Psyllid ID: psy12573


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-----
MIQDESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLAVDKEGRPKLDEIFSTCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGYNILVSTCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGARHGIFCSTPAVALTRKVPLGVVRSMTITGIPISAQDAYNAGLITRVVSSNEELESETKVLTSAILENSRSVLTLGKQFLYQQMSLNIEEAY
ccccccccHHHHHHHHHHHHHccccEEEEcccccccccccEEEEccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEEcccccccccHHHHHHccccccccccHHHHHHHHHHHHHHHccccccEEEEEEEEEcccccccccccccHHHHccccccHHHHHHHHHHHHHHHHHHcccccEEEEEcHHHcHHHHHHHHHHHHHHHcccccccccccccccccccccHHHcccccHHHHHHHHHHcccccHHHHHHccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHc
ccccccccccHHHEEEEEEEEccccEEEEEcccccccHHHHHHHHcccHHHHHccccccccccHHHHHHHHHcccccccccEEEEEEccccccEEEEEcccEEEEEEcccHHHHccHHHHHHHHHHHHHHHcccccEEEEEEccccEEEEcccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcEEcccHHHHHHHccEEEEccccccccccEEEEEcccccccHHHHHccHHHHHHHHHccccccHHHHHHccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHc
miqdesvplnYYAAIHAVQvsipdnciivgegantmDIGRSLLLnnlprhrldagtfgtmGVGLGFALAAALYcnhyapgkrvvcvqgdsafgfsgmeletlavdkegrpkLDEIFSTCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIAttaskfstpgynILVSTCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIAttaskfstpgarhgifcstpavaltrkvplgVVRSMTItgipisaqdaynAGLITRVVSSNEELESETKVLTSAILENSRSVLTLGKQFLYQQMSLNIEEAY
MIQDESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELEtlavdkegrpKLDEIFSTCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATtaskfstpgyNILVSTCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTAskfstpgarhGIFCSTPAVALTRKVPLGVVRSMTITGipisaqdayNAGLITRVVSSNEELESETKVLTSAILENSRSVLTLGKQFLYQQMSLNIEEAY
MIQDESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMgvglgfalaaalYCNHYAPGKRVVCVQGDSAFGFSGMELETLAVDKEGRPKLDEIFSTCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGYNILVSTCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGARHGIFCSTPAVALTRKVPLGVVRSMTITGIPISAQDAYNAGLITRVVSSNEELESETKVLTSAILENSRSVLTLGKQFLYQQMSLNIEEAY
*******PLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLAVDKEGRPKLDEIFSTCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGYNILVSTCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGARHGIFCSTPAVALTRKVPLGVVRSMTITGIPISAQDAYNAGLITRVVS*********KVLTSAILENSRSVLTLGKQFLYQQM********
****ESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRL*AGTFGTMGVGLGFALAAAL**NHYAPGKRVVCVQGDSAFGFSGMELETLAVDKEGRPKLDEIFSTCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGYNILVSTCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGARHGIFCSTPAVALTRKVPLGVVRSMTITGIPISAQDAYNAGLITRVVSSNEELESETKVLTSAILENSRSVLTLGKQFLYQQMSLNI****
MIQDESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLAVDKEGRPKLDEIFSTCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGYNILVSTCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGARHGIFCSTPAVALTRKVPLGVVRSMTITGIPISAQDAYNAGLITRVVSS********KVLTSAILENSRSVLTLGKQFLYQQMSLNIEEAY
*****SVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLAVDKEGRPKLDEIFSTCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGYNILVSTCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGARHGIFCSTPAVALTRKVPLGVVRSMTITGIPISAQDAYNAGLITRVVSSNEELESETKVLTSAILENSRSVLTLGKQFLYQQMSLNIEEAY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIQDESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLAVDKEGRPKLDEIFSTCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGYNILVSTCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGARHGIFCSTPAVALTRKVPLGVVRSMTITGIPISAQDAYNAGLITRVVSSNEELESETKVLTSAILENSRSVLTLGKQFLYQQMSLNIEEAY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query315 2.2.26 [Sep-21-2011]
Q8CHM7581 2-hydroxyacyl-CoA lyase 1 yes N/A 0.311 0.168 0.673 4e-36
Q9D7J9300 Enoyl-CoA hydratase domai yes N/A 0.457 0.48 0.524 1e-35
Q9UJ83578 2-hydroxyacyl-CoA lyase 1 yes N/A 0.314 0.171 0.636 7e-35
Q9QXE0581 2-hydroxyacyl-CoA lyase 1 no N/A 0.314 0.170 0.656 1e-34
Q3MIE0300 Enoyl-CoA hydratase domai no N/A 0.466 0.49 0.5 1e-34
Q96DC8303 Enoyl-CoA hydratase domai no N/A 0.457 0.475 0.489 5e-33
A0PJR5289 Enoyl-CoA hydratase domai no N/A 0.447 0.487 0.5 7e-33
A9JS71294 Enoyl-CoA hydratase domai N/A N/A 0.457 0.489 0.482 3e-31
Q9LF46572 2-hydroxyacyl-CoA lyase O yes N/A 0.292 0.160 0.51 1e-20
Q54DA9580 Probable 2-hydroxyacyl-Co yes N/A 0.279 0.151 0.531 6e-20
>sp|Q8CHM7|HACL1_RAT 2-hydroxyacyl-CoA lyase 1 OS=Rattus norvegicus GN=Hacl1 PE=1 SV=1 Back     alignment and function desciption
 Score =  152 bits (384), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 82/98 (83%)

Query: 5   ESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGL 64
           +S+P+NYY   + VQ  +P NC IV EGANTMDIGR++L N LPRHRLDAG+FGTMGVGL
Sbjct: 374 KSLPMNYYTVFYHVQEQLPRNCFIVSEGANTMDIGRTVLQNYLPRHRLDAGSFGTMGVGL 433

Query: 65  GFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETL 102
           GFA+AAA+     +PG+RV+CV+GDSAFGFSGME+ET+
Sbjct: 434 GFAIAAAVVAKERSPGQRVICVEGDSAFGFSGMEVETI 471




Catalyzes a carbon-carbon cleavage reaction; cleaves a 2-hydroxy-3-methylacyl-CoA into formyl-CoA and a 2-methyl-branched fatty aldehyde.
Rattus norvegicus (taxid: 10116)
EC: 4EC: .EC: 1EC: .EC: -EC: .EC: -
>sp|Q9D7J9|ECHD3_MOUSE Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Mus musculus GN=Echdc3 PE=2 SV=1 Back     alignment and function description
>sp|Q9UJ83|HACL1_HUMAN 2-hydroxyacyl-CoA lyase 1 OS=Homo sapiens GN=HACL1 PE=1 SV=2 Back     alignment and function description
>sp|Q9QXE0|HACL1_MOUSE 2-hydroxyacyl-CoA lyase 1 OS=Mus musculus GN=Hacl1 PE=1 SV=2 Back     alignment and function description
>sp|Q3MIE0|ECHD3_RAT Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Rattus norvegicus GN=Echdc3 PE=2 SV=1 Back     alignment and function description
>sp|Q96DC8|ECHD3_HUMAN Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Homo sapiens GN=ECHDC3 PE=1 SV=2 Back     alignment and function description
>sp|A0PJR5|ECHD3_DANRE Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Danio rerio GN=echdc3 PE=2 SV=2 Back     alignment and function description
>sp|A9JS71|ECHD3_XENLA Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Xenopus laevis GN=echdc3 PE=2 SV=1 Back     alignment and function description
>sp|Q9LF46|HACL_ARATH 2-hydroxyacyl-CoA lyase OS=Arabidopsis thaliana GN=HACL PE=2 SV=1 Back     alignment and function description
>sp|Q54DA9|HACL1_DICDI Probable 2-hydroxyacyl-CoA lyase 1 OS=Dictyostelium discoideum GN=hacl1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query315
193586967 571 PREDICTED: 2-hydroxyacyl-CoA lyase 1-lik 0.323 0.178 0.735 2e-40
91088717 568 PREDICTED: similar to 2-hydroxyphytanoyl 0.323 0.179 0.735 3e-39
332028930312 2-hydroxyacyl-CoA lyase 1 [Acromyrmex ec 0.307 0.310 0.762 5e-39
114051914 593 2-hydroxyphytanoyl-CoA lyase [Bombyx mor 0.307 0.163 0.752 4e-38
307171064 566 2-hydroxyacyl-CoA lyase 1 [Camponotus fl 0.323 0.180 0.725 4e-38
357618628 568 2-hydroxyphytanoyl-CoA lyase [Danaus ple 0.314 0.174 0.737 5e-38
307196382 566 2-hydroxyacyl-CoA lyase 1 [Harpegnathos 0.323 0.180 0.725 6e-38
156545467 568 PREDICTED: 2-hydroxyacyl-CoA lyase 1-lik 0.323 0.179 0.715 1e-37
345482048 543 PREDICTED: 2-hydroxyacyl-CoA lyase 1-lik 0.323 0.187 0.715 1e-37
383849866 566 PREDICTED: 2-hydroxyacyl-CoA lyase 1-lik 0.314 0.174 0.737 1e-37
>gi|193586967|ref|XP_001952174.1| PREDICTED: 2-hydroxyacyl-CoA lyase 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  172 bits (436), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 75/102 (73%), Positives = 89/102 (87%)

Query: 1   MIQDESVPLNYYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTM 60
           M++D S+PLNYY     V  +IP +C+IV EGANTMDIGR++LLNNLPRHRLDAGTFGTM
Sbjct: 360 MMKDTSIPLNYYTVFRHVSDNIPKDCMIVSEGANTMDIGRAVLLNNLPRHRLDAGTFGTM 419

Query: 61  GVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETL 102
           GVGLGFA+AAAL+C  Y PGKRV+CV+GDSAFGFSGME+ET+
Sbjct: 420 GVGLGFAIAAALWCQKYEPGKRVLCVEGDSAFGFSGMEVETM 461




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91088717|ref|XP_975143.1| PREDICTED: similar to 2-hydroxyphytanoyl-coa lyase [Tribolium castaneum] gi|270011662|gb|EFA08110.1| hypothetical protein TcasGA2_TC005714 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332028930|gb|EGI68948.1| 2-hydroxyacyl-CoA lyase 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|114051914|ref|NP_001040193.1| 2-hydroxyphytanoyl-CoA lyase [Bombyx mori] gi|87248339|gb|ABD36222.1| 2-hydroxyphytanoyl-CoA lyase [Bombyx mori] Back     alignment and taxonomy information
>gi|307171064|gb|EFN63107.1| 2-hydroxyacyl-CoA lyase 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|357618628|gb|EHJ71538.1| 2-hydroxyphytanoyl-CoA lyase [Danaus plexippus] Back     alignment and taxonomy information
>gi|307196382|gb|EFN77971.1| 2-hydroxyacyl-CoA lyase 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|156545467|ref|XP_001606876.1| PREDICTED: 2-hydroxyacyl-CoA lyase 1-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345482048|ref|XP_003424517.1| PREDICTED: 2-hydroxyacyl-CoA lyase 1-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383849866|ref|XP_003700555.1| PREDICTED: 2-hydroxyacyl-CoA lyase 1-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query315
MGI|MGI:1915106300 Echdc3 "enoyl Coenzyme A hydra 0.447 0.47 0.535 1.7e-34
UNIPROTKB|E1BLR8300 ECHDC3 "Uncharacterized protei 0.473 0.496 0.509 2.8e-34
RGD|1589147300 Echdc3 "enoyl Coenzyme A hydra 0.447 0.47 0.521 1.2e-33
UNIPROTKB|F1PAH9261 ECHDC3 "Uncharacterized protei 0.476 0.574 0.493 1.5e-33
ZFIN|ZDB-GENE-061201-12289 zgc:158321 "zgc:158321" [Danio 0.568 0.619 0.434 1.4e-32
UNIPROTKB|Q96DC8303 ECHDC3 "Enoyl-CoA hydratase do 0.447 0.465 0.5 2.9e-32
UNIPROTKB|F1RUP0302 ECHDC3 "Uncharacterized protei 0.473 0.493 0.476 3.7e-32
UNIPROTKB|F1P1V5297 ECHDC3 "Uncharacterized protei 0.444 0.471 0.489 3.7e-32
FB|FBgn0034191285 CG6984 [Drosophila melanogaste 0.441 0.487 0.457 1.4e-30
FB|FBgn0034488568 CG11208 [Drosophila melanogast 0.323 0.179 0.598 7.9e-29
MGI|MGI:1915106 Echdc3 "enoyl Coenzyme A hydratase domain containing 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 374 (136.7 bits), Expect = 1.7e-34, P = 1.7e-34
 Identities = 76/142 (53%), Positives = 100/142 (70%)

Query:   174 TCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGARHGIFCSTP 233
             TCS++M+ I  HPVPILA+++G+A AAGCQLVA+CD+A+A+  S F+TPG   G+FCSTP
Sbjct:   127 TCSEVMMLIRNHPVPILAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCSTP 186

Query:   234 AVALTRKVPLGVVRSMTITGIPISAQDAYNAGLITRVVSSNEELESETKVLTSAILENSR 293
             AVAL R VP  V   M  TG PISAQ+A   GLI++VV   E+LE+ET  +   I   SR
Sbjct:   187 AVALGRAVPRKVALEMLFTGEPISAQEALRHGLISKVVPE-EQLEAETMRIAKKISSLSR 245

