Psyllid ID: psy12524

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-
KPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPTP
cccEEEEccEEEEcccccccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccccccEEEccccccccccHHHHHHHHHHHHHccccccEEEEEEEEEEEEcccccccccccccccccEEEEccccccccccccccccccHHHHHcccc
ccccEEEEEccEEEccEEEcccccHHHHHHHHcHHHHHHHHcccEEEEEEEccccccHHHHHcEccccccccHHHHHHHHHHHHHccccccEEEEEEEEEEEEcHcHHHcccccccccccEEEcccccccccccHHHHEEccHHHcccccc
kppktfafdhcfysldpnlpnfasqEKVFDALGRDILDNAFQGYNACIFaygqtgsgksytmmgsqdnkgiipRLCDSLFDLIAKQESSELTYKVEVSYMEIYNekvhdlldpkankqslkvrehnvlgpyvdglSQLAVTSFqaranptp
kppktfafDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTsfqaranptp
KPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPTP
*****FAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDP******LKVREHNVLGPYVDGLSQLAVT**********
*PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDP********VREHNVLGPYVDGLSQLAVTSFQARANP**
KPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPTP
*PPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQAR*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPTP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query151 2.2.26 [Sep-21-2011]
Q9EQW7 1749 Kinesin-like protein KIF1 no N/A 0.953 0.082 0.696 4e-56
Q9H1H9 1805 Kinesin-like protein KIF1 yes N/A 0.953 0.079 0.689 1e-55
Q9NQT8 1826 Kinesin-like protein KIF1 no N/A 0.940 0.077 0.671 6e-55
O60333 1816 Kinesin-like protein KIF1 no N/A 0.927 0.077 0.583 2e-43
Q60575 1816 Kinesin-like protein KIF1 no N/A 0.927 0.077 0.583 2e-43
O43896 1103 Kinesin-like protein KIF1 no N/A 0.927 0.126 0.562 6e-43
O88658 1816 Kinesin-like protein KIF1 no N/A 0.927 0.077 0.576 6e-43
Q12756 1690 Kinesin-like protein KIF1 no N/A 0.927 0.082 0.576 8e-43
P33173 1695 Kinesin-like protein KIF1 no N/A 0.927 0.082 0.576 8e-43
O35071 1100 Kinesin-like protein KIF1 no N/A 0.927 0.127 0.562 4e-42
>sp|Q9EQW7|KI13A_MOUSE Kinesin-like protein KIF13A OS=Mus musculus GN=Kif13a PE=1 SV=1 Back     alignment and function desciption
 Score =  216 bits (550), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 101/145 (69%), Positives = 118/145 (81%), Gaps = 1/145 (0%)

Query: 1   KPPKTFAFDHCFYSLD-PNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKS 59
           KPPK FAFD+CF+S+D  N   +A QE VF  LG  IL+ AFQGYNACIFAYGQTGSGKS
Sbjct: 50  KPPKVFAFDYCFWSMDESNTTKYAGQEVVFKCLGEGILEKAFQGYNACIFAYGQTGSGKS 109

Query: 60  YTMMGSQDNKGIIPRLCDSLFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQS 119
           ++MMG  +  G+IPRLC +LF  IA +++   T+KVEVSYMEIYNEKV DLLDPK ++QS
Sbjct: 110 FSMMGHAEQLGLIPRLCCALFQRIALEQNESQTFKVEVSYMEIYNEKVRDLLDPKGSRQS 169

Query: 120 LKVREHNVLGPYVDGLSQLAVTSFQ 144
           LKVREH VLGPYVDGLSQLAVTSF+
Sbjct: 170 LKVREHKVLGPYVDGLSQLAVTSFE 194
Plus end-directed microtubule-dependent motor protein involved in intracellular transport and regulating various processes such as mannose-6-phosphate receptor (M6PR) transport to the plasma membrane, endosomal sorting during melanosome biogenesis and cytokinesis. During melanosome maturation, required for delivering melanogenic enzymes from recycling endosomes to nascent melanosomes by creating peripheral recycling endosomal subdomains in melanocytes. Also required for the abcission step in cytokinesis: mediates translocation of ZFYVE26, and possibly TTC19, to the midbody during cytokinesis (By similarity). Mediates the transport of M6PR-containing vesicles from trans-Golgi network to the plasma membrane via direct interaction with the AP-1 complex.
Mus musculus (taxid: 10090)
>sp|Q9H1H9|KI13A_HUMAN Kinesin-like protein KIF13A OS=Homo sapiens GN=KIF13A PE=1 SV=2 Back     alignment and function description
>sp|Q9NQT8|KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens GN=KIF13B PE=1 SV=1 Back     alignment and function description
>sp|O60333|KIF1B_HUMAN Kinesin-like protein KIF1B OS=Homo sapiens GN=KIF1B PE=1 SV=5 Back     alignment and function description
>sp|Q60575|KIF1B_MOUSE Kinesin-like protein KIF1B OS=Mus musculus GN=Kif1b PE=1 SV=2 Back     alignment and function description
>sp|O43896|KIF1C_HUMAN Kinesin-like protein KIF1C OS=Homo sapiens GN=KIF1C PE=1 SV=3 Back     alignment and function description
>sp|O88658|KIF1B_RAT Kinesin-like protein KIF1B OS=Rattus norvegicus GN=Kif1b PE=1 SV=2 Back     alignment and function description
>sp|Q12756|KIF1A_HUMAN Kinesin-like protein KIF1A OS=Homo sapiens GN=KIF1A PE=1 SV=2 Back     alignment and function description
>sp|P33173|KIF1A_MOUSE Kinesin-like protein KIF1A OS=Mus musculus GN=Kif1a PE=1 SV=2 Back     alignment and function description
>sp|O35071|KIF1C_MOUSE Kinesin-like protein KIF1C OS=Mus musculus GN=Kif1c PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
383858251 2117 PREDICTED: kinesin-like protein KIF13B-l 0.940 0.067 0.929 1e-74
332019903 1860 Kinesin-like protein KIF13A [Acromyrmex 0.940 0.076 0.929 2e-74
380022445 1876 PREDICTED: kinesin-like protein KIF13B, 0.940 0.075 0.922 4e-74
340719864 1905 PREDICTED: kinesin-like protein KIF13B-l 0.940 0.074 0.915 7e-74
350416890 1909 PREDICTED: kinesin-like protein KIF13B-l 0.940 0.074 0.915 8e-74
328780639 1929 PREDICTED: kinesin 3A [Apis mellifera] 0.940 0.073 0.915 2e-73
189233780 1837 PREDICTED: similar to Kinesin-73 CG8183- 0.953 0.078 0.895 3e-73
270015064 1824 hypothetical protein TcasGA2_TC014226 [T 0.953 0.078 0.895 3e-73
242020853 1814 conserved hypothetical protein [Pediculu 0.953 0.079 0.875 6e-70
198459379 1918 GA20876 [Drosophila pseudoobscura pseudo 0.953 0.075 0.847 6e-69
>gi|383858251|ref|XP_003704615.1| PREDICTED: kinesin-like protein KIF13B-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 132/142 (92%), Positives = 138/142 (97%)

Query: 3   PKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTM 62
           PKTFAFDHCF+SLDP+L NFASQE VFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTM
Sbjct: 238 PKTFAFDHCFHSLDPSLENFASQEVVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTM 297

Query: 63  MGSQDNKGIIPRLCDSLFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKV 122
           MGS +NKGIIPRLCD+LFD+IAKQ+SSELTYKVEVSYMEIYNEKVHDLLDPK NKQSLKV
Sbjct: 298 MGSGENKGIIPRLCDNLFDMIAKQQSSELTYKVEVSYMEIYNEKVHDLLDPKPNKQSLKV 357

Query: 123 REHNVLGPYVDGLSQLAVTSFQ 144
           REHNVLGPYVDGLSQLAVTSFQ
Sbjct: 358 REHNVLGPYVDGLSQLAVTSFQ 379

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332019903|gb|EGI60364.1| Kinesin-like protein KIF13A [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|380022445|ref|XP_003695056.1| PREDICTED: kinesin-like protein KIF13B, partial [Apis florea] Back     alignment and taxonomy information
>gi|340719864|ref|XP_003398365.1| PREDICTED: kinesin-like protein KIF13B-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350416890|ref|XP_003491154.1| PREDICTED: kinesin-like protein KIF13B-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328780639|ref|XP_003249835.1| PREDICTED: kinesin 3A [Apis mellifera] Back     alignment and taxonomy information
>gi|189233780|ref|XP_001814557.1| PREDICTED: similar to Kinesin-73 CG8183-PB [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270015064|gb|EFA11512.1| hypothetical protein TcasGA2_TC014226 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242020853|ref|XP_002430865.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212516076|gb|EEB18127.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|198459379|ref|XP_001361354.2| GA20876 [Drosophila pseudoobscura pseudoobscura] gi|198136674|gb|EAL25932.2| GA20876 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query151
FB|FBgn0019968 1921 Khc-73 "Kinesin-73" [Drosophil 0.953 0.074 0.833 4.5e-61
UNIPROTKB|E7ERX9 743 KIF13B "Kinesin-like protein K 0.940 0.191 0.678 1.1e-50
UNIPROTKB|F1PBU4 1754 KIF13A "Uncharacterized protei 0.953 0.082 0.703 2.2e-50
UNIPROTKB|F1RJP9 1851 KIF13B "Uncharacterized protei 0.940 0.076 0.692 2.4e-50
UNIPROTKB|F1PIS5 1984 KIF13B "Uncharacterized protei 0.940 0.071 0.685 7.2e-50
MGI|MGI:1098264 1749 Kif13a "kinesin family member 0.953 0.082 0.696 9.6e-50
UNIPROTKB|F1LRB4 1753 Kif13b "Protein Kif13b" [Rattu 0.940 0.081 0.678 2.6e-49
RGD|1303307 1767 Kif13b "kinesin family member 0.940 0.080 0.678 2.6e-49
UNIPROTKB|Q9H1H9 1805 KIF13A "Kinesin-like protein K 0.953 0.079 0.689 2.7e-49
UNIPROTKB|D4A996 1827 Kif13b "Protein Kif13b" [Rattu 0.940 0.077 0.678 2.8e-49
FB|FBgn0019968 Khc-73 "Kinesin-73" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 639 (230.0 bits), Expect = 4.5e-61, P = 4.5e-61
 Identities = 120/144 (83%), Positives = 129/144 (89%)

Query:     1 KPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSY 60
             K PKTFAFDHCFYSL+P   NFASQE VFD +GR ILDNAFQGYNACIFAYGQTGSGKSY
Sbjct:    49 KQPKTFAFDHCFYSLNPEDENFASQETVFDCVGRGILDNAFQGYNACIFAYGQTGSGKSY 108

Query:    61 TMMGSQDNKGIIPRLCDSLFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSL 120
             TMMG+Q++KGIIPRLCD LF  IA + + EL YKVEVSYMEIYNEKVHDLLDPK NKQSL
Sbjct:   109 TMMGTQESKGIIPRLCDQLFSAIANKSTPELMYKVEVSYMEIYNEKVHDLLDPKPNKQSL 168

Query:   121 KVREHNVLGPYVDGLSQLAVTSFQ 144
             KVREHNV+GPYVDGLSQLAVTS+Q
Sbjct:   169 KVREHNVMGPYVDGLSQLAVTSYQ 192
GO:0003777 "microtubule motor activity" evidence=ISS;IDA
GO:0008017 "microtubule binding" evidence=ISS
GO:0005871 "kinesin complex" evidence=ISS
GO:0007018 "microtubule-based movement" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0000235 "astral microtubule" evidence=IDA
GO:0051294 "establishment of spindle orientation" evidence=IMP
GO:0050803 "regulation of synapse structure and activity" evidence=IMP
GO:0035371 "microtubule plus end" evidence=IDA
GO:0042803 "protein homodimerization activity" evidence=IDA
GO:0005769 "early endosome" evidence=IDA
UNIPROTKB|E7ERX9 KIF13B "Kinesin-like protein KIF13B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PBU4 KIF13A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RJP9 KIF13B "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PIS5 KIF13B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1098264 Kif13a "kinesin family member 13A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1LRB4 Kif13b "Protein Kif13b" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1303307 Kif13b "kinesin family member 13B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H1H9 KIF13A "Kinesin-like protein KIF13A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D4A996 Kif13b "Protein Kif13b" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9NGQ2KIF1_DICDINo assigned EC number0.55550.92710.0634yesN/A
Q9H1H9KI13A_HUMANNo assigned EC number0.68960.95360.0797yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
cd01365 356 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K 1e-87
pfam00225 326 pfam00225, Kinesin, Kinesin motor domain 6e-64
cd00106 328 cd00106, KISc, Kinesin motor domain 2e-61
smart00129 335 smart00129, KISc, Kinesin motor, catalytic domain 1e-60
cd01369 325 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine 9e-50
cd01374 321 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E 3e-44
cd01371 333 cd01371, KISc_KIF3, Kinesin motor domain, kinesins 3e-43
cd01373 337 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP 1e-39
cd01366 329 cd01366, KISc_C_terminal, Kinesin motor domain, KI 3e-39
cd01372 341 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik 5e-38
COG5059 568 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] 6e-37
cd01370 338 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP 4e-36
cd01375 334 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF 2e-32
cd01364 352 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC 5e-31
cd01368 345 cd01368, KISc_KIF23_like, Kinesin motor domain, KI 7e-30
cd01367 322 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF 2e-29
cd01376 319 cd01376, KISc_KID_like, Kinesin motor domain, KIF2 2e-28
PLN03188 1320 PLN03188, PLN03188, kinesin-12 family protein; Pro 7e-26
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 6e-19
>gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins Back     alignment and domain information 
 Score =  259 bits (664), Expect = 1e-87
 Identities = 94/145 (64%), Positives = 120/145 (82%), Gaps = 1/145 (0%)

Query: 1   KPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSY 60
           K PK+F+FDH ++S D   P++ASQE VF+ LGR++LD+AF+GYN C+FAYGQTGSGKSY
Sbjct: 45  KKPKSFSFDHSYWSHDSEDPHYASQEDVFEDLGRELLDHAFEGYNVCLFAYGQTGSGKSY 104

Query: 61  TMMGSQDNKGIIPRLCDSLFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPK-ANKQS 119
           TMMG ++ KGIIPRLC+ LF  I  ++   L+Y+VEVSYMEIYNEKV DLL+PK  NK +
Sbjct: 105 TMMGYKEEKGIIPRLCEELFQRIESKKEQNLSYEVEVSYMEIYNEKVRDLLNPKKKNKGN 164

Query: 120 LKVREHNVLGPYVDGLSQLAVTSFQ 144
           LKVREH VLGPYV+ LS++AVTS++
Sbjct: 165 LKVREHPVLGPYVEDLSKVAVTSYE 189

KIF1A (Unc104) transports synaptic vesicles to the nerve terminal, KIF1B has been implicated in transport of mitochondria. Both proteins are expressed in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. In contrast to the majority of dimeric kinesins, most KIF1A/Unc104 kinesins are monomeric motors. A lysine-rich loop in KIF1A binds to the negatively charged C-terminus of tubulin and compensates for the lack of a second motor domain, allowing KIF1A to move processively. Length = 356
>gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238054 cd00106, KISc, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain Back     alignment and domain information
>gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group Back     alignment and domain information
>gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 151
KOG4280|consensus 574 100.0
cd01370 338 KISc_KIP3_like Kinesin motor domain, KIP3-like sub 100.0
cd01365 356 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p 100.0
KOG0245|consensus 1221 100.0
KOG0242|consensus 675 100.0
cd01368 345 KISc_KIF23_like Kinesin motor domain, KIF23-like s 100.0
cd01373 337 KISc_KLP2_like Kinesin motor domain, KLP2-like sub 100.0
cd01367 322 KISc_KIF2_like Kinesin motor domain, KIF2-like gro 100.0
cd01376 319 KISc_KID_like Kinesin motor domain, KIF22/Kid-like 100.0
cd01374 321 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like 100.0
cd01371 333 KISc_KIF3 Kinesin motor domain, kinesins II or KIF 100.0
KOG0243|consensus 1041 100.0
KOG0241|consensus 1714 100.0
cd01375 334 KISc_KIF9_like Kinesin motor domain, KIF9-like sub 100.0
PF00225 335 Kinesin: Kinesin motor domain; InterPro: IPR001752 100.0
cd01369 325 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy 100.0
PLN03188 1320 kinesin-12 family protein; Provisional 100.0
cd01366 329 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ 100.0
cd01372 341 KISc_KIF4 Kinesin motor domain, KIF4-like subfamil 100.0
cd01364 352 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind 100.0
cd00106 328 KISc Kinesin motor domain. This catalytic (head) d 100.0
smart00129 335 KISc Kinesin motor, catalytic domain. ATPase. Micr 100.0
KOG0240|consensus 607 100.0
KOG0239|consensus 670 100.0
KOG0246|consensus 676 99.97
COG5059 568 KIP1 Kinesin-like protein [Cytoskeleton] 99.97
KOG0247|consensus 809 99.97
KOG0244|consensus 913 99.93
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 99.58
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.07
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 95.6
PRK06620214 hypothetical protein; Validated 94.92
PRK06893229 DNA replication initiation factor; Validated 94.62
PRK09087226 hypothetical protein; Validated 94.31
PRK14086 617 dnaA chromosomal replication initiation protein; P 93.49
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 93.48
COG2805 353 PilT Tfp pilus assembly protein, pilus retraction 93.14
PRK08084235 DNA replication initiation factor; Provisional 93.06
PRK12377248 putative replication protein; Provisional 92.87
PRK08181269 transposase; Validated 92.7
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 92.69
PRK00411 394 cdc6 cell division control protein 6; Reviewed 92.68
PRK06526254 transposase; Provisional 92.67
PRK05642234 DNA replication initiation factor; Validated 92.42
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 92.41
PRK08116268 hypothetical protein; Validated 92.33
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 92.33
COG0593 408 DnaA ATPase involved in DNA replication initiation 92.12
PRK00149 450 dnaA chromosomal replication initiation protein; R 92.07
PRK14088 440 dnaA chromosomal replication initiation protein; P 91.59
PRK07952244 DNA replication protein DnaC; Validated 91.34
PF1324576 AAA_19: Part of AAA domain 91.16
PRK06835329 DNA replication protein DnaC; Validated 90.86
PRK08903227 DnaA regulatory inactivator Hda; Validated 90.22
COG2804 500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 90.12
PF04851184 ResIII: Type III restriction enzyme, res subunit; 90.02
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 89.9
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 89.35
KOG0989|consensus 346 89.33
PRK06921266 hypothetical protein; Provisional 89.3
PRK14087 450 dnaA chromosomal replication initiation protein; P 89.19
PRK12422 445 chromosomal replication initiation protein; Provis 89.1
COG1484254 DnaC DNA replication protein [DNA replication, rec 89.08
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 88.99
PRK08939306 primosomal protein DnaI; Reviewed 88.79
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 88.62
PRK08727233 hypothetical protein; Validated 88.12
PF01637 234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 87.52
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 87.41
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 87.13
smart00382148 AAA ATPases associated with a variety of cellular 86.63
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 86.3
PF00004132 AAA: ATPase family associated with various cellula 86.18
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 85.95
PRK10436 462 hypothetical protein; Provisional 85.8
TIGR01420 343 pilT_fam pilus retraction protein PilT. This model 85.7
TIGR02533 486 type_II_gspE general secretory pathway protein E. 85.7
PHA00729 226 NTP-binding motif containing protein 85.69
PRK12402 337 replication factor C small subunit 2; Reviewed 85.67
PRK09183259 transposase/IS protein; Provisional 85.65
TIGR02538 564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 85.61
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 85.45
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 85.44
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 85.24
PF07693 325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 84.86
PF01935229 DUF87: Domain of unknown function DUF87; InterPro: 84.78
KOG1514|consensus 767 84.24
TIGR02524 358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 83.94
COG5008 375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 83.91
PF12846 304 AAA_10: AAA-like domain 83.82
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 83.72
TIGR02525 372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 83.68
PF13479 213 AAA_24: AAA domain 83.21
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 82.78
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 82.65
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 82.43
PF00580 315 UvrD-helicase: UvrD/REP helicase N-terminal domain 81.69
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 81.48
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 81.44
PF00063 689 Myosin_head: Myosin head (motor domain); InterPro: 81.39
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 80.97
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 80.79
PLN03025 319 replication factor C subunit; Provisional 80.65
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 80.51
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 80.41
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 80.34
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 80.2
COG4096 875 HsdR Type I site-specific restriction-modification 80.01
>KOG4280|consensus Back     alignment and domain information 
Probab=100.00  E-value=6.2e-42  Score=285.56  Aligned_cols=141  Identities=39%  Similarity=0.725  Sum_probs=131.5

Q ss_pred             CCCeEEEeceEeccCCCCCCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccC-CCCCCcHHHHHHHH
Q psy12524          1 KPPKTFAFDHCFYSLDPNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGS-QDNKGIIPRLCDSL   79 (151)
Q Consensus         1 ~~~k~f~fD~vf~~~d~~~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~-~~~~Gli~~~~~~l   79 (151)
                      +++|+|+||.||       +++++|++||+.++.|+|+++++|||+||||||+|||||||||+|. +...|||||++++|
T Consensus        49 ~~~~~ftfD~vf-------~~~stQ~dvy~~~~~~lV~svl~GyNgtvFaYGQTGsGKTyTM~G~~~~~~GiiPraf~~L  121 (574)
T KOG4280|consen   49 GKPKSFTFDAVF-------DSDSTQDDVYQETVAPLVESVLEGYNGTVFAYGQTGSGKTYTMIGPDPELRGLIPRAFEHL  121 (574)
T ss_pred             CCCCCceeeeee-------cCCCCHHHHHHHHhHHHHHHHhcccCceEEEeccCCCCCceEeeCCChhhCCchhHHHHHH
Confidence            468899999999       8899999999999999999999999999999999999999999998 56799999999999


Q ss_pred             HHHHHhhcCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         80 FDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        80 f~~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      |+.++..+... +|+|++||+|||||+|+|||++.+. +.|.++|+++.|+||+||+++.|.+++++..+|
T Consensus       122 F~~I~~~~~~~-~f~vrvS~lEiYnE~i~DLL~~~~~-~~l~lre~p~~Gv~V~nlse~~v~s~~d~~~~l  190 (574)
T KOG4280|consen  122 FRHIDERKEKT-RFLVRVSYLEIYNESIRDLLSPVNP-KGLELREDPKCGVYVENLSEMDVESAEDAQQLL  190 (574)
T ss_pred             HHHHHhccccc-eEEEEeehHHHHhHHHHHHhCccCc-CCceeeEcCCCceEecCcceeecCCHHHHHHHH
Confidence            99999776444 8999999999999999999998753 589999999999999999999999999998775

>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>KOG0245|consensus Back     alignment and domain information
>KOG0242|consensus Back     alignment and domain information
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group Back     alignment and domain information
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>cd00106 KISc Kinesin motor domain Back     alignment and domain information
>smart00129 KISc Kinesin motor, catalytic domain Back     alignment and domain information
>KOG0240|consensus Back     alignment and domain information
>KOG0239|consensus Back     alignment and domain information
>KOG0246|consensus Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG0247|consensus Back     alignment and domain information
>KOG0244|consensus Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>KOG1514|consensus Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
3gbj_A 354 Crystal Structure Of The Motor Domain Of Kinesin Ki 8e-57
1i5s_A 367 Crystal Structure Of The Kif1a Motor Domain Complex 3e-44
1ia0_K 394 Kif1a Head-Microtubule Complex Structure In Atp-For 4e-44
1i6i_A 366 Crystal Structure Of The Kif1a Motor Domain Complex 4e-44
1vfv_A 366 Crystal Structure Of The Kif1a Motor Domain Complex 4e-44
2owm_A 443 Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 1e-36
1goj_A 355 Structure Of A Fast Kinesin: Implications For Atpas 2e-23
1t5c_A 349 Crystal Structure Of The Motor Domain Of Human Kine 1e-22
2y5w_A 365 Crystal Structure Of Drosophila Melanogaster Kinesi 1e-21
2kin_A238 Kinesin (Monomeric) From Rattus Norvegicus Length = 2e-21
1cz7_A 406 The Crystal Structure Of A Minus-End Directed Micro 3e-21
1n6m_A 409 Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY 3e-21
2ncd_A 420 Ncd (Non-Claret Disjunctional) Dimer From D. Melano 3e-21
3u06_A 412 Crystal Structure Of The Kinesin-14 Ncdg347d Length 3e-21
2vvg_A 350 Crystal Structure Of The G.Intestinalis Kinesin 2 G 6e-21
3b6u_A 372 Crystal Structure Of The Motor Domain Of Human Kine 8e-21
3l1c_A 383 Kinesin-14 Protein Ncd, T436s Mutant Length = 383 8e-21
1mkj_A 349 Human Kinesin Motor Domain With Docked Neck Linker 4e-20
1bg2_A 325 Human Ubiquitous Kinesin Motor Domain Length = 325 4e-20
4atx_C 340 Rigor Kinesin Motor Domain With An Ordered Neck-Lin 5e-20
3b6v_A 395 Crystal Structure Of The Motor Domain Of Human Kine 9e-20
3nwn_A 359 Crystal Structure Of The Human Kif9 Motor Domain In 3e-19
3t0q_A 349 Motor Domain Structure Of The Kar3-Like Kinesin Fro 3e-18
3bfn_A 388 Crystal Structure Of The Motor Domain Of Human Kine 5e-18
1f9t_A 358 Crystal Structures Of Kinesin Mutants Reveal A Sign 1e-17
1f9w_A 347 Crystal Structures Of Mutants Reveal A Signalling P 1e-17
1f9u_A 347 Crystal Structures Of Mutants Reveal A Signalling P 1e-17
3kar_A 346 The Motor Domain Of Kinesin-Like Protein Kar3, A Sa 2e-17
1f9v_A 347 Crystal Structures Of Mutants Reveal A Signalling P 2e-17
2rep_A 376 Crystal Structure Of The Motor Domain Of Human Kine 2e-17
4gkr_A 371 Structure Of The C-Terminal Motor Domain Of Kar3 Fr 3e-17
2h58_A 330 Crystal Structure Of The Kifc3 Motor Domain In Comp 4e-17
4a14_A 344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 6e-17
2xt3_A 344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 6e-17
4etp_A 403 C-Terminal Motor And Motor Homology Domain Of Kar3v 7e-17
3h4s_A 386 Structure Of The Complex Of A Mitotic Kinesin With 2e-16
4aqv_C 373 Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma 4e-16
1sdm_A 369 Crystal Structure Of Kinesin-Like Calmodulin Bindin 2e-15
3hqd_A 369 Human Kinesin Eg5 Motor Domain In Complex With Ampp 4e-15
1ii6_A 368 Crystal Structure Of The Mitotic Kinesin Eg5 In Com 4e-15
4a28_A 368 Eg5-2 Length = 368 4e-15
1q0b_A 367 Crystal Structure Of The Motor Protein Ksp In Compl 4e-15
4a1z_A 368 Eg5-1 Length = 368 4e-15
3zcw_A 348 Eg5 - New Allosteric Binding Site Length = 348 4e-15
4ap0_A 370 The Mitotic Kinesin Eg5 In Complex With Mg-Adp And 4e-15
1x88_A 359 Human Eg5 Motor Domain Bound To Mg-Adp And Monastro 5e-15
3lre_A 355 Crystal Structure Analysis Of Human Kinesin-8 Motor 1e-14
2wbe_C 373 Kinesin-5-Tubulin Complex With Amppnp Length = 373 2e-14
3dc4_A 344 Crystal Structure Of The Drosophila Kinesin Family 4e-14
3pxn_A 344 Crystal Structure Of The Drosophila Kinesin Family 4e-14
4h1g_A 715 Structure Of Candida Albicans Kar3 Motor Domain Fus 1e-13
1v8j_A 410 The Crystal Structure Of The Minimal Functional Dom 7e-13
3edl_D 331 Kinesin13-Microtubule Ring Complex Length = 331 9e-13
2gry_A 420 Crystal Structure Of The Human Kif2 Motor Domain In 1e-12
2heh_A 387 Crystal Structure Of The Kif2c Motor Domain (Casp T 2e-11
1ry6_A 360 Crystal Structure Of Internal Kinesin Motor Domain 4e-08
>pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 Back     alignment and structure 
Iteration: 1

 Score =  215 bits (548), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 97/143 (67%), Positives = 119/143 (83%), Gaps = 1/143 (0%)
Query: 3   PKTFAFDHCFYSLDPNLP-NFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYT 61
           PK FA+DHCF+S+D ++   +A Q+ VF  LG +IL NAF GYNACIFAYGQTGSGKSYT
Sbjct: 50  PKVFAYDHCFWSMDESVKEKYAGQDIVFKCLGENILQNAFDGYNACIFAYGQTGSGKSYT 109
Query: 62  MMGSQDNKGIIPRLCDSLFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLK 121
           MMG+ D  G+IPRLC  LF+   K+E+ E ++KVEVSYMEIYNEKV DLLDPK ++Q+LK
Sbjct: 110 MMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNEKVRDLLDPKGSRQTLK 169
Query: 122 VREHNVLGPYVDGLSQLAVTSFQ 144
           VREH+VLGPYVDGLS+LAVTS++
Sbjct: 170 VREHSVLGPYVDGLSKLAVTSYK 192
>pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 Back     alignment and structure
>pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 Back     alignment and structure
>pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 Back     alignment and structure
>pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 Back     alignment and structure
>pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 Back     alignment and structure
>pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 Back     alignment and structure
>pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 Back     alignment and structure
>pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 Back     alignment and structure
>pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 Back     alignment and structure
>pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 Back     alignment and structure
>pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 Back     alignment and structure
>pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 Back     alignment and structure
>pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 Back     alignment and structure
>pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 Back     alignment and structure
>pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 Back     alignment and structure
>pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 Back     alignment and structure
>pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 Back     alignment and structure
>pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 Back     alignment and structure
>pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 Back     alignment and structure
>pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 Back     alignment and structure
>pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 Back     alignment and structure
>pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 Back     alignment and structure
>pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 Back     alignment and structure
>pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 Back     alignment and structure
>pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 Back     alignment and structure
>pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 Back     alignment and structure
>pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 Back     alignment and structure
>pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 Back     alignment and structure
>pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 Back     alignment and structure
>pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 Back     alignment and structure
>pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 Back     alignment and structure
>pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 Back     alignment and structure
>pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 Back     alignment and structure
>pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 Back     alignment and structure
>pdb|4A28|A Chain A, Eg5-2 Length = 368 Back     alignment and structure
>pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 Back     alignment and structure
>pdb|4A1Z|A Chain A, Eg5-1 Length = 368 Back     alignment and structure
>pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 Back     alignment and structure
>pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 Back     alignment and structure
>pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 Back     alignment and structure
>pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 Back     alignment and structure
>pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 Back     alignment and structure
>pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 Back     alignment and structure
>pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 Back     alignment and structure
>pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 Back     alignment and structure
>pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 Back     alignment and structure
>pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 Back     alignment and structure
>pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 Back     alignment and structure
>pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 Back     alignment and structure
>pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query151
3gbj_A 354 KIF13B protein; kinesin, motor domain, ADP, struct 1e-90
2zfi_A 366 Kinesin-like protein KIF1A, kinesin heavy chain is 3e-85
2owm_A 443 Nckin3-434, related to kinesin-like protein KIF1C; 6e-85
1t5c_A 349 CENP-E protein, centromeric protein E; kinesin mot 2e-76
2vvg_A 350 Kinesin-2; motor protein, nucleotide-binding, micr 1e-74
3b6u_A 372 Kinesin-like protein KIF3B; structural genomics co 1e-73
3lre_A 355 Kinesin-like protein KIF18A; motor protein, nucleo 2e-73
1goj_A 355 Kinesin, kinesin heavy chain; motor protein, ATPas 9e-72
3bfn_A 388 Kinesin-like protein KIF22; limited proteolysis, s 6e-70
4a14_A 344 Kinesin, kinesin-like protein KIF7; motor protein, 6e-70
1bg2_A 325 Kinesin; motor protein, ATPase, microtubule associ 3e-68
2y65_A 365 Kinesin, kinesin heavy chain; motor protein; HET: 1e-67
2nr8_A 358 Kinesin-like protein KIF9; motor domain, ADP, stru 8e-67
3dc4_A 344 Kinesin-like protein NOD; catalytic domain, ATPase 2e-66
1x88_A 359 Kinesin-like protein KIF11; switch II, motor domai 3e-65
1v8k_A 410 Kinesin-like protein KIF2C; microtubule destabiliz 8e-65
2heh_A 387 KIF2C protein; kinesin, motor domain, ADP, structu 1e-64
2wbe_C 373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 2e-62
3t0q_A 349 AGR253WP; kinesin, alpha and beta proteins, P-loop 2e-61
3cob_A 369 Kinesin heavy chain-like protein; motor, switch II 3e-61
2rep_A 376 Kinesin-like protein KIFC1; structural genomics co 9e-59
2h58_A 330 Kinesin-like protein KIFC3 variant; motor domain, 1e-58
1f9v_A 347 Kinesin-like protein KAR3; kinesin-related protein 1e-58
3u06_A 412 Protein claret segregational; motor domain, stalk 2e-58
1ry6_A 360 Internal kinesin; kinesin motor domain, nucleotide 3e-57
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 2e-55
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 Back     alignment and structure
 Score =  265 bits (681), Expect = 1e-90
 Identities = 97/145 (66%), Positives = 119/145 (82%), Gaps = 1/145 (0%)

Query: 1   KPPKTFAFDHCFYSLDPNL-PNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKS 59
             PK FA+DHCF+S+D ++   +A Q+ VF  LG +IL NAF GYNACIFAYGQTGSGKS
Sbjct: 48  GQPKVFAYDHCFWSMDESVKEKYAGQDIVFKCLGENILQNAFDGYNACIFAYGQTGSGKS 107

Query: 60  YTMMGSQDNKGIIPRLCDSLFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQS 119
           YTMMG+ D  G+IPRLC  LF+   K+E+ E ++KVEVSYMEIYNEKV DLLDPK ++Q+
Sbjct: 108 YTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNEKVRDLLDPKGSRQT 167

Query: 120 LKVREHNVLGPYVDGLSQLAVTSFQ 144
           LKVREH+VLGPYVDGLS+LAVTS++
Sbjct: 168 LKVREHSVLGPYVDGLSKLAVTSYK 192
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
3gbj_A 354 KIF13B protein; kinesin, motor domain, ADP, struct 100.0
2owm_A 443 Nckin3-434, related to kinesin-like protein KIF1C; 100.0
1t5c_A 349 CENP-E protein, centromeric protein E; kinesin mot 100.0
4a14_A 344 Kinesin, kinesin-like protein KIF7; motor protein, 100.0
2vvg_A 350 Kinesin-2; motor protein, nucleotide-binding, micr 100.0
2zfi_A 366 Kinesin-like protein KIF1A, kinesin heavy chain is 100.0
3bfn_A 388 Kinesin-like protein KIF22; limited proteolysis, s 100.0
1bg2_A 325 Kinesin; motor protein, ATPase, microtubule associ 100.0
3b6u_A 372 Kinesin-like protein KIF3B; structural genomics co 100.0
1goj_A 355 Kinesin, kinesin heavy chain; motor protein, ATPas 100.0
3lre_A 355 Kinesin-like protein KIF18A; motor protein, nucleo 100.0
3cob_A 369 Kinesin heavy chain-like protein; motor, switch II 100.0
2y65_A 365 Kinesin, kinesin heavy chain; motor protein; HET: 100.0
2h58_A 330 Kinesin-like protein KIFC3 variant; motor domain, 100.0
3u06_A 412 Protein claret segregational; motor domain, stalk 100.0
2wbe_C 373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 100.0
2heh_A 387 KIF2C protein; kinesin, motor domain, ADP, structu 100.0
1x88_A 359 Kinesin-like protein KIF11; switch II, motor domai 100.0
2rep_A 376 Kinesin-like protein KIFC1; structural genomics co 100.0
1v8k_A 410 Kinesin-like protein KIF2C; microtubule destabiliz 100.0
1f9v_A 347 Kinesin-like protein KAR3; kinesin-related protein 100.0
3t0q_A 349 AGR253WP; kinesin, alpha and beta proteins, P-loop 100.0
2nr8_A 358 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
3nwn_A 359 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 100.0
1ry6_A 360 Internal kinesin; kinesin motor domain, nucleotide 100.0
3dc4_A 344 Kinesin-like protein NOD; catalytic domain, ATPase 100.0
4h1g_A 715 Maltose binding protein-cakar3 motor domain fusio; 100.0
2o0a_A 298 S.cerevisiae chromosome XVI reading frame ORF YPL2 99.92
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 95.7
4etp_B 333 Spindle POLE BODY-associated protein VIK1; kinesin 93.49
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 93.41
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 93.36
2qgz_A308 Helicase loader, putative primosome component; str 93.27
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 92.79
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 92.09
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 90.98
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 90.36
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 90.36
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 90.01
2chg_A226 Replication factor C small subunit; DNA-binding pr 89.53
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 89.27
3bos_A242 Putative DNA replication factor; P-loop containing 89.17
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 88.81
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 88.72
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 88.45
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 87.68
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 87.66
2kjq_A149 DNAA-related protein; solution structure, NESG, st 86.15
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 85.34
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 85.26
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 84.43
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 84.14
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 84.14
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 83.8
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 83.62
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 83.39
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 83.14
1p9r_A 418 General secretion pathway protein E; bacterial typ 83.14
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 82.72
3co5_A143 Putative two-component system transcriptional RES 82.45
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 82.34
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 82.34
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 82.19
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 81.88
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 81.85
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 81.82
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 81.58
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 81.4
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 81.16
3pvs_A 447 Replication-associated recombination protein A; ma 81.0
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 80.82
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 80.75
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 80.58
1tue_A212 Replication protein E1; helicase, replication, E1E 80.34
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 80.25
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 80.1
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 Back     alignment and structure
Probab=100.00  E-value=2.3e-44  Score=288.92  Aligned_cols=149  Identities=65%  Similarity=1.123  Sum_probs=128.7

Q ss_pred             CCeEEEeceEeccCCCC-CCCCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCCCCCcHHHHHHHHH
Q psy12524          2 PPKTFAFDHCFYSLDPN-LPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQDNKGIIPRLCDSLF   80 (151)
Q Consensus         2 ~~k~f~fD~vf~~~d~~-~~~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~~~Gli~~~~~~lf   80 (151)
                      ++|+|+||+|||++|.. .++.++|++||+.++.|+|+.+++|+|+||||||+|||||||||+|+..++||+||++++||
T Consensus        49 ~~k~F~FD~vF~~~d~~~~~~~a~Q~~vy~~~~~~lv~~~l~G~n~tifAYGqTGSGKTyTm~G~~~~~Giipr~~~~lF  128 (354)
T 3gbj_A           49 QPKVFAYDHCFWSMDESVKEKYAGQDIVFKCLGENILQNAFDGYNACIFAYGQTGSGKSYTMMGTADQPGLIPRLCSGLF  128 (354)
T ss_dssp             CCEEEECSEEEECSCTTCTTTBCCHHHHHHHHHHHHHHHHHTTCCEEEEEEECTTSSHHHHHTBCSSSBCHHHHHHHHHH
T ss_pred             CceEEEeeEEeccCccccccccccHHHHHHHhhHHHHHHHhCCceeEEEeeCCCCCCCceEEecCCCCCchhhHHHHHHH
Confidence            47899999999988853 36779999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhcCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         81 DLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        81 ~~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      +.++.....++.|.|.+||+|||||+|+|||++...+..|+++|++.+|++|+||+++.|.|++|+.++|
T Consensus       129 ~~i~~~~~~~~~~~v~vS~~EIYnE~i~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  198 (354)
T 3gbj_A          129 ERTQKEENEEQSFKVEVSYMEIYNEKVRDLLDPKGSRQTLKVREHSVLGPYVDGLSKLAVTSYKDIESLM  198 (354)
T ss_dssp             HHHHHHCBTTEEEEEEEEEEEEETTEEEETTC------CBCBC------CCBTTCCCEEECSHHHHHHHH
T ss_pred             HHHHhhcccccceeeeceeEEEecCeeeEccCCCCCCcceEEEEcCCCCEEEEeeEEEecCCHHHHHHHH
Confidence            9998777778899999999999999999999987667789999999999999999999999999998765
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>4etp_B Spindle POLE BODY-associated protein VIK1; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 151
d2zfia1 349 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), 1e-28
d1x88a1 345 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), 9e-28
d1bg2a_ 323 c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId 4e-27
d1goja_ 354 c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 1e-24
d1ry6a_ 330 c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu 1e-22
d1v8ka_ 362 c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c 3e-22
d2ncda_ 368 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 8e-22
d1sdma_ 364 c.37.1.9 (A:) Kinesin heavy chain-like protein {Po 3e-21
d1f9va_ 342 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 2e-20
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin
species: Mouse (Mus musculus), kif1a [TaxId: 10090]

 Score =  105 bits (263), Expect = 1e-28
 Identities = 82/147 (55%), Positives = 113/147 (76%), Gaps = 4/147 (2%)

Query: 1   KPPKTFAFDHCFYSLD-PNLPNFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKS 59
           + PK+F+FD+ ++S   P   N+ASQ++V+  +G ++L +AF+GYN CIFAYGQTG+GKS
Sbjct: 42  ETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKS 101

Query: 60  YTMMGSQD--NKGIIPRLCDSLFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANK 117
           YTMMG Q+   +GIIP+LC+ LF  I    +  ++Y VEVSYMEIY E+V DLL+PK NK
Sbjct: 102 YTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPK-NK 160

Query: 118 QSLKVREHNVLGPYVDGLSQLAVTSFQ 144
            +L+VREH +LGPYV+ LS+LAVTS+ 
Sbjct: 161 GNLRVREHPLLGPYVEDLSKLAVTSYN 187
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query151
d2zfia1 349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 100.0
d1sdma_ 364 Kinesin heavy chain-like protein {Potato (Solanum 100.0
d1bg2a_ 323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1v8ka_ 362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 100.0
d1goja_ 354 Kinesin {Neurospora crassa [TaxId: 5141]} 100.0
d2ncda_ 368 Kinesin motor Ncd (non-claret disjunctional) {Frui 100.0
d1x88a1 345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 100.0
d1ry6a_ 330 Kinesin {Malaria parasite (Plasmodium falciparum) 100.0
d1f9va_ 342 Kinesin motor Ncd (non-claret disjunctional) {Bake 100.0
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.91
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 93.06
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.84
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 92.47
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 90.49
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 90.35
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 89.18
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 89.11
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 88.95
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 88.25
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 87.61
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 87.58
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 87.25
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 86.76
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 86.64
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 86.53
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 85.65
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 85.41
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 85.25
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 85.22
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 85.19
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 84.94
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 84.24
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 84.09
d1okkd2207 GTPase domain of the signal recognition particle r 83.24
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 82.98
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 82.95
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 81.89
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 81.63
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 81.45
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 81.27
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 80.18
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 80.12
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 80.1
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 80.05
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin
species: Mouse (Mus musculus), kif1a [TaxId: 10090]

Probab=100.00  E-value=1.7e-39  Score=258.52  Aligned_cols=148  Identities=54%  Similarity=0.989  Sum_probs=132.7

Q ss_pred             CCeEEEeceEeccCCCCCC-CCCCHHHHHHHHhHHHHHHhhcCCCeeEEeeccCCCCCceeeccCCC--CCCcHHHHHHH
Q psy12524          2 PPKTFAFDHCFYSLDPNLP-NFASQEKVFDALGRDILDNAFQGYNACIFAYGQTGSGKSYTMMGSQD--NKGIIPRLCDS   78 (151)
Q Consensus         2 ~~k~f~fD~vf~~~d~~~~-~~~~q~~vy~~~~~~lv~~~~~G~~~~v~~yG~~~sGKt~t~~G~~~--~~Gli~~~~~~   78 (151)
                      .+|+|+||+|||+.+..-+ ..++|++||+.++.|+|+.+++|+|+||||||+|||||||||+|+++  ++||+||++++
T Consensus        43 ~~k~f~FD~vf~~~~~~~~~~~~sQ~~vy~~~~~plv~~~l~G~n~ti~aYGqTgSGKT~Tm~G~~~~~~~Glipr~l~~  122 (349)
T d2zfia1          43 TPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCED  122 (349)
T ss_dssp             CCEEEECSEEEECSSCTTSSSCCCHHHHHHHTHHHHHHHHHTTCCEEEEEECSTTSSHHHHHTBCSGGGCBCHHHHHHHH
T ss_pred             CCeeEEeceEeCCCCCccccccccHHHHHHHhhHHHHHHHHhccCceeeeeccCCCCCceeeccCccccccCchHHHHhh
Confidence            3689999999987553222 23799999999999999999999999999999999999999999864  79999999999


Q ss_pred             HHHHHHhhcCCCceEEEEEEEEEEECCeeeecCCCCCCCceeeEEecCCCCeEEcCceEEEcCCHHHHhcCC
Q psy12524         79 LFDLIAKQESSELTYKVEVSYMEIYNEKVHDLLDPKANKQSLKVREHNVLGPYVDGLSQLAVTSFQARANPT  150 (151)
Q Consensus        79 lf~~~~~~~~~~~~~~v~~S~~eiy~e~v~DLL~~~~~~~~l~i~e~~~~g~~v~gl~~~~v~s~~e~~~ll  150 (151)
                      ||+.++.....+..+.|.+||+|||||+++|||++.. +..+.+++++.+|++|.|++++.|.+.+|+.++|
T Consensus       123 lf~~~~~~~~~~~~~~v~~S~~Eiyne~i~DLL~~~~-~~~~~i~~~~~~~~~v~~l~~~~v~s~~e~~~~l  193 (349)
T d2zfia1         123 LFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKN-KGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLM  193 (349)
T ss_dssp             HHHHHHTCCCTTEEEEEEEEEEEEETTEEEETTCTTT-CSCBCEEEETTTEEEETTCCCEECCSHHHHHHHH
T ss_pred             hhhhccccccCCcceEEEEEeeeeeCCEEEecccccc-cCCceEEecCCCCcEEEEeEEEeccCHHHHHHHH
Confidence            9999988777788999999999999999999999753 4578999999999999999999999999998764
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure