 | Nitrous oxide reductase, N-terminal domain {Pseudo | 82.32 | |
| d2hqsa1 | 269 | TolB, C-terminal domain {Escherichia coli [TaxId: | 82.16 |
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: WD40 repeat-like family: WD40-repeat domain: beta1-subunit of the signal-transducing G protein heterotrimer species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.22 E-value=4.3e-11 Score=96.97 Aligned_cols=56 Identities=20% Similarity=0.259 Sum_probs=53.2
Q ss_pred CCCEEEEEeccCCCCEEEEecCCCcEEEEeCCCcceEEEeccCCCcEEEEEECCCCC
Q psy12461 237 VPGILAMDIQVEDTSKILTGGNDCQATVFNKDTEQVVAILKGHRKKVTRVVYHPSEL 293 (294)
Q Consensus 237 ~pGIlSLdfSpsDgnlLATGG~DGTVkVWDleTgKvV~TLkGHTkkVtSVaFhPd~~ 293 (294)
...|++|+|+| ++++||||+.||+|+|||+.+++.+.++++|..+|++++|+|+++
T Consensus 55 ~~~I~~l~~s~-~~~~l~sgs~Dg~v~iWd~~~~~~~~~~~~~~~~v~~v~~~~~~~ 110 (340)
T d1tbga_ 55 LAKIYAMHWGT-DSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGN 110 (340)
T ss_dssp SSCEEEEEECT-TSSEEEEEETTTEEEEEETTTTEEEEEEECSCSCEEEEEECTTSS
T ss_pred CCCEEEEEECC-CCCEEEEEECCCceeeeecccceeEEEEecccccEEeeEeeccce
Confidence 56799999999 799999999999999999999999999999999999999999875
|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} | Back information, alignment and structure |
|---|
| >d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|