Query:   294 SVLTLGKQFLYQQMSLNIEEAY 315
             SV+ LGK   Y+Q+  ++  AY
Sbjct:   246 SVVALGKATFYKQLPQDLRTAY 267


GO:0003674 "molecular_function" evidence=ND
GO:0003824 "catalytic activity" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0008150 "biological_process" evidence=ND
GO:0008152 "metabolic process" evidence=IEA
UNIPROTKB|E1BLR8 ECHDC3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1589147 Echdc3 "enoyl Coenzyme A hydratase domain containing 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PAH9 ECHDC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061201-12 zgc:158321 "zgc:158321" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q96DC8 ECHDC3 "Enoyl-CoA hydratase domain-containing protein 3, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RUP0 ECHDC3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1V5 ECHDC3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0034191 CG6984 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0034488 CG11208 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9D7J9ECHD3_MOUSENo assigned EC number0.52410.45710.48yesN/A
A4YI89HPCD_METS54, ., 2, ., 1, ., 1, 1, 60.30800.60950.7413yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
cd02004172 cd02004, TPP_BZL_OCoD_HPCL, Thiamine pyrophosphate 3e-47
PRK08139266 PRK08139, PRK08139, enoyl-CoA hydratase; Validated 7e-46
PRK09259569 PRK09259, PRK09259, putative oxalyl-CoA decarboxyl 4e-30
TIGR03254554 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase 1e-26
cd06558195 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme 7e-23
COG1024257 COG1024, CaiD, Enoyl-CoA hydratase/carnithine race 2e-22
PRK08139266 PRK08139, PRK08139, enoyl-CoA hydratase; Validated 1e-20
COG0028550 COG0028, IlvB, Thiamine pyrophosphate-requiring en 1e-17
pfam00378245 pfam00378, ECH, Enoyl-CoA hydratase/isomerase fami 3e-16
PRK05809260 PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydrata 5e-16
PRK05995262 PRK05995, PRK05995, enoyl-CoA hydratase; Provision 7e-16
PRK11423261 PRK11423, PRK11423, methylmalonyl-CoA decarboxylas 2e-14
cd00568168 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) 8e-14
pfam02775151 pfam02775, TPP_enzyme_C, Thiamine pyrophosphate en 2e-13
PRK06494259 PRK06494, PRK06494, enoyl-CoA hydratase; Provision 4e-12
PRK06688259 PRK06688, PRK06688, enoyl-CoA hydratase; Provision 4e-12
PLN02888265 PLN02888, PLN02888, enoyl-CoA hydratase 8e-12
PRK07854243 PRK07854, PRK07854, enoyl-CoA hydratase; Provision 1e-10
PRK05858542 PRK05858, PRK05858, hypothetical protein; Provisio 2e-10
PRK06127269 PRK06127, PRK06127, enoyl-CoA hydratase; Provision 1e-09
cd02015186 cd02015, TPP_AHAS, Thiamine pyrophosphate (TPP) fa 2e-09
PRK09674255 PRK09674, PRK09674, enoyl-CoA hydratase-isomerase; 3e-09
PRK06143256 PRK06143, PRK06143, enoyl-CoA hydratase; Provision 3e-09
PRK09245266 PRK09245, PRK09245, enoyl-CoA hydratase; Provision 5e-09
PRK06190258 PRK06190, PRK06190, enoyl-CoA hydratase; Provision 7e-09
PRK08138261 PRK08138, PRK08138, enoyl-CoA hydratase; Provision 7e-09
PRK05862257 PRK05862, PRK05862, enoyl-CoA hydratase; Provision 8e-09
PRK08617552 PRK08617, PRK08617, acetolactate synthase; Reviewe 1e-08
cd02010177 cd02010, TPP_ALS, Thiamine pyrophosphate (TPP) fam 1e-08
PRK07658257 PRK07658, PRK07658, enoyl-CoA hydratase; Provision 1e-08
PRK05980260 PRK05980, PRK05980, enoyl-CoA hydratase; Provision 2e-08
PRK07525588 PRK07525, PRK07525, sulfoacetaldehyde acetyltransf 2e-08
PRK08155564 PRK08155, PRK08155, acetolactate synthase catalyti 2e-08
PRK07799263 PRK07799, PRK07799, enoyl-CoA hydratase; Provision 3e-08
PRK07509262 PRK07509, PRK07509, enoyl-CoA hydratase; Provision 3e-08
PLN02921327 PLN02921, PLN02921, naphthoate synthase 3e-08
PRK11730 715 PRK11730, fadB, multifunctional fatty acid oxidati 4e-08
PRK08258277 PRK08258, PRK08258, enoyl-CoA hydratase; Provision 4e-08
PRK03580261 PRK03580, PRK03580, carnitinyl-CoA dehydratase; Pr 6e-08
cd02014178 cd02014, TPP_POX, Thiamine pyrophosphate (TPP) fam 8e-08
PRK08252254 PRK08252, PRK08252, enoyl-CoA hydratase; Provision 1e-07
TIGR02418539 TIGR02418, acolac_catab, acetolactate synthase, ca 1e-07
PRK08290288 PRK08290, PRK08290, enoyl-CoA hydratase; Provision 2e-07
PRK07112255 PRK07112, PRK07112, polyketide biosynthesis enoyl- 2e-07
PRK07938249 PRK07938, PRK07938, enoyl-CoA hydratase; Provision 3e-07
TIGR01929259 TIGR01929, menB, naphthoate synthase (dihydroxynap 3e-07
TIGR02280256 TIGR02280, PaaB1, phenylacetate degradation probab 4e-07
TIGR02437 714 TIGR02437, FadB, fatty oxidation complex, alpha su 4e-07
PRK06154565 PRK06154, PRK06154, hypothetical protein; Provisio 6e-07
PRK06144262 PRK06144, PRK06144, enoyl-CoA hydratase; Provision 6e-07
PRK07827260 PRK07827, PRK07827, enoyl-CoA hydratase; Provision 8e-07
PLN02664275 PLN02664, PLN02664, enoyl-CoA hydratase/delta3,5-d 3e-06
PRK07511260 PRK07511, PRK07511, enoyl-CoA hydratase; Provision 4e-06
PRK06495257 PRK06495, PRK06495, enoyl-CoA hydratase; Provision 4e-06
cd02013196 cd02013, TPP_Xsc_like, Thiamine pyrophosphate (TPP 5e-06
PRK08260296 PRK08260, PRK08260, enoyl-CoA hydratase; Provision 6e-06
PRK07657260 PRK07657, PRK07657, enoyl-CoA hydratase; Provision 7e-06
PRK08140262 PRK08140, PRK08140, enoyl-CoA hydratase; Provision 9e-06
TIGR03210256 TIGR03210, badI, 2-ketocyclohexanecarboxyl-CoA hyd 9e-06
PRK08259254 PRK08259, PRK08259, enoyl-CoA hydratase; Provision 9e-06
pfam00378245 pfam00378, ECH, Enoyl-CoA hydratase/isomerase fami 1e-05
PRK05674265 PRK05674, PRK05674, gamma-carboxygeranoyl-CoA hydr 1e-05
TIGR03189251 TIGR03189, dienoyl_CoA_hyt, cyclohexa-1,5-dienecar 1e-05
PRK05981266 PRK05981, PRK05981, enoyl-CoA hydratase; Provision 2e-05
COG0447282 COG0447, MenB, Dihydroxynaphthoic acid synthase [C 2e-05
PRK07260255 PRK07260, PRK07260, enoyl-CoA hydratase; Provision 2e-05
PRK05870249 PRK05870, PRK05870, enoyl-CoA hydratase; Provision 2e-05
PRK06688259 PRK06688, PRK06688, enoyl-CoA hydratase; Provision 4e-05
PRK07418616 PRK07418, PRK07418, acetolactate synthase 3 cataly 7e-05
PRK07586514 PRK07586, PRK07586, hypothetical protein; Validate 7e-05
PRK06725570 PRK06725, PRK06725, acetolactate synthase 3 cataly 9e-05
TIGR02280256 TIGR02280, PaaB1, phenylacetate degradation probab 1e-04
PRK05864276 PRK05864, PRK05864, enoyl-CoA hydratase; Provision 1e-04
PRK07854243 PRK07854, PRK07854, enoyl-CoA hydratase; Provision 2e-04
PRK08321302 PRK08321, PRK08321, naphthoate synthase; Validated 2e-04
TIGR02441 737 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation c 2e-04
TIGR03457579 TIGR03457, sulphoacet_xsc, sulfoacetaldehyde acety 2e-04
PRK07979574 PRK07979, PRK07979, acetolactate synthase 3 cataly 4e-04
PRK08322547 PRK08322, PRK08322, acetolactate synthase; Reviewe 4e-04
cd02002178 cd02002, TPP_BFDC, Thiamine pyrophosphate (TPP) fa 5e-04
PRK06276586 PRK06276, PRK06276, acetolactate synthase catalyti 5e-04
PRK06466574 PRK06466, PRK06466, acetolactate synthase 3 cataly 5e-04
PLN02470585 PLN02470, PLN02470, acetolactate synthase 5e-04
PLN02600251 PLN02600, PLN02600, enoyl-CoA hydratase 5e-04
PRK06210272 PRK06210, PRK06210, enoyl-CoA hydratase; Provision 6e-04
PRK06882574 PRK06882, PRK06882, acetolactate synthase 3 cataly 6e-04
PRK05995262 PRK05995, PRK05995, enoyl-CoA hydratase; Provision 7e-04
PRK06142272 PRK06142, PRK06142, enoyl-CoA hydratase; Provision 7e-04
PRK06023251 PRK06023, PRK06023, enoyl-CoA hydratase; Provision 8e-04
PRK08258277 PRK08258, PRK08258, enoyl-CoA hydratase; Provision 0.001
PRK06144262 PRK06144, PRK06144, enoyl-CoA hydratase; Provision 0.001
PRK08140262 PRK08140, PRK08140, enoyl-CoA hydratase; Provision 0.001
TIGR03200 360 TIGR03200, dearomat_oah, 6-oxocyclohex-1-ene-1-car 0.001
PRK07396273 PRK07396, PRK07396, dihydroxynaphthoic acid synthe 0.001
TIGR00118558 TIGR00118, acolac_lg, acetolactate synthase, large 0.001
PRK08266542 PRK08266, PRK08266, hypothetical protein; Provisio 0.001
cd02008178 cd02008, TPP_IOR_alpha, Thiamine pyrophosphate (TP 0.001
CHL00099585 CHL00099, ilvB, acetohydroxyacid synthase large su 0.001
PRK08150255 PRK08150, PRK08150, enoyl-CoA hydratase; Provision 0.002
PRK07468262 PRK07468, PRK07468, enoyl-CoA hydratase; Provision 0.002
TIGR02720575 TIGR02720, pyruv_oxi_spxB, pyruvate oxidase 0.002
PRK07827260 PRK07827, PRK07827, enoyl-CoA hydratase; Provision 0.003
PRK05674265 PRK05674, PRK05674, gamma-carboxygeranoyl-CoA hydr 0.003
PRK06456572 PRK06456, PRK06456, acetolactate synthase catalyti 0.003
PRK08979572 PRK08979, PRK08979, acetolactate synthase 3 cataly 0.003
PRK08978548 PRK08978, PRK08978, acetolactate synthase 2 cataly 0.004
PRK07524535 PRK07524, PRK07524, hypothetical protein; Provisio 0.004
>gnl|CDD|238962 cd02004, TPP_BZL_OCoD_HPCL, Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
 Score =  156 bits (396), Expect = 3e-47
 Identities = 59/127 (46%), Positives = 75/127 (59%), Gaps = 28/127 (22%)

Query: 11  YYAAIHAVQVSIPDNCIIVGEGANTMDIGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAA 70
            Y  +H +Q ++PD+ IIV +G NTMD  R +L    PRHRLDAGTFGT+GVGLG+A+AA
Sbjct: 1   PYRVLHELQEALPDDAIIVSDGGNTMDWARYILRPRKPRHRLDAGTFGTLGVGLGYAIAA 60

Query: 71  ALYCNHYAPGKRVVCVQGDSAFGFSGMELETLAVDKEGRPKLDEIFSTCSDLMLSILRHP 130
           AL      P KRVV V+GD AFGFSGMELET                          R+ 
Sbjct: 61  ALAR----PDKRVVLVEGDGAFGFSGMELETAV------------------------RYN 92

Query: 131 VPILAII 137
           +PI+ ++
Sbjct: 93  LPIVVVV 99


Pseudomonas fluorescens biovar I BZL cleaves the acyloin linkage of benzoin producing 2 molecules of benzaldehyde and enabling the Pseudomonas to grow on benzoin as the sole carbon and energy source. OCoD has a role in the detoxification of oxalate, catalyzing the decarboxylation of oxalyl-CoA to formate. 2-HPCL is a peroxisomal enzyme which plays a role in the alpha-oxidation of 3-methyl-branched fatty acids, catalyzing the cleavage of 2-hydroxy-3-methylacyl-CoA into formyl-CoA and a 2-methyl-branched fatty aldehyde. All these enzymes depend on Mg2+ and TPP for activity. Length = 172

>gnl|CDD|181249 PRK08139, PRK08139, enoyl-CoA hydratase; Validated Back     alignment and domain information
>gnl|CDD|236433 PRK09259, PRK09259, putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>gnl|CDD|132298 TIGR03254, oxalate_oxc, oxalyl-CoA decarboxylase Back     alignment and domain information
>gnl|CDD|119339 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>gnl|CDD|223955 COG1024, CaiD, Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|181249 PRK08139, PRK08139, enoyl-CoA hydratase; Validated Back     alignment and domain information
>gnl|CDD|223107 COG0028, IlvB, Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|201191 pfam00378, ECH, Enoyl-CoA hydratase/isomerase family Back     alignment and domain information
>gnl|CDD|180270 PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>gnl|CDD|235664 PRK05995, PRK05995, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236908 PRK11423, PRK11423, methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|238318 cd00568, TPP_enzymes, Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>gnl|CDD|217223 pfam02775, TPP_enzyme_C, Thiamine pyrophosphate enzyme, C-terminal TPP binding domain Back     alignment and domain information
>gnl|CDD|180591 PRK06494, PRK06494, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235852 PRK06688, PRK06688, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|215480 PLN02888, PLN02888, enoyl-CoA hydratase Back     alignment and domain information
>gnl|CDD|236115 PRK07854, PRK07854, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235629 PRK05858, PRK05858, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235705 PRK06127, PRK06127, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|238973 cd02015, TPP_AHAS, Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>gnl|CDD|182026 PRK09674, PRK09674, enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>gnl|CDD|180423 PRK06143, PRK06143, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181723 PRK09245, PRK09245, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235733 PRK06190, PRK06190, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236162 PRK08138, PRK08138, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180295 PRK05862, PRK05862, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236312 PRK08617, PRK08617, acetolactate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|238968 cd02010, TPP_ALS, Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>gnl|CDD|181070 PRK07658, PRK07658, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180335 PRK05980, PRK05980, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236042 PRK07525, PRK07525, sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>gnl|CDD|181257 PRK08155, PRK08155, acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|181122 PRK07799, PRK07799, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181008 PRK07509, PRK07509, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|178509 PLN02921, PLN02921, naphthoate synthase Back     alignment and domain information
>gnl|CDD|183293 PRK11730, fadB, multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>gnl|CDD|181329 PRK08258, PRK08258, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|179599 PRK03580, PRK03580, carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|238972 cd02014, TPP_POX, Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>gnl|CDD|181325 PRK08252, PRK08252, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|131471 TIGR02418, acolac_catab, acetolactate synthase, catabolic Back     alignment and domain information
>gnl|CDD|236220 PRK08290, PRK08290, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235938 PRK07112, PRK07112, polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>gnl|CDD|181174 PRK07938, PRK07938, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|200143 TIGR01929, menB, naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>gnl|CDD|131333 TIGR02280, PaaB1, phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>gnl|CDD|131490 TIGR02437, FadB, fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>gnl|CDD|235718 PRK06154, PRK06154, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180424 PRK06144, PRK06144, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236109 PRK07827, PRK07827, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|178269 PLN02664, PLN02664, enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>gnl|CDD|181009 PRK07511, PRK07511, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168580 PRK06495, PRK06495, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|238971 cd02013, TPP_Xsc_like, Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>gnl|CDD|236206 PRK08260, PRK08260, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181069 PRK07657, PRK07657, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236163 PRK08140, PRK08140, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|132254 TIGR03210, badI, 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>gnl|CDD|236205 PRK08259, PRK08259, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|201191 pfam00378, ECH, Enoyl-CoA hydratase/isomerase family Back     alignment and domain information
>gnl|CDD|168168 PRK05674, PRK05674, gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>gnl|CDD|132233 TIGR03189, dienoyl_CoA_hyt, cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>gnl|CDD|235661 PRK05981, PRK05981, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|223524 COG0447, MenB, Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|180910 PRK07260, PRK07260, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180298 PRK05870, PRK05870, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235852 PRK06688, PRK06688, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236014 PRK07418, PRK07418, acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|236063 PRK07586, PRK07586, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|180672 PRK06725, PRK06725, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|131333 TIGR02280, PaaB1, phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>gnl|CDD|168278 PRK05864, PRK05864, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236115 PRK07854, PRK07854, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181386 PRK08321, PRK08321, naphthoate synthase; Validated Back     alignment and domain information
>gnl|CDD|131494 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>gnl|CDD|132497 TIGR03457, sulphoacet_xsc, sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>gnl|CDD|181185 PRK07979, PRK07979, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|236239 PRK08322, PRK08322, acetolactate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|238960 cd02002, TPP_BFDC, Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>gnl|CDD|235766 PRK06276, PRK06276, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180578 PRK06466, PRK06466, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|215261 PLN02470, PLN02470, acetolactate synthase Back     alignment and domain information
>gnl|CDD|178210 PLN02600, PLN02600, enoyl-CoA hydratase Back     alignment and domain information
>gnl|CDD|180472 PRK06210, PRK06210, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168717 PRK06882, PRK06882, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|235664 PRK05995, PRK05995, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235714 PRK06142, PRK06142, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168351 PRK06023, PRK06023, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181329 PRK08258, PRK08258, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180424 PRK06144, PRK06144, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236163 PRK08140, PRK08140, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|132244 TIGR03200, dearomat_oah, 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>gnl|CDD|180958 PRK07396, PRK07396, dihydroxynaphthoic acid synthetase; Validated Back     alignment and domain information
>gnl|CDD|232833 TIGR00118, acolac_lg, acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>gnl|CDD|181337 PRK08266, PRK08266, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238966 cd02008, TPP_IOR_alpha, Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>gnl|CDD|214363 CHL00099, ilvB, acetohydroxyacid synthase large subunit Back     alignment and domain information
>gnl|CDD|181254 PRK08150, PRK08150, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180987 PRK07468, PRK07468, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|213733 TIGR02720, pyruv_oxi_spxB, pyruvate oxidase Back     alignment and domain information
>gnl|CDD|236109 PRK07827, PRK07827, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168168 PRK05674, PRK05674, gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>gnl|CDD|180569 PRK06456, PRK06456, acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181602 PRK08979, PRK08979, acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>gnl|CDD|181601 PRK08978, PRK08978, acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>gnl|CDD|236041 PRK07524, PRK07524, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 315
KOG1680|consensus290 100.0
PRK08139266 enoyl-CoA hydratase; Validated 100.0
PRK06143256 enoyl-CoA hydratase; Provisional 100.0
PRK09120275 p-hydroxycinnamoyl CoA hydratase/lyase; Validated 100.0
PRK08150255 enoyl-CoA hydratase; Provisional 100.0
PRK06190258 enoyl-CoA hydratase; Provisional 100.0
PRK05862257 enoyl-CoA hydratase; Provisional 100.0
PRK05674265 gamma-carboxygeranoyl-CoA hydratase; Validated 100.0
PRK09245266 enoyl-CoA hydratase; Provisional 100.0
PLN02600251 enoyl-CoA hydratase 100.0
PRK05995262 enoyl-CoA hydratase; Provisional 100.0
PRK05980260 enoyl-CoA hydratase; Provisional 100.0
PRK09674255 enoyl-CoA hydratase-isomerase; Provisional 100.0
PRK06127269 enoyl-CoA hydratase; Provisional 100.0
PRK05869222 enoyl-CoA hydratase; Validated 100.0
PRK09076258 enoyl-CoA hydratase; Provisional 100.0
PRK06142272 enoyl-CoA hydratase; Provisional 100.0
PRK08138261 enoyl-CoA hydratase; Provisional 100.0
TIGR02280256 PaaB1 phenylacetate degradation probable enoyl-CoA 100.0
PRK06563255 enoyl-CoA hydratase; Provisional 100.0
PRK05809260 3-hydroxybutyryl-CoA dehydratase; Validated 100.0
PRK07657260 enoyl-CoA hydratase; Provisional 100.0
PRK08140262 enoyl-CoA hydratase; Provisional 100.0
PRK06144262 enoyl-CoA hydratase; Provisional 100.0
PLN02888265 enoyl-CoA hydratase 100.0
PRK07511260 enoyl-CoA hydratase; Provisional 100.0
TIGR03210256 badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb 100.0
PLN02664275 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA 100.0
PRK06494259 enoyl-CoA hydratase; Provisional 100.0
PRK07468262 enoyl-CoA hydratase; Provisional 100.0
PRK07658257 enoyl-CoA hydratase; Provisional 100.0
PRK06023251 enoyl-CoA hydratase; Provisional 100.0
PRK07260255 enoyl-CoA hydratase; Provisional 100.0
PRK07799263 enoyl-CoA hydratase; Provisional 100.0
PRK08259254 enoyl-CoA hydratase; Provisional 100.0
PRK08258277 enoyl-CoA hydratase; Provisional 100.0
PRK08252254 enoyl-CoA hydratase; Provisional 100.0
PRK05864276 enoyl-CoA hydratase; Provisional 100.0
PRK05870249 enoyl-CoA hydratase; Provisional 100.0
PRK07327268 enoyl-CoA hydratase; Provisional 100.0
PRK03580261 carnitinyl-CoA dehydratase; Provisional 100.0
PRK07110249 polyketide biosynthesis enoyl-CoA hydratase; Valid 100.0
PRK06495257 enoyl-CoA hydratase; Provisional 100.0
PRK06688259 enoyl-CoA hydratase; Provisional 100.0
PRK07659260 enoyl-CoA hydratase; Provisional 100.0
TIGR03222546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 100.0
PRK06210272 enoyl-CoA hydratase; Provisional 100.0
TIGR01929259 menB naphthoate synthase (dihydroxynaphthoic acid 100.0
PRK05981266 enoyl-CoA hydratase; Provisional 100.0
PRK07938249 enoyl-CoA hydratase; Provisional 100.0
PRK08290288 enoyl-CoA hydratase; Provisional 100.0
PRK07396273 dihydroxynaphthoic acid synthetase; Validated 100.0
TIGR03189251 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy 100.0
PRK11423261 methylmalonyl-CoA decarboxylase; Provisional 100.0
PRK08260296 enoyl-CoA hydratase; Provisional 100.0
PRK12478298 enoyl-CoA hydratase; Provisional 100.0
COG1024257 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi 100.0
PRK07509262 enoyl-CoA hydratase; Provisional 100.0
PLN03214278 probable enoyl-CoA hydratase/isomerase; Provisiona 100.0
PRK08184550 benzoyl-CoA-dihydrodiol lyase; Provisional 100.0
PLN02921327 naphthoate synthase 100.0
PRK08272302 enoyl-CoA hydratase; Provisional 100.0
PRK06072248 enoyl-CoA hydratase; Provisional 100.0
PRK05617342 3-hydroxyisobutyryl-CoA hydrolase; Provisional 100.0
PF00378245 ECH: Enoyl-CoA hydratase/isomerase family; InterPr 100.0
PRK07827260 enoyl-CoA hydratase; Provisional 100.0
PRK06213229 enoyl-CoA hydratase; Provisional 100.0
PLN02874379 3-hydroxyisobutyryl-CoA hydrolase-like protein 100.0
KOG1681|consensus292 100.0
PRK08321302 naphthoate synthase; Validated 100.0
PRK07854243 enoyl-CoA hydratase; Provisional 100.0
PRK07112255 polyketide biosynthesis enoyl-CoA hydratase; Valid 100.0
PLN02157 401 3-hydroxyisobutyryl-CoA hydrolase-like protein 100.0
PRK08788287 enoyl-CoA hydratase; Validated 100.0
TIGR03200360 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy 100.0
PLN02267239 enoyl-CoA hydratase/isomerase family protein 100.0
PLN02988 381 3-hydroxyisobutyryl-CoA hydrolase 100.0
KOG1679|consensus291 100.0
PRK11730 715 fadB multifunctional fatty acid oxidation complex 100.0
PLN02851 407 3-hydroxyisobutyryl-CoA hydrolase-like protein 100.0
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 100.0
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 100.0
KOG0016|consensus266 100.0
COG0447282 MenB Dihydroxynaphthoic acid synthase [Coenzyme me 100.0
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 99.98
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 99.97
cd06558195 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy 99.97
KOG1682|consensus287 99.97
KOG1684|consensus 401 99.94
TIGR03222 546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 99.93
PRK08184 550 benzoyl-CoA-dihydrodiol lyase; Provisional 99.92
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptid 99.65
cd02006202 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl s 99.62
cd02013196 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, 99.6
cd07020187 Clp_protease_NfeD_1 Nodulation formation efficienc 99.58
cd02015186 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acet 99.54
PLN02157401 3-hydroxyisobutyryl-CoA hydrolase-like protein 99.51
cd02010177 TPP_ALS Thiamine pyrophosphate (TPP) family, Aceto 99.5
COG0028550 IlvB Thiamine pyrophosphate-requiring enzymes [ace 99.49
cd02004172 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) fam 99.46
cd02014178 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruv 99.44
cd02003205 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD 99.44
PLN02851407 3-hydroxyisobutyryl-CoA hydrolase-like protein 99.43
PRK08273597 thiamine pyrophosphate protein; Provisional 99.43
cd02005183 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, 99.42
TIGR01504588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 99.41
PLN02988381 3-hydroxyisobutyryl-CoA hydrolase 99.41
KOG1185|consensus571 99.4
PRK12474518 hypothetical protein; Provisional 99.39
PRK07979574 acetolactate synthase 3 catalytic subunit; Validat 99.39
PRK08979572 acetolactate synthase 3 catalytic subunit; Validat 99.39
PRK06466574 acetolactate synthase 3 catalytic subunit; Validat 99.38
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase 99.38
PRK09107595 acetolactate synthase 3 catalytic subunit; Validat 99.38
PLN02470585 acetolactate synthase 99.38
PRK07282566 acetolactate synthase catalytic subunit; Reviewed 99.37
PRK06965587 acetolactate synthase 3 catalytic subunit; Validat 99.37
TIGR02720575 pyruv_oxi_spxB pyruvate oxidase. Members of this f 99.36
PRK06457549 pyruvate dehydrogenase; Provisional 99.36
PRK06154565 hypothetical protein; Provisional 99.36
cd02002178 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC 99.35
PRK06456572 acetolactate synthase catalytic subunit; Reviewed 99.35
PRK09124574 pyruvate dehydrogenase; Provisional 99.35
PRK07525588 sulfoacetaldehyde acetyltransferase; Validated 99.34
TIGR02418539 acolac_catab acetolactate synthase, catabolic. Ace 99.34
PRK08527563 acetolactate synthase 3 catalytic subunit; Validat 99.34
PRK07586514 hypothetical protein; Validated 99.34
PRK06725570 acetolactate synthase 3 catalytic subunit; Validat 99.33
PRK08978548 acetolactate synthase 2 catalytic subunit; Reviewe 99.33
TIGR03393539 indolpyr_decarb indolepyruvate decarboxylase, Erwi 99.33
PRK05858542 hypothetical protein; Provisional 99.33
PRK07710571 acetolactate synthase catalytic subunit; Reviewed 99.32
PRK08611576 pyruvate oxidase; Provisional 99.32
cd02009175 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) fa 99.32
PRK07418616 acetolactate synthase 3 catalytic subunit; Reviewe 99.31
PRK08155564 acetolactate synthase catalytic subunit; Validated 99.31
PRK07789612 acetolactate synthase 1 catalytic subunit; Validat 99.3
PLN02573578 pyruvate decarboxylase 99.3
PRK08617552 acetolactate synthase; Reviewed 99.3
PRK06048561 acetolactate synthase 3 catalytic subunit; Reviewe 99.29
PRK06163202 hypothetical protein; Provisional 99.29
TIGR03254554 oxalate_oxc oxalyl-CoA decarboxylase. In a number 99.29
PRK11269591 glyoxylate carboligase; Provisional 99.29
PRK06546578 pyruvate dehydrogenase; Provisional 99.28
PRK08322547 acetolactate synthase; Reviewed 99.27
KOG4166|consensus675 99.27
TIGR00118558 acolac_lg acetolactate synthase, large subunit, bi 99.26
PRK06276586 acetolactate synthase catalytic subunit; Reviewed 99.25
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a se 99.24
KOG1684|consensus401 99.23
PRK06882574 acetolactate synthase 3 catalytic subunit; Validat 99.23
PRK09259569 putative oxalyl-CoA decarboxylase; Validated 99.23
PRK06112578 acetolactate synthase catalytic subunit; Validated 99.2
CHL00099585 ilvB acetohydroxyacid synthase large subunit 99.2
cd00394161 Clp_protease_like Caseinolytic protease (ClpP) is 99.18
TIGR03200360 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy 99.17
cd07016160 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- 99.17
PRK05980260 enoyl-CoA hydratase; Provisional 99.17
PLN02600251 enoyl-CoA hydratase 99.16
PRK08199557 thiamine pyrophosphate protein; Validated 99.16
PLN03214278 probable enoyl-CoA hydratase/isomerase; Provisiona 99.15
cd02001157 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) famil 99.14
PLN02664275 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA 99.13
PRK07658257 enoyl-CoA hydratase; Provisional 99.13
PRK06143256 enoyl-CoA hydratase; Provisional 99.12
PRK09076258 enoyl-CoA hydratase; Provisional 99.12
PRK08150255 enoyl-CoA hydratase; Provisional 99.12
KOG1680|consensus290 99.12
PRK07657260 enoyl-CoA hydratase; Provisional 99.12
cd03371188 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, Pp 99.11
PRK06142272 enoyl-CoA hydratase; Provisional 99.11
PRK09120275 p-hydroxycinnamoyl CoA hydratase/lyase; Validated 99.11
PRK07938249 enoyl-CoA hydratase; Provisional 99.11
PRK07511260 enoyl-CoA hydratase; Provisional 99.1
COG3961557 Pyruvate decarboxylase and related thiamine pyroph 99.1
PRK07524535 hypothetical protein; Provisional 99.1
PRK07854243 enoyl-CoA hydratase; Provisional 99.1
PRK07260255 enoyl-CoA hydratase; Provisional 99.09
PRK05862257 enoyl-CoA hydratase; Provisional 99.08
PRK05674265 gamma-carboxygeranoyl-CoA hydratase; Validated 99.08
PRK07092530 benzoylformate decarboxylase; Reviewed 99.07
PRK08258277 enoyl-CoA hydratase; Provisional 99.07
TIGR02280256 PaaB1 phenylacetate degradation probable enoyl-CoA 99.07
PRK08138261 enoyl-CoA hydratase; Provisional 99.07
PRK07449568 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1 99.06
PRK05809260 3-hydroxybutyryl-CoA dehydratase; Validated 99.06
PRK07468262 enoyl-CoA hydratase; Provisional 99.06
PRK06127269 enoyl-CoA hydratase; Provisional 99.06
PRK06495257 enoyl-CoA hydratase; Provisional 99.06
PRK07509262 enoyl-CoA hydratase; Provisional 99.06
PRK07659260 enoyl-CoA hydratase; Provisional 99.06
PRK08266542 hypothetical protein; Provisional 99.05
PRK08139266 enoyl-CoA hydratase; Validated 99.05
PRK09674255 enoyl-CoA hydratase-isomerase; Provisional 99.05
PRK07799263 enoyl-CoA hydratase; Provisional 99.05
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, 99.04
PRK03580261 carnitinyl-CoA dehydratase; Provisional 99.04
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA 99.04
PRK08140262 enoyl-CoA hydratase; Provisional 99.04
PRK09245266 enoyl-CoA hydratase; Provisional 99.04
PF00378245 ECH: Enoyl-CoA hydratase/isomerase family; InterPr 99.03
PRK06688259 enoyl-CoA hydratase; Provisional 99.03
TIGR01929259 menB naphthoate synthase (dihydroxynaphthoic acid 99.03
TIGR00705584 SppA_67K signal peptide peptidase SppA, 67K type. 99.02
PRK06494259 enoyl-CoA hydratase; Provisional 99.02
PRK06563255 enoyl-CoA hydratase; Provisional 99.02
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a 99.02
PRK08327569 acetolactate synthase catalytic subunit; Validated 99.02
PRK05981266 enoyl-CoA hydratase; Provisional 99.01
PRK05870249 enoyl-CoA hydratase; Provisional 99.01
TIGR03189251 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy 99.01
PRK07064544 hypothetical protein; Provisional 99.01
cd03372179 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE 98.99
COG1024257 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi 98.99
PRK05995262 enoyl-CoA hydratase; Provisional 98.99
KOG1679|consensus291 98.99
TIGR03210256 badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb 98.99
PRK07327268 enoyl-CoA hydratase; Provisional 98.99
PLN02888265 enoyl-CoA hydratase 98.99
PRK06210272 enoyl-CoA hydratase; Provisional 98.98
KOG1681|consensus292 98.97
TIGR03394535 indol_phenyl_DC indolepyruvate/phenylpyruvate deca 98.97
PRK11423261 methylmalonyl-CoA decarboxylase; Provisional 98.96
PRK08260296 enoyl-CoA hydratase; Provisional 98.95
PRK05864276 enoyl-CoA hydratase; Provisional 98.95
PRK06072248 enoyl-CoA hydratase; Provisional 98.95
PRK06023251 enoyl-CoA hydratase; Provisional 98.95
TIGR00706207 SppA_dom signal peptide peptidase SppA, 36K type. 98.95
TIGR03846181 sulfopy_beta sulfopyruvate decarboxylase, beta sub 98.94
PRK07396273 dihydroxynaphthoic acid synthetase; Validated 98.94
PRK06144262 enoyl-CoA hydratase; Provisional 98.93
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 98.92
PRK08252254 enoyl-CoA hydratase; Provisional 98.92
PRK07112255 polyketide biosynthesis enoyl-CoA hydratase; Valid 98.91
PRK07827260 enoyl-CoA hydratase; Provisional 98.91
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme fa 98.91
PLN02921327 naphthoate synthase 98.9
PF02775153 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-ter 98.89
cd07018222 S49_SppA_67K_type Signal peptide peptidase A (SppA 98.89
PRK08788287 enoyl-CoA hydratase; Validated 98.89
PRK07110249 polyketide biosynthesis enoyl-CoA hydratase; Valid 98.86
PRK05617342 3-hydroxyisobutyryl-CoA hydrolase; Provisional 98.86
COG0447282 MenB Dihydroxynaphthoic acid synthase [Coenzyme me 98.86
PRK08321302 naphthoate synthase; Validated 98.85
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 98.84
PRK05869222 enoyl-CoA hydratase; Validated 98.83
TIGR03297361 Ppyr-DeCO2ase phosphonopyruvate decarboxylase. Thi 98.82
PRK06190258 enoyl-CoA hydratase; Provisional 98.82
PRK12478298 enoyl-CoA hydratase; Provisional 98.8
PRK08259254 enoyl-CoA hydratase; Provisional 98.8
PRK11730 715 fadB multifunctional fatty acid oxidation complex 98.79
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 98.74
cd02018237 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyru 98.73
PRK08272302 enoyl-CoA hydratase; Provisional 98.72
PLN02874 379 3-hydroxyisobutyryl-CoA hydrolase-like protein 98.71
cd03376235 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP fam 98.7
cd07021178 Clp_protease_NfeD_like Nodulation formation effici 98.69
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 98.67
PRK06213229 enoyl-CoA hydratase; Provisional 98.66
cd03375193 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-o 98.64
PRK08290288 enoyl-CoA hydratase; Provisional 98.58
PLN02267239 enoyl-CoA hydratase/isomerase family protein 98.58
COG3960592 Glyoxylate carboligase [General function predictio 98.57
PRK05778301 2-oxoglutarate ferredoxin oxidoreductase subunit b 98.54
cd06558195 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy 98.48
PRK09628277 oorB 2-oxoglutarate-acceptor oxidoreductase subuni 98.44
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 98.4
PRK11867286 2-oxoglutarate ferredoxin oxidoreductase subunit b 98.31
cd07015172 Clp_protease_NfeD Nodulation formation efficiency 98.3
PRK11866279 2-oxoacid ferredoxin oxidoreductase subunit beta; 98.27
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 98.27
KOG1184|consensus561 98.21
TIGR02177287 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta 98.14
PRK12319256 acetyl-CoA carboxylase subunit alpha; Provisional 98.14
PRK11869280 2-oxoacid ferredoxin oxidoreductase subunit beta; 98.04
PRK05724319 acetyl-CoA carboxylase carboxyltransferase subunit 98.0
COG3962617 Acetolactate synthase [Amino acid transport and me 97.99
PLN03230431 acetyl-coenzyme A carboxylase carboxyl transferase 97.96
CHL00198322 accA acetyl-CoA carboxylase carboxyltransferase al 97.94
TIGR00513316 accA acetyl-CoA carboxylase, carboxyl transferase, 97.94
cd07020187 Clp_protease_NfeD_1 Nodulation formation efficienc 97.86
PLN03229 762 acetyl-coenzyme A carboxylase carboxyl transferase 97.82
TIGR00173432 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex 97.81
KOG1682|consensus287 97.79
cd07013162 S14_ClpP Caseinolytic protease (ClpP) is an ATP-de 97.76
PRK10949618 protease 4; Provisional 97.74
KOG0016|consensus266 97.68
PRK00277200 clpP ATP-dependent Clp protease proteolytic subuni 97.58
PRK14512197 ATP-dependent Clp protease proteolytic subunit; Pr 97.58
PRK12553207 ATP-dependent Clp protease proteolytic subunit; Re 97.55
cd07017171 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP- 97.42
TIGR03133274 malonate_beta malonate decarboxylase, beta subunit 97.25
PF01972285 SDH_sah: Serine dehydrogenase proteinase; InterPro 97.18
PF00574182 CLP_protease: Clp protease; InterPro: IPR001907 In 97.17
PRK05654292 acetyl-CoA carboxylase subunit beta; Validated 97.16
TIGR00515285 accD acetyl-CoA carboxylase, carboxyl transferase, 97.12
PF01343154 Peptidase_S49: Peptidase family S49 peptidase clas 97.1
COG0777294 AccD Acetyl-CoA carboxylase beta subunit [Lipid me 97.09
PRK14514221 ATP-dependent Clp protease proteolytic subunit; Pr 97.07
CHL00174296 accD acetyl-CoA carboxylase beta subunit; Reviewed 97.07
CHL00028200 clpP ATP-dependent Clp protease proteolytic subuni 97.07
PRK07189301 malonate decarboxylase subunit beta; Reviewed 97.02
TIGR00493191 clpP ATP-dependent Clp protease, proteolytic subun 96.95
PRK11778330 putative inner membrane peptidase; Provisional 96.92
PRK12551196 ATP-dependent Clp protease proteolytic subunit; Re 96.92
PRK14513201 ATP-dependent Clp protease proteolytic subunit; Pr 96.87
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptid 96.76
COG0825317 AccA Acetyl-CoA carboxylase alpha subunit [Lipid m 96.69
KOG1683|consensus380 96.64
TIGR01117512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 96.55
cd07016160 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- 96.51
TIGR03134238 malonate_gamma malonate decarboxylase, gamma subun 96.37
COG1030 436 NfeD Membrane-bound serine protease (ClpP class) [ 96.23
CHL00149341 odpA pyruvate dehydrogenase E1 component alpha sub 96.23
PRK12552222 ATP-dependent Clp protease-like protein; Reviewed 96.22
TIGR01117 512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 96.21
COG0616317 SppA Periplasmic serine proteases (ClpP class) [Po 96.12
COG0740200 ClpP Protease subunit of ATP-dependent Clp proteas 96.11
cd07021178 Clp_protease_NfeD_like Nodulation formation effici 96.03
PF01039 493 Carboxyl_trans: Carboxyl transferase domain; Inter 95.93
TIGR00705 584 SppA_67K signal peptide peptidase SppA, 67K type. 95.73
TIGR03181341 PDH_E1_alph_x pyruvate dehydrogenase E1 component, 95.5
TIGR03182315 PDH_E1_alph_y pyruvate dehydrogenase E1 component, 95.45
cd02012255 TPP_TK Thiamine pyrophosphate (TPP) family, Transk 95.23
PRK10949 618 protease 4; Provisional 94.77
cd02007195 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS s 94.52
PLN02820 569 3-methylcrotonyl-CoA carboxylase, beta chain 94.51
cd02000293 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) 94.45
PLN02820569 3-methylcrotonyl-CoA carboxylase, beta chain 94.26
COG4799 526 Acetyl-CoA carboxylase, carboxyltransferase compon 93.81
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a 92.16
PRK05899 624 transketolase; Reviewed 91.88
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a se 91.83
PF01039493 Carboxyl_trans: Carboxyl transferase domain; Inter 91.82
PRK11865299 pyruvate ferredoxin oxidoreductase subunit beta; P 91.23
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA 89.9
PLN02374433 pyruvate dehydrogenase (acetyl-transferring) 89.55
PF13766118 ECH_C: 2-enoyl-CoA Hydratase C-terminal region; PD 88.65
PRK05444 580 1-deoxy-D-xylulose-5-phosphate synthase; Provision 86.33
PF06833234 MdcE: Malonate decarboxylase gamma subunit (MdcE); 85.6
PRK11864300 2-ketoisovalerate ferredoxin oxidoreductase subuni 85.03
PRK07189301 malonate decarboxylase subunit beta; Reviewed 84.76
TIGR03133274 malonate_beta malonate decarboxylase, beta subunit 83.49
COG0777294 AccD Acetyl-CoA carboxylase beta subunit [Lipid me 82.54
cd07013162 S14_ClpP Caseinolytic protease (ClpP) is an ATP-de 82.15
COG0616317 SppA Periplasmic serine proteases (ClpP class) [Po 81.58
TIGR00706207 SppA_dom signal peptide peptidase SppA, 36K type. 81.13
>KOG1680|consensus Back     alignment and domain information
Probab=100.00  E-value=2e-43  Score=291.17  Aligned_cols=209  Identities=26%  Similarity=0.284  Sum_probs=186.1

Q ss_pred             hhhhhhccCCCcccccCCCCccccchHHHHHHHHHHhhhcCCCCeEEEEEcCCCccccchhhhHHhhhccCchhHHHHHH
Q psy12573         38 IGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLAVDKEGRPKLDEIFS  117 (315)
Q Consensus        38 ~~~~~l~~~~~~n~~~~~~~~~mg~~~~~~l~~~l~~~~~d~~~~vvvl~g~g~~~~aG~Dl~~~~~~~~~~~~~~~~~~  117 (315)
                      |+.||||||+.+|++++.+.        .+|.+++..+++|+.+.++||||.|+.||+|.||+++......         
T Consensus        47 I~lItlNRP~~~Nal~~~~m--------~eL~~A~~~~e~D~s~~viVltG~gksFcsG~Dl~e~~~~~~~---------  109 (290)
T KOG1680|consen   47 IALITLNRPKALNALCRATM--------LELAEAFKDFESDDSVGVIVLTGSGKSFCSGADLKEMKKDEFQ---------  109 (290)
T ss_pred             eEEEEeCChHHhccccHHHH--------HHHHHHHHHhhccCcccEEEEEcCCCccccccCHHHHhhcccc---------
Confidence            89999999999999999887        9999999999999999999999999999999999988541100         


Q ss_pred             HHHHHHHHHHcCCCcEEEEEeeEEecccchhccccChhhhhhhcCCCCcchhhHHHHHHHHHHHHhcCCCcEEEEEcccc
Q psy12573        118 TCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGYNILVSTCSDLMLSILRHPVPILAIISGVA  197 (315)
Q Consensus       118 ~~~~~~~~~~~~~~~~i~~v~G~~~g~G~~f~~g~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~kpvIa~v~G~~  197 (315)
                                                         |..   ..         .+    ...+..+.+.+||+|++++|+|
T Consensus       110 -----------------------------------~~~---~~---------~~----~~~~~~~~~~~KPvIaainG~A  138 (290)
T KOG1680|consen  110 -----------------------------------DVS---DG---------IF----LRVWDLVSRLKKPVIAAINGFA  138 (290)
T ss_pred             -----------------------------------ccc---cc---------cc----cchhhhhhhcccceeEeeecee
Confidence                                               000   00         00    1122334489999999999999


Q ss_pred             chhhhHHHhhcCeeeeeCCceeeCCCccCCCCCCc-hHHHHhhhcCHHHHHHHHhcCCCCCHHHHHHcCccccccCCchH
Q psy12573        198 AAAGCQLVATCDLAIATTASKFSTPGARHGIFCST-PAVALTRKVPLGVVRSMTITGIPISAQDAYNAGLITRVVSSNEE  276 (315)
Q Consensus       198 ~g~G~~l~l~~d~~~a~~~a~~~~pe~~~Gl~~~~-~~~~l~~~~g~~~a~~~~~~g~~~~a~~a~~~Glv~~v~~~~~~  276 (315)
                      +|||++|++.||++++++.++|++|+.++|++|.+ ++.+|++.+|.++|++++++|++++++||.++|+|++|+|. ++
T Consensus       139 lgGG~ELalmCDirva~~~Akfg~~~~~~Gi~p~~GGT~rl~r~vG~s~Ale~~ltg~~~~AqeA~~~GlVn~Vvp~-~~  217 (290)
T KOG1680|consen  139 LGGGLELALMCDIRVAGEGAKFGFFEIRMGIIPSWGGTQRLPRIVGKSRALEMILTGRRLGAQEAKKIGLVNKVVPS-GD  217 (290)
T ss_pred             eccchhhhhhcceEeccCCCeecccccccCCccCCCchhhHHHHhChHHHHHHHHhcCcccHHHHHhCCceeEeecc-hh
Confidence            99999999999999999999999999999999998 45899999999999999999999999999999999999999 99


Q ss_pred             HHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhCCChhhhC
Q psy12573        277 LESETKVLTSAILENSRSVLTLGKQFLYQQMSLNIEEAY  315 (315)
Q Consensus       277 ~~~~~~~~~~~l~~~~~~a~~~~k~~l~~~~~~~l~~~l  315 (315)
                      +.+++.+++++|++.||..++..|+.++.+.+.++.++|
T Consensus       218 ~l~eAv~l~~~Ia~~~~~~v~~~K~svn~~~e~~l~e~l  256 (290)
T KOG1680|consen  218 ALGEAVKLAEQIAKNSPLVVRADKESVNAAYETTLFEGL  256 (290)
T ss_pred             HHHHHHHHHHHHHhCCHHHHHHHHHHHHHHhhccHHHHH
Confidence            999999999999999999999999999999998887764



>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06190 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05862 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02600 enoyl-CoA hydratase Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05980 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09674 enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>PRK06127 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05869 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>PRK06563 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>PRK07657 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08140 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06144 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02888 enoyl-CoA hydratase Back     alignment and domain information
>PRK07511 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>PRK06494 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07468 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07658 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06023 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07799 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08259 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08258 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08252 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05864 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05870 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07327 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK03580 carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06688 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07659 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK06210 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07938 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08290 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07396 dihydroxynaphthoic acid synthetase; Validated Back     alignment and domain information
>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>PRK11423 methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>PRK08260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK12478 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>PRK07509 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>PLN02921 naphthoate synthase Back     alignment and domain information
>PRK08272 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06072 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix Back     alignment and domain information
>PRK07827 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06213 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>KOG1681|consensus Back     alignment and domain information
>PRK08321 naphthoate synthase; Validated Back     alignment and domain information
>PRK07854 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK08788 enoyl-CoA hydratase; Validated Back     alignment and domain information
>TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>PLN02267 enoyl-CoA hydratase/isomerase family protein Back     alignment and domain information
>PLN02988 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>KOG1679|consensus Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>KOG0016|consensus Back     alignment and domain information
>COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>KOG1682|consensus Back     alignment and domain information
>KOG1684|consensus Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK08273 thiamine pyrophosphate protein; Provisional Back     alignment and domain information
>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PLN02988 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>KOG1185|consensus Back     alignment and domain information
>PRK12474 hypothetical protein; Provisional Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PLN02470 acetolactate synthase Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK06965 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR02720 pyruv_oxi_spxB pyruvate oxidase Back     alignment and domain information
>PRK06457 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>TIGR02418 acolac_catab acetolactate synthase, catabolic Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK07586 hypothetical protein; Validated Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>PRK07710 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>PRK08611 pyruvate oxidase; Provisional Back     alignment and domain information
>cd02009 TPP_SHCHC_synthase Thiamine pyrophosphate (TPP) family, SHCHC synthase subfamily, TPP-binding module; composed of proteins similar to Escherichia coli 2-succinyl-6-hydroxyl-2,4-cyclohexadiene-1-carboxylic acid (SHCHC) synthase (also called MenD) Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK08155 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PLN02573 pyruvate decarboxylase Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK06048 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK06163 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03254 oxalate_oxc oxalyl-CoA decarboxylase Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>KOG4166|consensus Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>KOG1684|consensus Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>PRK05980 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02600 enoyl-CoA hydratase Back     alignment and domain information
>PRK08199 thiamine pyrophosphate protein; Validated Back     alignment and domain information
>PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional Back     alignment and domain information
>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase) Back     alignment and domain information
>PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>PRK07658 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>KOG1680|consensus Back     alignment and domain information
>PRK07657 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>PRK07938 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07511 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>COG3961 Pyruvate decarboxylase and related thiamine pyrophosphate-requiring enzymes [Carbohydrate transport and metabolism / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PRK07854 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05862 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07092 benzoylformate decarboxylase; Reviewed Back     alignment and domain information
>PRK08258 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07449 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase; Validated Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>PRK07468 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06127 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07509 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07659 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK09674 enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>PRK07799 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>PRK03580 carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>PRK08140 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix Back     alignment and domain information
>PRK06688 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>PRK06494 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06563 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05870 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>cd03372 TPP_ComE Thiamine pyrophosphate (TPP) family, ComE subfamily, TPP-binding module; composed of proteins similar to Methanococcus jannaschii sulfopyruvate decarboxylase beta subunit (ComE) Back     alignment and domain information
>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>KOG1679|consensus Back     alignment and domain information
>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>PRK07327 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02888 enoyl-CoA hydratase Back     alignment and domain information
>PRK06210 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>KOG1681|consensus Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>PRK11423 methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>PRK08260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05864 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06072 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06023 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type Back     alignment and domain information
>TIGR03846 sulfopy_beta sulfopyruvate decarboxylase, beta subunit Back     alignment and domain information
>PRK07396 dihydroxynaphthoic acid synthetase; Validated Back     alignment and domain information
>PRK06144 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK08252 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07827 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>PLN02921 naphthoate synthase Back     alignment and domain information
>PF02775 TPP_enzyme_C: Thiamine pyrophosphate enzyme, C-terminal TPP binding domain; InterPro: IPR011766 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>PRK08788 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK08321 naphthoate synthase; Validated Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK05869 enoyl-CoA hydratase; Validated Back     alignment and domain information
>TIGR03297 Ppyr-DeCO2ase phosphonopyruvate decarboxylase Back     alignment and domain information
>PRK06190 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK12478 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08259 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>cd02018 TPP_PFOR Thiamine pyrophosphate (TPP family), Pyruvate ferredoxin/flavodoxin oxidoreductase (PFOR) subfamily, TPP-binding module; PFOR catalyzes the oxidative decarboxylation of pyruvate to form acetyl-CoA, a crucial step in many metabolic pathways Back     alignment and domain information
>PRK08272 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>cd03376 TPP_PFOR_porB_like Thiamine pyrophosphate (TPP family), PFOR porB-like subfamily, TPP-binding module; composed of proteins similar to the beta subunit (porB) of the Helicobacter pylori four-subunit pyruvate ferredoxin oxidoreductase (PFOR), which are also found in archaea and some hyperthermophilic bacteria Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PRK06213 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd03375 TPP_OGFOR Thiamine pyrophosphate (TPP family), 2-oxoglutarate ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding module; OGFOR catalyzes the oxidative decarboxylation of 2-oxo-acids, with ferredoxin acting as an electron acceptor Back     alignment and domain information
>PRK08290 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02267 enoyl-CoA hydratase/isomerase family protein Back     alignment and domain information
>COG3960 Glyoxylate carboligase [General function prediction only] Back     alignment and domain information
>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated Back     alignment and domain information
>cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PRK11867 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Reviewed Back     alignment and domain information
>cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>PRK11866 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>KOG1184|consensus Back     alignment and domain information
>TIGR02177 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional Back     alignment and domain information
>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Back     alignment and domain information
>COG3962 Acetolactate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional Back     alignment and domain information
>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Back     alignment and domain information
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit Back     alignment and domain information
>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase Back     alignment and domain information
>KOG1682|consensus Back     alignment and domain information
>cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>KOG0016|consensus Back     alignment and domain information
>PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK14512 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>cd07017 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>TIGR03133 malonate_beta malonate decarboxylase, beta subunit Back     alignment and domain information
>PF01972 SDH_sah: Serine dehydrogenase proteinase; InterPro: IPR002825 This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily Back     alignment and domain information
>PF00574 CLP_protease: Clp protease; InterPro: IPR001907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit Back     alignment and domain information
>PF01343 Peptidase_S49: Peptidase family S49 peptidase classification Back     alignment and domain information
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>PRK14514 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>CHL00028 clpP ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>PRK07189 malonate decarboxylase subunit beta; Reviewed Back     alignment and domain information
>TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP Back     alignment and domain information
>PRK11778 putative inner membrane peptidase; Provisional Back     alignment and domain information
>PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK14513 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] Back     alignment and domain information
>KOG1683|consensus Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit Back     alignment and domain information
>COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>PRK12552 ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>cd02012 TPP_TK Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>cd02007 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>PRK11865 pyruvate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>PLN02374 pyruvate dehydrogenase (acetyl-transferring) Back     alignment and domain information
>PF13766 ECH_C: 2-enoyl-CoA Hydratase C-terminal region; PDB: 3JU1_A 3BPT_A Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PF06833 MdcE: Malonate decarboxylase gamma subunit (MdcE); InterPro: IPR009648 This family consists of several bacterial malonate decarboxylase gamma subunit proteins Back     alignment and domain information
>PRK11864 2-ketoisovalerate ferredoxin oxidoreductase subunit beta; Provisional Back     alignment and domain information
>PRK07189 malonate decarboxylase subunit beta; Reviewed Back     alignment and domain information
>TIGR03133 malonate_beta malonate decarboxylase, beta subunit Back     alignment and domain information
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
2vx2_A287 Crystal Structure Of Human Enoyl Coenzyme A Hydrata 1e-33
3myb_A286 Crystal Structure Of Enoyl-Coa Hydratase Mycobacter 3e-32
3l3s_A263 Crystal Structure Of An Enoyl-Coa HydrotaseISOMERAS 7e-19
2q27_A564 Crystal Structure Of Oxalyl-Coa Decarboxylase From 1e-13
3pe8_A256 Crystal Structure Of Enoyl-Coa Hydratase From Mycob 6e-13
3trr_A256 Crystal Structure Of A Probable Enoyl-Coa Hydratase 1e-11
3qyr_A253 Crystal Structure Of Enoyl-Coa Hydratase Echa16_2 M 7e-11
3p85_A270 Crystal Structure Enoyl-Coa Hydratase From Mycobact 8e-11
2c31_A568 Crystal Structure Of Oxalyl-Coa Decarboxylase In Co 1e-10
3q0j_A258 Crystal Structure Of The Mycobacterium Tuberculosis 4e-09
3h81_A278 Crystal Structure Of Enoyl-Coa Hydratase From Mycob 4e-09
3pzk_A257 Crystal Structure Of The Mycobacterium Tuberculosis 4e-09
1ey3_A258 Structure Of Enoyl-Coa Hydratase Complexed With The 5e-09
1dub_A261 2-Enoyl-Coa Hydratase, Data Collected At 100 K, Ph 6e-09
1mj3_A260 Crystal Structure Analysis Of Rat Enoyl-Coa Hydrata 6e-09
2hw5_A286 The Crystal Structure Of Human Enoyl-Coenzyme A (Co 2e-08
4fzw_A258 Crystal Structure Of The Paaf-paag Hydratase-isomer 5e-08
3rsi_A265 The Structure Of A Putative Enoyl-Coa HydrataseISOM 2e-07
1uiy_A253 Crystal Structure Of Enoyl-Coa Hydratase From Therm 2e-07
3moy_A263 Crystal Structure Of Probable Enoyl-Coa Hydratase F 4e-07
3p5m_A255 Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS 5e-07
2iex_A272 Crystal Structure Of Dihydroxynapthoic Acid Synthet 7e-07
2pbp_A258 Crystal Structure Of Enoyl-Coa Hydrates Subunit I ( 8e-07
4f47_A278 The Structure Of Enoyl-Coa Hydratase Echa19 From My 1e-06
1ef8_A261 Crystal Structure Of Methylmalonyl Coa Decarboxylas 1e-06
3tlf_A274 Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS 2e-06
3r0o_A273 Crystal Structure Of Carnitinyl-Coa Hydratase From 3e-06
3r9q_A262 Structure Of A Probable Enoyl-Coa HydrataseISOMERAS 3e-06
3sll_A290 Crystal Structure Of A Probable Enoyl-Coa Hydratase 4e-06
3hrx_A254 Crystal Structure Of Phenylacetic Acid Degradation 5e-06
3r9t_A267 Structure Of Echa1_1 From Mycobacterium Paratubercu 6e-06
3r9s_A267 Structure Of A Carnitinyl-Coa Dehydratase From Myco 6e-06
2uzf_A273 Crystal Structure Of Staphylococcus Aureus 1,4-Dihy 2e-05
3oc7_A267 Crystal Structure Of An Enoyl-Coa Hydratase From My 2e-05
3bpt_A 363 Crystal Structure Of Human Beta-Hydroxyisobutyryl-C 2e-05
1jxz_A269 Structure Of The H90q Mutant Of 4-Chlorobenzoyl-Coe 3e-05
1nzy_A269 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudo 4e-05
1nzy_B269 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudo 5e-05
3he2_A264 Crystal Structure Of Enoyl-Coa Hydratase From Mycob 5e-05
3kqf_A265 1.8 Angstrom Resolution Crystal Structure Of Enoyl- 5e-05
2pg8_A417 Crystal Structure Of R254k Mutanat Of Dpgc With Bou 7e-05
2np9_A440 Crystal Structure Of A Dioxygenase In The Crotonase 7e-05
3ome_A282 Crystal Structure Of A Probable Enoyl-Coa Hydratase 1e-04
3qka_A261 Crystal Structure Of Enoyl-Coa Hydratase Echa5 From 1e-04
3t88_A289 Crystal Structure Of Escherichia Coli Menb In Compl 1e-04
4els_A285 Structure Of E. Coli. 1,4-Dihydroxy-2- Naphthoyl Co 1e-04
3h02_A288 2.15 Angstrom Resolution Crystal Structure Of Napht 2e-04
3lke_A263 Crystal Structure Of Enoyl-Coa Hydratase From Bacil 2e-04
>pdb|2VX2|A Chain A, Crystal Structure Of Human Enoyl Coenzyme A Hydratase Domain-Containing Protein 3 (Echdc3) Length = 287 Back     alignment and structure

Iteration: 1

Score = 140 bits (352), Expect = 1e-33, Method: Compositional matrix adjust. Identities = 70/145 (48%), Positives = 97/145 (66%), Gaps = 1/145 (0%) Query: 171 LVSTCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGARHGIFC 230 + TCS +M+ I HPVP++A+++G+A AAGCQLVA+CD+A+A+ S F+TPG G+FC Sbjct: 111 VFQTCSKVMMHIRNHPVPVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFC 170 Query: 231 STPAVALTRKVPLGVVRSMTITGIPISAQDAYNAGLITRVVSSNEELESETKVLTSAILE 290 STP VAL R VP V M TG PISAQ+A GL+++VV EL+ ET + I Sbjct: 171 STPGVALARAVPRKVALEMLFTGEPISAQEALLHGLLSKVV-PEAELQEETMRIARKIAS 229 Query: 291 NSRSVLTLGKQFLYQQMSLNIEEAY 315 SR V++LGK Y+Q+ ++ AY Sbjct: 230 LSRPVVSLGKATFYKQLPQDLGTAY 254
>pdb|3MYB|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Mycobacterium Smegm Length = 286 Back     alignment and structure
>pdb|3L3S|A Chain A, Crystal Structure Of An Enoyl-Coa HydrotaseISOMERASE FAMILY Protein From Silicibacter Pomeroyi Length = 263 Back     alignment and structure
>pdb|2Q27|A Chain A, Crystal Structure Of Oxalyl-Coa Decarboxylase From Escherichia Coli Length = 564 Back     alignment and structure
>pdb|3PE8|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Smegmatis Length = 256 Back     alignment and structure
>pdb|3TRR|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 256 Back     alignment and structure
>pdb|3QYR|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa16_2 Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 253 Back     alignment and structure
>pdb|3P85|A Chain A, Crystal Structure Enoyl-Coa Hydratase From Mycobacterium Avium Length = 270 Back     alignment and structure
>pdb|2C31|A Chain A, Crystal Structure Of Oxalyl-Coa Decarboxylase In Complex With The Cofactor Derivative Thiamin-2-Thiazolone Diphosphate And Adenosine Diphosphate Length = 568 Back     alignment and structure
>pdb|3Q0J|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Crotonase In Complex With The Inhibitor Acetoacetylcoa Length = 258 Back     alignment and structure
>pdb|3H81|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Tuberculosis Length = 278 Back     alignment and structure
>pdb|3PZK|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Crotonase In Apo Form Length = 257 Back     alignment and structure
>pdb|1EY3|A Chain A, Structure Of Enoyl-Coa Hydratase Complexed With The Substrate Dac-Coa Length = 258 Back     alignment and structure
>pdb|1DUB|A Chain A, 2-Enoyl-Coa Hydratase, Data Collected At 100 K, Ph 6.5 Length = 261 Back     alignment and structure
>pdb|1MJ3|A Chain A, Crystal Structure Analysis Of Rat Enoyl-Coa Hydratase In Complex With Hexadienoyl-Coa Length = 260 Back     alignment and structure
>pdb|2HW5|A Chain A, The Crystal Structure Of Human Enoyl-Coenzyme A (Coa) Hydratase Short Chain 1, Echs1 Length = 286 Back     alignment and structure
>pdb|4FZW|A Chain A, Crystal Structure Of The Paaf-paag Hydratase-isomerase Complex From E.coli Length = 258 Back     alignment and structure
>pdb|3RSI|A Chain A, The Structure Of A Putative Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Atcc 19977 DSM 44196 Length = 265 Back     alignment and structure
>pdb|1UIY|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Thermus Thermophilus Hb8 Length = 253 Back     alignment and structure
>pdb|3MOY|A Chain A, Crystal Structure Of Probable Enoyl-Coa Hydratase From Mycob Smegmatis Length = 263 Back     alignment and structure
>pdb|3P5M|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Avium Length = 255 Back     alignment and structure
>pdb|2IEX|A Chain A, Crystal Structure Of Dihydroxynapthoic Acid Synthetase (Gk2873) From Geobacillus Kaustophilus Hta426 Length = 272 Back     alignment and structure
>pdb|2PBP|A Chain A, Crystal Structure Of Enoyl-Coa Hydrates Subunit I (Gk_2039) From Geobacillus Kaustophilus Hta426 Length = 258 Back     alignment and structure
>pdb|4F47|A Chain A, The Structure Of Enoyl-Coa Hydratase Echa19 From Mycobacterium Marinum Length = 278 Back     alignment and structure
>pdb|1EF8|A Chain A, Crystal Structure Of Methylmalonyl Coa Decarboxylase Length = 261 Back     alignment and structure
>pdb|3TLF|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Paratuberculosis Length = 274 Back     alignment and structure
>pdb|3R0O|A Chain A, Crystal Structure Of Carnitinyl-Coa Hydratase From Mycobacterium Avium Length = 273 Back     alignment and structure
>pdb|3R9Q|A Chain A, Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Atcc 19977 DSM 44196 Length = 262 Back     alignment and structure
>pdb|3SLL|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 290 Back     alignment and structure
>pdb|3HRX|A Chain A, Crystal Structure Of Phenylacetic Acid Degradation Protein Paag Length = 254 Back     alignment and structure
>pdb|3R9T|A Chain A, Structure Of Echa1_1 From Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 267 Back     alignment and structure
>pdb|3R9S|A Chain A, Structure Of A Carnitinyl-Coa Dehydratase From Mycobacterium Avium 104 Length = 267 Back     alignment and structure
>pdb|2UZF|A Chain A, Crystal Structure Of Staphylococcus Aureus 1,4-Dihydroxy-2- Naphthoyl Coa Synthase (Menb) In Complex With Acetoacetyl Coa Length = 273 Back     alignment and structure
>pdb|3OC7|A Chain A, Crystal Structure Of An Enoyl-Coa Hydratase From Mycobacterium Avium Length = 267 Back     alignment and structure
>pdb|3BPT|A Chain A, Crystal Structure Of Human Beta-Hydroxyisobutyryl-Coa Hydrolase In Complex With Quercetin Length = 363 Back     alignment and structure
>pdb|1JXZ|A Chain A, Structure Of The H90q Mutant Of 4-Chlorobenzoyl-Coenzyme A Dehalogenase Complexed With 4-Hydroxybenzoyl-Coenzyme A (Product) Length = 269 Back     alignment and structure
>pdb|1NZY|A Chain A, 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudomonas Sp. Strain Cbs-3 Length = 269 Back     alignment and structure
>pdb|1NZY|B Chain B, 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudomonas Sp. Strain Cbs-3 Length = 269 Back     alignment and structure
>pdb|3HE2|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Tuberculosis Length = 264 Back     alignment and structure
>pdb|3KQF|A Chain A, 1.8 Angstrom Resolution Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Anthracis. Length = 265 Back     alignment and structure
>pdb|2PG8|A Chain A, Crystal Structure Of R254k Mutanat Of Dpgc With Bound Substrate Analog Length = 417 Back     alignment and structure
>pdb|2NP9|A Chain A, Crystal Structure Of A Dioxygenase In The Crotonase Superfamily Length = 440 Back     alignment and structure
>pdb|3OME|A Chain A, Crystal Structure Of A Probable Enoyl-Coa Hydratase From Mycobacterium Smegmatis Length = 282 Back     alignment and structure
>pdb|3QKA|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa5 From Mycobacterium Marinum Length = 261 Back     alignment and structure
>pdb|3T88|A Chain A, Crystal Structure Of Escherichia Coli Menb In Complex With Substrate Analogue, Osb-Ncoa Length = 289 Back     alignment and structure
>pdb|4ELS|A Chain A, Structure Of E. Coli. 1,4-Dihydroxy-2- Naphthoyl Coenzyme A Synthases (Menb) In Complex With Bicarbonate Length = 285 Back     alignment and structure
>pdb|3H02|A Chain A, 2.15 Angstrom Resolution Crystal Structure Of Naphthoate Synthase From Salmonella Typhimurium. Length = 288 Back     alignment and structure
>pdb|3LKE|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Halodurans Length = 263 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 2e-50
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 1e-49
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 2e-48
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 1e-36
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 4e-36
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 2e-33
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 4e-26
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 1e-08
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 4e-25
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 3e-23
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 2e-07
3t3w_A279 Probable enoyl-COA hydratase; ssgcid, structural g 5e-22
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 9e-22
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 2e-21
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 3e-21
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 8e-20
3lke_A263 Enoyl-COA hydratase; nysgrc, target 11251J, struct 9e-20
3lke_A263 Enoyl-COA hydratase; nysgrc, target 11251J, struct 3e-06
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 1e-19
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 1e-07
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 2e-19
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 5e-19
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 5e-06
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 6e-19
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 9e-06
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 1e-18
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 7e-07
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 1e-18
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 3e-18
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 2e-07
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 6e-18
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 1e-05
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 7e-18
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 4e-06
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 7e-18
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 5e-04
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 1e-17
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 1e-17
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 2e-06
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 2e-17
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 2e-17
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 3e-17
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 2e-07
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 3e-17
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 3e-17
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 5e-17
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 4e-05
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 6e-17
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 7e-06
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 6e-17
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 4e-05
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 8e-17
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 8e-17
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 2e-05
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 1e-16
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 9e-08
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 1e-16
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 1e-16
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 1e-06
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 1e-16
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 1e-06
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 2e-16
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 2e-16
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 3e-16
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 4e-16
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 7e-16
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 1e-15
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 3e-05
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 2e-15
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 3e-15
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 3e-15
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 4e-15
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 8e-04
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 5e-15
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 5e-15
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 8e-15
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 1e-14
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 3e-14
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 8e-14
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 1e-13
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 2e-13
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 2e-13
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 3e-13
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 7e-13
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 8e-13
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 9e-13
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 2e-12
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 4e-12
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 7e-12
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 2e-11
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 4e-11
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 5e-11
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 1e-07
1v5e_A590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 1e-07
3bpt_A 363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 1e-06
3ju1_A 407 Enoyl-COA hydratase/isomerase family protein; alph 2e-06
4feg_A603 Pyruvate oxidase; carbanion, structure activity re 2e-05
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 2e-05
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 3e-05
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 5e-05
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 5e-05
2pan_A616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 6e-05
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 9e-05
2pgn_A589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 1e-04
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 1e-04
1t9b_A677 Acetolactate synthase, mitochondrial; acetohydroxy 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 2e-04
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 4e-04
3viv_A230 441AA long hypothetical NFED protein; protein-pept 6e-04
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 6e-04
1ybh_A590 Acetolactate synthase, chloroplast; acetohydroxyac 7e-04
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Length = 287 Back     alignment and structure
 Score =  167 bits (426), Expect = 2e-50
 Identities = 70/148 (47%), Positives = 98/148 (66%), Gaps = 1/148 (0%)

Query: 168 YNILVSTCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGARHG 227
           +  +  TCS +M+ I  HPVP++A+++G+A AAGCQLVA+CD+A+A+  S F+TPG   G
Sbjct: 108 HAEVFQTCSKVMMHIRNHPVPVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVG 167

Query: 228 IFCSTPAVALTRKVPLGVVRSMTITGIPISAQDAYNAGLITRVVSSNEELESETKVLTSA 287
           +FCSTP VAL R VP  V   M  TG PISAQ+A   GL+++VV    EL+ ET  +   
Sbjct: 168 LFCSTPGVALARAVPRKVALEMLFTGEPISAQEALLHGLLSKVVPE-AELQEETMRIARK 226

Query: 288 ILENSRSVLTLGKQFLYQQMSLNIEEAY 315
           I   SR V++LGK   Y+Q+  ++  AY
Sbjct: 227 IASLSRPVVSLGKATFYKQLPQDLGTAY 254


>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Length = 286 Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Length = 263 Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} Length = 267 Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} Length = 268 Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Length = 267 Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Length = 254 Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Length = 254 Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Length = 253 Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Length = 333 Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Length = 333 Back     alignment and structure
>3t3w_A Probable enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Length = 279 Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Length = 568 Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Length = 564 Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Length = 334 Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} Length = 274 Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 11251J, structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Length = 263 Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 11251J, structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Length = 263 Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Length = 279 Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Length = 279 Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Length = 243 Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Length = 291 Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Length = 291 Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Length = 261 Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Length = 261 Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Length = 280 Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Length = 280 Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Length = 290 Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Length = 276 Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Length = 276 Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Length = 257 Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Length = 257 Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Length = 256 Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Length = 256 Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Length = 256 Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Length = 255 Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Length = 255 Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Length = 232 Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Length = 273 Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Length = 264 Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Length = 264 Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Length = 262 Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Length = 275 Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} Length = 233 Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} Length = 233 Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Length = 269 Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Length = 269 Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 3h02_A 2iex_A Length = 289 Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Length = 298 Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Length = 298 Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Length = 266 Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Length = 266 Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Length = 265 Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Length = 280 Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Length = 280 Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} PDB: 3q1t_A Length = 272 Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} PDB: 3q1t_A Length = 272 Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Length = 276 Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Length = 256 Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Length = 250 Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Length = 278 Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Length = 264 Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Length = 264 Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Length = 261 Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Length = 275 Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Length = 257 Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Length = 257 Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Length = 440 Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} PDB: 3r9s_A 3r0o_A Length = 267 Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Length = 258 Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Length = 261 Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Length = 263 Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Length = 275 Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Length = 278 Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Length = 258 Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Length = 260 Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Length = 260 Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Length = 263 Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Length = 265 Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Length = 265 Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Length = 556 Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Length = 277 Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Length = 289 Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Length = 287 Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Length = 305 Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Length = 272 Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Length = 566 Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Length = 590 Back     alignment and structure
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Length = 363 Back     alignment and structure
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Length = 407 Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Length = 603 Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Length = 549 Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Length = 565 Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Length = 725 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Length = 715 Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Length = 616 Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Length = 563 Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Length = 589 Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Length = 563 Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Length = 677 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Length = 573 Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Length = 742 Back     alignment and structure
>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Length = 230 Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Length = 528 Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Length = 590 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query315
3hrx_A254 Probable enoyl-COA hydratase; the spiral fold, the 100.0
4fzw_C274 1,2-epoxyphenylacetyl-COA isomerase; structural ge 100.0
4fzw_A258 2,3-dehydroadipyl-COA hydratase; structural genomi 100.0
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 100.0
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 100.0
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 100.0
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 100.0
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 100.0
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 100.0
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 100.0
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 100.0
3lke_A263 Enoyl-COA hydratase; nysgrc, target 112 structural 100.0
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 100.0
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 100.0
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 100.0
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 100.0
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 100.0
4hdt_A353 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti 100.0
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 100.0
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 100.0
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 100.0
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 100.0
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 100.0
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 100.0
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 100.0
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 100.0
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 100.0
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 100.0
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 100.0
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 100.0
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 100.0
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 100.0
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 100.0
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 100.0
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 100.0
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 100.0
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 100.0
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 100.0
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 100.0
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 100.0
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 100.0
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 100.0
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 100.0
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 100.0
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 100.0
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 100.0
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 100.0
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 100.0
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 100.0
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 100.0
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 100.0
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 100.0
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 100.0
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 100.0
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 100.0
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 100.0
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 100.0
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 100.0
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 100.0
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 100.0
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 100.0
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 100.0
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 100.0
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 100.0
3t3w_A279 Enoyl-COA hydratase; ssgcid, structural genomics, 100.0
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 100.0
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 100.0
3bpt_A363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 100.0
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 100.0
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 100.0
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 100.0
3ju1_A407 Enoyl-COA hydratase/isomerase family protein; alph 100.0
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 100.0
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 100.0
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 100.0
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 100.0
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 100.0
3bf0_A593 Protease 4; bacterial, hydrolase, inner membrane, 99.69
3rst_A240 Signal peptide peptidase SPPA; alpha/beta protein 99.61
3viv_A230 441AA long hypothetical NFED protein; protein-pept 99.57
3hrx_A254 Probable enoyl-COA hydratase; the spiral fold, the 99.35
2f9y_B304 Acetyl-coenzyme A carboxylase carboxyl transferas 99.32
4fzw_C274 1,2-epoxyphenylacetyl-COA isomerase; structural ge 99.29
2f9i_A327 Acetyl-coenzyme A carboxylase carboxyl transferase 99.27
2f9y_A339 Acetyl-COA carboxylase, carboxyltransferase alpha; 99.25
4fzw_A258 2,3-dehydroadipyl-COA hydratase; structural genomi 99.24
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 99.23
4hdt_A353 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti 99.23
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hy 99.22
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 99.21
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 99.2
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 99.2
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 99.19
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 99.18
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 99.17
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 99.16
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 99.16
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 99.15
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 99.15
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 99.15
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 99.15
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 99.14
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 99.14
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 99.14
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 99.13
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 99.13
3lke_A263 Enoyl-COA hydratase; nysgrc, target 112 structural 99.13
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 99.13
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 99.13
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 99.13
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 99.12
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 99.12
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 99.12
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 99.11
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 99.11
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 99.11
1v5e_A590 Pyruvate oxidase; oxidoreductase, flavoprotein; HE 99.11
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 99.11
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 99.11
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 99.1
1ybh_A590 Acetolactate synthase, chloroplast; acetohydroxyac 99.1
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 99.09
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 99.08
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 99.08
3bpt_A363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 99.06
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 99.06
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 99.06
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 99.06
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 99.05
3ju1_A407 Enoyl-COA hydratase/isomerase family protein; alph 99.05
1t9b_A677 Acetolactate synthase, mitochondrial; acetohydroxy 99.05
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 99.05
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 99.04
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 99.04
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 99.04
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 99.04
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 99.04
4feg_A603 Pyruvate oxidase; carbanion, structure activity re 99.03
1ozh_A566 ALS, acetolactate synthase, catabolic; acetohydrox 99.03
2q28_A564 Oxalyl-COA decarboxylase; lyase, oxalate degradati 99.03
2pgn_A589 Cyclohexane-1,2-dione hydrolase (CDH); three alpha 99.02
2c31_A568 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 99.02
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 99.02
2pan_A616 Glyoxylate carboligase; thiamin-diphosphate (THDP) 99.02
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 99.0
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 98.99
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 98.99
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 98.99
1q6z_A528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 98.98
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 98.98
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 98.98
2uz1_A563 Benzaldehyde lyase; thiamine diphosphate, thiamine 98.97
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 98.97
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 98.95
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 98.95
2iht_A573 Carboxyethylarginine synthase; thiamin diphosphate 98.95
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 98.95
2wvg_A568 PDC, pyruvate decarboxylase; thiamine diphosphate, 98.94
2vbf_A570 Branched-chain alpha-ketoacid decarboxylase; KDCA, 98.94
1ovm_A552 Indole-3-pyruvate decarboxylase; thiamine diphosph 98.94
2vbi_A566 Pyruvate decarboxylase; thiamine pyrophosphate, ly 98.93
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 98.93
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 98.92
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 98.91
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 98.91
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 98.9
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 98.87
2vk8_A563 Pyruvate decarboxylase isozyme 1; asymmetric activ 98.85
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 98.83
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 98.83
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 98.81
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 98.77
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 98.77
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 98.76
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophos 98.74
2x7j_A604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 98.73
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 98.7
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 98.65
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 98.63
3t3w_A279 Enoyl-COA hydratase; ssgcid, structural genomics, 98.61
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 98.46
3lq1_A578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 98.46
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 98.44
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; 98.34
2f6i_A215 ATP-dependent CLP protease, putative; structural g 97.78
3qwd_A203 ATP-dependent CLP protease proteolytic subunit; ca 97.76
1pix_A 587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 97.6
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; en 97.59
1tg6_A277 Putative ATP-dependent CLP protease proteolytic S; 97.58
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; st 97.5
3iav_A 530 Propionyl-COA carboxylase complex B subunit; accas 97.46
2c42_A1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 97.4
1on3_A 523 Methylmalonyl-COA carboxyltransferase 12S subunit; 97.32
3n6r_B 531 Propionyl-COA carboxylase, beta subunit; protein c 97.31
2f9i_B285 Acetyl-coenzyme A carboxylase carboxyl transferase 97.24
4gm2_A205 ATP-dependent CLP protease proteolytic subunit; st 97.22
2bzr_A 548 Propionyl-COA carboxylase beta chain 5; fatty acid 97.13
1x0u_A 522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 97.12
3u9r_B 555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 97.0
1vrg_A 527 Propionyl-COA carboxylase, beta subunit; TM0716, s 96.8
2f9i_A327 Acetyl-coenzyme A carboxylase carboxyl transferase 96.52
1x0u_A522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 96.38
1vrg_A527 Propionyl-COA carboxylase, beta subunit; TM0716, s 96.29
2f9y_A339 Acetyl-COA carboxylase, carboxyltransferase alpha; 96.21
1on3_A523 Methylmalonyl-COA carboxyltransferase 12S subunit; 96.16
2o1x_A 629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, 96.06
2bzr_A548 Propionyl-COA carboxylase beta chain 5; fatty acid 95.92
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, 95.91
1pix_A587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 95.76
3gf3_A 588 Glutaconyl-COA decarboxylase subunit A; sodium ION 95.68
3rst_A240 Signal peptide peptidase SPPA; alpha/beta protein 95.27
2o1s_A 621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thia 94.74
3n6r_B531 Propionyl-COA carboxylase, beta subunit; protein c 94.74
3iav_A530 Propionyl-COA carboxylase complex B subunit; accas 94.71
2bfd_A400 2-oxoisovalerate dehydrogenase alpha subunit; oxid 94.6
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltrans 94.39
1qs0_A407 2-oxoisovalerate dehydrogenase alpha-subunit; hete 94.31
1w85_A368 Pyruvate dehydrogenase E1 component, alpha subunit 94.27
1umd_A367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; 93.77
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 93.25
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; 92.79
2ozl_A365 PDHE1-A type I, pyruvate dehydrogenase E1 componen 91.99
3gf3_A588 Glutaconyl-COA decarboxylase subunit A; sodium ION 91.83
1gpu_A 680 Transketolase; transferase(ketone residues); HET: 91.74
3u9r_B555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 91.46
3viv_A230 441AA long hypothetical NFED protein; protein-pept 91.12
2f9y_B304 Acetyl-coenzyme A carboxylase carboxyl transferas 89.12
3l84_A 632 Transketolase; TKT, structural genomics, center fo 88.51
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; en 87.25
3uk1_A 711 Transketolase; structural genomics, seattle struct 86.72
3m49_A 690 Transketolase; alpha-beta-alpha sandwich, csgid, t 85.62
3kom_A 663 Transketolase; rossmann fold, csgid, transferase, 85.08
1itz_A 675 Transketolase; calvin cycle, cofactor, thiamine py 85.04
2e6k_A 651 Transketolase; structural genomics, NPPSFA, nation 84.85
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hy 84.82
2r8o_A 669 Transketolase 1, TK 1; reaction intermediate, calc 83.73
3qwd_A203 ATP-dependent CLP protease proteolytic subunit; ca 83.19
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 81.23
2f9i_B285 Acetyl-coenzyme A carboxylase carboxyl transferase 80.55
3mos_A 616 Transketolase, TK; thiamin diphosphate TPP THDP en 80.41
>3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} Back     alignment and structure
Probab=100.00  E-value=1e-45  Score=317.61  Aligned_cols=210  Identities=24%  Similarity=0.292  Sum_probs=189.7

Q ss_pred             hhhhhhccCCCcccccCCCCccccchHHHHHHHHHHhhhcCCCCeEEEEEcCCCccccchhhhHHhhhccCchhHHHHHH
Q psy12573         38 IGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDSAFGFSGMELETLAVDKEGRPKLDEIFS  117 (315)
Q Consensus        38 ~~~~~l~~~~~~n~~~~~~~~~mg~~~~~~l~~~l~~~~~d~~~~vvvl~g~g~~~~aG~Dl~~~~~~~~~~~~~~~~~~  117 (315)
                      |+++|||||+++|++|..|+        .+|.+++.+++.|+++|+|||+|.|+.||+|+|++++....   +       
T Consensus        10 Va~itlnrP~~~NAl~~~m~--------~~L~~al~~~~~d~~vr~vVltg~g~~F~aG~Dl~~~~~~~---~-------   71 (254)
T 3hrx_A           10 VLVLTLNRPEKLNAITGELL--------DALYAALKEGEEDREVRALLLTGAGRAFSAGQDLTEFGDRK---P-------   71 (254)
T ss_dssp             EEEEEECCGGGTTCBCHHHH--------HHHHHHHHHHHHCTTCCEEEEEESTTCSBCCBCGGGTTTSC---C-------
T ss_pred             EEEEEEcCCCcCCCCCHHHH--------HHHHHHHHHHHhCCCeEEEEEeCCCCCcccCccHHHhcccc---h-------
Confidence            88999999999999999998        99999999999999999999999999999999998753200   0       


Q ss_pred             HHHHHHHHHHcCCCcEEEEEeeEEecccchhccccChhhhhhhcCCCCcchhhHHHHHHHHHHHHhcCCCcEEEEEcccc
Q psy12573        118 TCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGYNILVSTCSDLMLSILRHPVPILAIISGVA  197 (315)
Q Consensus       118 ~~~~~~~~~~~~~~~~i~~v~G~~~g~G~~f~~g~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~kpvIa~v~G~~  197 (315)
                                                         +.              ......++..+..+.++|||+||+|+|+|
T Consensus        72 -----------------------------------~~--------------~~~~~~~~~~~~~l~~~~kPvIAav~G~a  102 (254)
T 3hrx_A           72 -----------------------------------DY--------------EAHLRRYNRVVEALSGLEKPLVVAVNGVA  102 (254)
T ss_dssp             -----------------------------------CH--------------HHHTHHHHHHHHHHHTCSSCEEEEECSEE
T ss_pred             -----------------------------------hh--------------HHHHHHHHHHHHHHHhCCCCEEEEECCEe
Confidence                                               00              01122345567788999999999999999


Q ss_pred             chhhhHHHhhcCeeeeeCCceeeCCCccCCCCCCch-HHHHhhhcCHHHHHHHHhcCCCCCHHHHHHcCccccccCCchH
Q psy12573        198 AAAGCQLVATCDLAIATTASKFSTPGARHGIFCSTP-AVALTRKVPLGVVRSMTITGIPISAQDAYNAGLITRVVSSNEE  276 (315)
Q Consensus       198 ~g~G~~l~l~~d~~~a~~~a~~~~pe~~~Gl~~~~~-~~~l~~~~g~~~a~~~~~~g~~~~a~~a~~~Glv~~v~~~~~~  276 (315)
                      +|||++|+++||+++++++++|++||+++|++|+++ ++++++++|..++++++++|+.++++||+++|||+++++. ++
T Consensus       103 ~GgG~~lalacD~ria~~~a~f~~pe~~lGl~p~~g~~~~L~r~vG~~~A~~llltg~~i~A~eA~~~GLv~~vv~~-~~  181 (254)
T 3hrx_A          103 AGAGMSLALWGDLRLAAVGASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPA-EK  181 (254)
T ss_dssp             ETHHHHHHTTCSEEEEETTCEEECCGGGGTCCCCTTHHHHHHHHHCHHHHHHHHHHCCCEEHHHHHHHTSCSEEECG-GG
T ss_pred             eehhhhhhhccceeeEcCCCEEEchhhCcCcCCcccHHHHHHHHhCcchHHHHhhcCcccCHHHHHHCCCeEEecCc-HH
Confidence            999999999999999999999999999999999885 5789999999999999999999999999999999999999 99


Q ss_pred             HHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhCCChhhhC
Q psy12573        277 LESETKVLTSAILENSRSVLTLGKQFLYQQMSLNIEEAY  315 (315)
Q Consensus       277 ~~~~~~~~~~~l~~~~~~a~~~~k~~l~~~~~~~l~~~l  315 (315)
                      +.+.+.+++++|+..+|.+++.+|+++++....++++++
T Consensus       182 l~~~a~~~a~~la~~~~~a~~~~K~~~~~~~~~~~~~~l  220 (254)
T 3hrx_A          182 LMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEAL  220 (254)
T ss_dssp             HHHHHHHHHHHHHTSCHHHHHHHHHHHHHGGGSCHHHHH
T ss_pred             HHHHHHHHHHHhhccchHHHHHHHHHHHHHHcCCHHHHH
Confidence            999999999999999999999999999999998887753



>4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* Back     alignment and structure
>4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Back     alignment and structure
>3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A Back     alignment and structure
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} Back     alignment and structure
>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Back     alignment and structure
>3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} Back     alignment and structure
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Back     alignment and structure
>4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Back     alignment and structure
>1v5e_A Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FAD; 1.60A {Aerococcus viridans} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2dji_A* 1v5f_A* 1v5g_A* Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Back     alignment and structure
>1ybh_A Acetolactate synthase, chloroplast; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: CIE NHE FAD P22; 2.50A {Arabidopsis thaliana} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1yhy_A* 1yhz_A* 1yi0_A* 1yi1_A* 1z8n_A* 3ea4_A* 3e9y_A* Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Back     alignment and structure
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Back     alignment and structure
>1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 Back     alignment and structure
>4feg_A Pyruvate oxidase; carbanion, structure activity relationship, oxidation-reduct umpolung, thiamine diphosphate, reaction intermediate; HET: TDM FAD GOL; 1.09A {Lactobacillus plantarum} PDB: 4fee_A* 1y9d_A* 2ez9_A* 2ez4_A* 2ez8_A* 2ezt_A* 2ezu_A* 1pow_A* 1pox_A* Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>2q28_A Oxalyl-COA decarboxylase; lyase, oxalate degradation, thiami diphosphate, lyase; HET: TPP ADP MES; 1.74A {Escherichia coli} PDB: 2q27_A* 2q29_A* Back     alignment and structure
>2pgn_A Cyclohexane-1,2-dione hydrolase (CDH); three alpha/beta domains; HET: P6G FAD TPP; 1.20A {Azoarcus SP} PDB: 2pgo_A* Back     alignment and structure
>2c31_A Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 2ji6_A* 2ji7_A* 2ji8_A* 2ji9_A* 2jib_A* Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Back     alignment and structure
>2pan_A Glyoxylate carboligase; thiamin-diphosphate (THDP), thimain-dependent enzymes, FAD, lyase; HET: FAD TDP 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Back     alignment and structure
>2uz1_A Benzaldehyde lyase; thiamine diphosphate, thiamine pyrophosphate, benzoin, flavoprotein; HET: TPP; 1.65A {Pseudomonas fluorescens} PDB: 2ag1_A* 2ag0_A* 2uz1_B* 3iae_A* 3iaf_A* 3d7k_A* Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>2iht_A Carboxyethylarginine synthase; thiamin diphosphate complex, transferase; HET: MSE TPP; 2.00A {Streptomyces clavuligerus} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1upb_A* 1upc_A* 1upa_A* 2ihu_A* 2ihv_A* Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* Back     alignment and structure
>2wvg_A PDC, pyruvate decarboxylase; thiamine diphosphate, lyase, flavoprotein, metal-binding, alcohol fermentation; HET: TPU; 1.75A {Zymomonas mobilis} PDB: 2wva_A* 2wvh_A 3oe1_A* 1zpd_A* Back     alignment and structure
>2vbf_A Branched-chain alpha-ketoacid decarboxylase; KDCA, flavoprotein, THDP-dependent enzymes, thiamine pyrophosphate, lyase; HET: TPP; 1.60A {Lactococcus lactis} PDB: 2vbg_A* Back     alignment and structure
>1ovm_A Indole-3-pyruvate decarboxylase; thiamine diphosphate, indole-3-acetic acid, TDP dependent enzyme, lyase; HET: TPP; 2.65A {Enterobacter cloacae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 Back     alignment and structure
>2vbi_A Pyruvate decarboxylase; thiamine pyrophosphate, lyase, pyruv flavoprotein, THDP-dependent enzyme; HET: TPP; 2.75A {Acetobacter pasteurianus} Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Back     alignment and structure
>2vk8_A Pyruvate decarboxylase isozyme 1; asymmetric active sites, phenylalanine catabolism, tryptophan catabolism, thiamine pyrophosphate; HET: TPP; 1.42A {Saccharomyces cerevisiae} PDB: 1qpb_A* 2vk1_A* 2w93_A* 1pyd_A* 1pvd_A* 2vk4_A* 2vjy_A* 2g1i_A* Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Back     alignment and structure
>2nxw_A Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate, asymmetric dimer of dimers, open ACT loops, lyase; HET: TPP; 1.50A {Azospirillum brasilense} PDB: 2q5j_A* 2q5l_A* 2q5o_A* 2q5q_A* Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>3hww_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- carboxylate synthase; menaquinone, THDP, Mg, vitamin K2, carboxylase, magnesium; HET: AKG; 1.95A {Escherichia coli k-12} PDB: 3flm_A* 3hwx_A* 2jlc_A* 2jla_A* Back     alignment and structure
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Back     alignment and structure
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Back     alignment and structure
>3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Back     alignment and structure
>1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Back     alignment and structure
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} SCOP: c.14.1.1 Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>4gm2_A ATP-dependent CLP protease proteolytic subunit; structural genomics, structural genomics consortium, SGC, PR hydrolase; 2.80A {Plasmodium falciparum} PDB: 4hnk_A Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Back     alignment and structure
>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Back     alignment and structure
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>1gpu_A Transketolase; transferase(ketone residues); HET: THD; 1.86A {Saccharomyces cerevisiae} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 1ngs_A* 1trk_A* 1ay0_A* 1tkb_A* 1tka_A* 1tkc_A* Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Back     alignment and structure
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>3l84_A Transketolase; TKT, structural genomics, center for structur genomics of infectious diseases, csgid, transferase; HET: MSE; 1.36A {Campylobacter jejuni} PDB: 3m6l_A* 3m34_A* 3m7i_A* Back     alignment and structure
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Back     alignment and structure
>3uk1_A Transketolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, thiamine pyrophosphate; 2.15A {Burkholderia thailandensis} PDB: 3upt_A* Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>3kom_A Transketolase; rossmann fold, csgid, transferase, structural genomics, center for structural genomics of infectious DISE; HET: MSE; 1.60A {Francisella tularensis subsp} Back     alignment and structure
>1itz_A Transketolase; calvin cycle, cofactor, thiamine pyrophosphate, plant, transferase; HET: TPP; 2.30A {Zea mays} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project protein structural and functional analyses; 2.09A {Thermus thermophilus} Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure
>3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure
>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>3mos_A Transketolase, TK; thiamin diphosphate TPP THDP enzyme catalysis sugar metaboli transferase; HET: TPP; 1.75A {Homo sapiens} PDB: 3ooy_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 315
d1mj3a_260 c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat 3e-17
d2ji7a3183 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxa 3e-14
d1pvda3196 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker 2e-10
d1zpda3204 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymom 2e-09
d1uiya_253 c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {The 1e-08
d1uiya_253 c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {The 8e-04
d2djia3229 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus 6e-08
d1ovma3196 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxyla 1e-06
d1dcia_275 c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2 6e-06
d1dcia_275 c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2 0.001
d2ihta3198 c.36.1.9 (A:375-572) Carboxyethylarginine synthase 5e-05
d1pjha_266 c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2 2e-04
d2ez9a3228 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacill 0.001
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 260 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Crotonase-like
domain: Enoyl-CoA hydratase (crotonase)
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 77.9 bits (191), Expect = 3e-17
 Identities = 37/140 (26%), Positives = 59/140 (42%), Gaps = 2/140 (1%)

Query: 177 DLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGARHGIFCSTPAVA 236
                I R   P++A ++G A   GC+L   CD+  A   ++F  P    G         
Sbjct: 88  SHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQ 147

Query: 237 -LTRKVPLGVVRSMTITGIPISAQDAYNAGLITRVVSSNEELESETKVLTSAILENSRSV 295
            LTR V   +   M +TG  ISAQDA  AGL++++         E       I  NS+ +
Sbjct: 148 RLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETL-VEEAIQCAEKIANNSKII 206

Query: 296 LTLGKQFLYQQMSLNIEEAY 315
           + + K+ +     + + E  
Sbjct: 207 VAMAKESVNAAFEMTLTEGN 226


>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Length = 183 Back     information, alignment and structure
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 196 Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Length = 204 Back     information, alignment and structure
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Length = 253 Back     information, alignment and structure
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Length = 253 Back     information, alignment and structure
>d2djia3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Length = 229 Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Length = 196 Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 275 Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 275 Back     information, alignment and structure
>d2ihta3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Length = 198 Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 266 Back     information, alignment and structure
>d2ez9a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Length = 228 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query315
d2a7ka1230 Carbapenem biosynthes protein CarB {Pectobacterium 100.0
d1mj3a_260 Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve 100.0
d2f6qa1245 Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( 100.0
d1uiya_253 Enoyl-CoA hydratase (crotonase) {Thermus thermophi 100.0
d1wz8a1263 Probable enoyl-CoA hydratase TTHA0218 {Thermus the 100.0
d1nzya_269 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., 100.0
d2fw2a1258 Chromodomain protein CDY2A {Human (Homo sapiens) [ 100.0
d1sg4a1249 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 100.0
d1hzda_266 AUH protein {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1dcia_275 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 100.0
d1ef8a_261 Methylmalonyl CoA decarboxylase {Escherichia coli 100.0
d1q52a_297 Naphthoate synthase MenB {Mycobacterium tuberculos 100.0
d1szoa_249 6-oxo camphor hydrolase {Rhodococcus erythropolis 100.0
d1pjha_266 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 100.0
d1wdka4310 Fatty oxidation complex alpha subunit, N-terminal 100.0
d1ybha3208 Acetohydroxyacid synthase catalytic subunit {Thale 99.67
d2ez9a3228 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 99.65
d1ozha3192 Catabolic acetolactate synthase {Klebsiella pneumo 99.64
d2djia3229 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 99.59
d1t9ba3227 Acetohydroxyacid synthase catalytic subunit {Baker 99.58
d1q6za3183 Benzoylformate decarboxylase {Pseudomonas putida [ 99.58
d2ihta3198 Carboxyethylarginine synthase {Streptomyces clavul 99.53
d1ovma3196 Indole-3-pyruvate decarboxylase {Enterobacter cloa 99.47
d1pvda3196 Pyruvate decarboxylase {Baker's yeast (Saccharomyc 99.47
d1zpda3204 Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 99.43
d2ji7a3183 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 99.39
d1hzda_266 AUH protein {Human (Homo sapiens) [TaxId: 9606]} 99.15
d2fw2a1258 Chromodomain protein CDY2A {Human (Homo sapiens) [ 99.09
d1q52a_297 Naphthoate synthase MenB {Mycobacterium tuberculos 99.04
d1uiya_253 Enoyl-CoA hydratase (crotonase) {Thermus thermophi 99.01
d1mj3a_260 Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve 98.99
d1wdka4310 Fatty oxidation complex alpha subunit, N-terminal 98.96
d1dcia_275 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 98.96
d1nzya_269 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., 98.9
d1ef8a_261 Methylmalonyl CoA decarboxylase {Escherichia coli 98.89
d1wz8a1263 Probable enoyl-CoA hydratase TTHA0218 {Thermus the 98.87
d2a7ka1230 Carbapenem biosynthes protein CarB {Pectobacterium 98.78
d2f6qa1245 Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( 98.72
d1pjha_266 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 98.71
d1sg4a1249 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 98.66
d1szoa_249 6-oxo camphor hydrolase {Rhodococcus erythropolis 98.29
d1on3a1253 Methylmalonyl-CoA carboxyltransferase (transcarbox 97.66
d2a7sa1258 Propionyl-CoA carboxylase complex B subunit, PccB 97.45
d1xnya1258 Propionyl-CoA carboxylase complex B subunit, PccB 97.28
d2f9yb1263 Acetyl-coenzyme A carboxylase carboxyl transferase 97.24
d2cbya1179 Clp protease, ClpP subunit {Mycobacterium tubercul 97.14
d2f9ya1316 Acetyl-coenzyme A carboxylase carboxyl transferase 97.14
d1vrga1251 Propionyl-CoA carboxylase complex B subunit, PccB 97.11
d1y7oa1192 Clp protease, ClpP subunit {Streptococcus pneumoni 97.01
d1tg6a1193 Clp protease, ClpP subunit {Human (Homo sapiens), 96.93
d1yg6a1183 Clp protease, ClpP subunit {Escherichia coli [TaxI 96.88
d2f6ia1190 Clp protease, ClpP subunit {Plasmodium falciparum 96.85
d1pixa2287 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 96.36
d1vrga2264 Propionyl-CoA carboxylase complex B subunit, PccB 94.96
d1uyra1333 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 94.86
d2a7sa2271 Propionyl-CoA carboxylase complex B subunit, PccB 94.6
d1on3a2264 Methylmalonyl-CoA carboxyltransferase (transcarbox 94.59
d1xnya2263 Propionyl-CoA carboxylase complex B subunit, PccB 94.16
d1pixa3299 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 92.44
d1xnya1258 Propionyl-CoA carboxylase complex B subunit, PccB 82.87
d1qs0a_407 2-oxoisovalerate dehydrogenase (E1B), PP module {P 81.43
d1on3a1253 Methylmalonyl-CoA carboxyltransferase (transcarbox 80.58
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Crotonase-like
domain: Carbapenem biosynthes protein CarB
species: Pectobacterium carotovorum [TaxId: 554]
Probab=100.00  E-value=8.9e-43  Score=292.96  Aligned_cols=211  Identities=18%  Similarity=0.208  Sum_probs=188.0

Q ss_pred             hhhhhhccCCCcccccCCCCccccchHHHHHHHHHHhhhcCCCCeEEEEEcCC-CccccchhhhHHhhhccCchhHHHHH
Q psy12573         38 IGRSLLLNNLPRHRLDAGTFGTMGVGLGFALAAALYCNHYAPGKRVVCVQGDS-AFGFSGMELETLAVDKEGRPKLDEIF  116 (315)
Q Consensus        38 ~~~~~l~~~~~~n~~~~~~~~~mg~~~~~~l~~~l~~~~~d~~~~vvvl~g~g-~~~~aG~Dl~~~~~~~~~~~~~~~~~  116 (315)
                      |+.+|||||+++|+++..++        .+|.+++.+++.|+++++|||+|.| ++||+|.|++++....  .++     
T Consensus        10 I~~itlnrp~~~Nal~~~~~--------~~l~~~l~~~~~d~~i~~vVl~~~g~~~F~aG~Dl~~~~~~~--~~~-----   74 (230)
T d2a7ka1          10 VRVITLDHPNKHNPFSRTLE--------TSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNEVKQLS--RSE-----   74 (230)
T ss_dssp             EEEEEECCSSTTCBCCHHHH--------HHHHHHHHHHHHCTTCCEEEEECCTTSCSBCBSCHHHHHTC---CHH-----
T ss_pred             EEEEEEcCCCCCCCCCHHHH--------HHHHHHHHHHHhCCcccccceeccchhhhhhhcccccccccc--ccc-----
Confidence            78899999999999999998        9999999999999999999999987 5788999999875310  000     


Q ss_pred             HHHHHHHHHHHcCCCcEEEEEeeEEecccchhccccChhhhhhhcCCCCcchhhHHHHHHHHHHHHhcCCCcEEEEEccc
Q psy12573        117 STCSDLMLSILRHPVPILAIISGVAAAAGCQLVATCDLAIATTASKFSTPGYNILVSTCSDLMLSILRHPVPILAIISGV  196 (315)
Q Consensus       117 ~~~~~~~~~~~~~~~~~i~~v~G~~~g~G~~f~~g~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~kpvIa~v~G~  196 (315)
                                                          +.              ..+...+..++..+.++|||+||+|+|+
T Consensus        75 ------------------------------------~~--------------~~~~~~~~~~~~~i~~~~kpvIaav~G~  104 (230)
T d2a7ka1          75 ------------------------------------DI--------------EEWIDRVIDLYQAVLNVNKPTIAAVDGY  104 (230)
T ss_dssp             ------------------------------------HH--------------HHHHHHHHHHHHHHHTCCSCEEEEECSE
T ss_pred             ------------------------------------cc--------------ccchhhhhhhhhcccchhcceeeecccc
Confidence                                                00              0223345567788899999999999999


Q ss_pred             cchhhhHHHhhcCeeeeeCCceeeCCCccCCCCCCchHHHHhhhcCHHHHHHHHhcCCCCCHHHHHHcCccccccCCchH
Q psy12573        197 AAAAGCQLVATCDLAIATTASKFSTPGARHGIFCSTPAVALTRKVPLGVVRSMTITGIPISAQDAYNAGLITRVVSSNEE  276 (315)
Q Consensus       197 ~~g~G~~l~l~~d~~~a~~~a~~~~pe~~~Gl~~~~~~~~l~~~~g~~~a~~~~~~g~~~~a~~a~~~Glv~~v~~~~~~  276 (315)
                      |+|||++|+++||+++++++++|++||.++|++|++++.++++++|..++++++++|+.++++||+++|+|+++++. ++
T Consensus       105 a~GgG~~lal~~D~~ia~~~a~f~~pe~~~G~~p~~g~~~l~~~iG~~~a~~l~l~g~~~~a~eA~~~Glv~~vv~~-~~  183 (230)
T d2a7ka1         105 AIGMGFQFALMFDQRLMASTANFVMPELKHGIGCSVGAAILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVES-SA  183 (230)
T ss_dssp             EETHHHHHHTTSSEEEEETTCEEECCGGGGTCCCHHHHHHHHHHHCHHHHHHHHHHCCCBCHHHHHHHTCCSEEECH-HH
T ss_pred             cccccccchhccchhhccccchhhhccccccccccccccccccccccccccccccccccchHHHHHHhhhcccCCCh-HH
Confidence            99999999999999999999999999999999998877889999999999999999999999999999999999999 99


Q ss_pred             HHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhCCChhhh
Q psy12573        277 LESETKVLTSAILENSRSVLTLGKQFLYQQMSLNIEEA  314 (315)
Q Consensus       277 ~~~~~~~~~~~l~~~~~~a~~~~k~~l~~~~~~~l~~~  314 (315)
                      +.+.+.+++++|++.||.+++.+|+.+++.....+++.
T Consensus       184 l~~~a~~~a~~ia~~~~~a~~~~K~~l~~~~~~~l~~~  221 (230)
T d2a7ka1         184 LLDAAITQAHVMASYPASAFINTKRAVNKPFIHLLEQT  221 (230)
T ss_dssp             HHHHHHHHHHHHHTSCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHhccHHHH
Confidence            99999999999999999999999999999877766654



>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ybha3 c.36.1.9 (A:460-667) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2ez9a3 c.36.1.9 (A:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1ozha3 c.36.1.9 (A:367-558) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2djia3 c.36.1.9 (A:364-592) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1t9ba3 c.36.1.9 (A:461-687) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q6za3 c.36.1.9 (A:342-524) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ihta3 c.36.1.9 (A:375-572) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1ovma3 c.36.1.9 (A:356-551) Indole-3-pyruvate decarboxylase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1pvda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2ji7a3 c.36.1.9 (A:370-552) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d2a7sa1 c.14.1.4 (A:20-277) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xnya1 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vrga1 c.14.1.4 (A:1-251) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1pixa2 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uyra1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a7sa2 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d1xnya2 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1pixa3 c.14.1.4 (A:288-586) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1xnya1 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1qs0a_ c.36.1.11 (A:) 2-oxoisovalerate dehydrogenase (E1B), PP module {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure