Psyllid ID: psy12586
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 309 | ||||||
| 242117926 | 477 | nicotinic acetylcholine receptor alpha 5 | 0.721 | 0.467 | 0.497 | 2e-49 | |
| 221222645 | 477 | nicotinic acetylcholine receptor subunit | 0.721 | 0.467 | 0.497 | 2e-49 | |
| 157954039 | 649 | nicotinic acetylcholine receptor alpha 5 | 0.394 | 0.187 | 0.784 | 3e-48 | |
| 157783832 | 478 | nicotinic acetylcholine receptor alpha 5 | 0.401 | 0.259 | 0.771 | 3e-48 | |
| 290560638 | 499 | nicotinic acetylcholine receptor subunit | 0.401 | 0.248 | 0.771 | 4e-48 | |
| 158186750 | 329 | nicotinic acetylcholine receptor subunit | 0.401 | 0.376 | 0.771 | 8e-48 | |
| 383858569 | 481 | PREDICTED: neuronal acetylcholine recept | 0.394 | 0.253 | 0.768 | 6e-47 | |
| 66537889 | 416 | PREDICTED: neuronal acetylcholine recept | 0.394 | 0.293 | 0.768 | 8e-47 | |
| 45686195 | 461 | neuronal nicotinic acetylcholine Apisa7- | 0.394 | 0.264 | 0.768 | 8e-47 | |
| 340725535 | 480 | PREDICTED: neuronal acetylcholine recept | 0.394 | 0.254 | 0.776 | 9e-47 |
| >gi|242117926|ref|NP_001155994.1| nicotinic acetylcholine receptor alpha 5 subunit isoform 2 precursor [Tribolium castaneum] gi|157783850|gb|ABV72696.1| nicotinic acetylcholine receptor alpha 5 subunit [Tribolium castaneum] gi|221222663|gb|ACM09854.1| nicotinic acetylcholine receptor subunit a5 [Tribolium castaneum] gi|221222665|gb|ACM09855.1| nicotinic acetylcholine receptor subunit a5 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 202 bits (513), Expect = 2e-49, Method: Compositional matrix adjust.
Identities = 121/243 (49%), Positives = 154/243 (63%), Gaps = 20/243 (8%)
Query: 57 QLDLLKEREEGDTTNYQVNGEFDLLSYSSVKNVVNYSCCVEPYPDITYYISLRRRPMFYV 116
Q++L K+ EEGD +NYQ NGEFDL+S+SSVK++ YSCC EPYPDITY I L+RRP+FYV
Sbjct: 172 QVELAKQTEEGDVSNYQANGEFDLISFSSVKHIEFYSCCPEPYPDITYTIKLKRRPLFYV 231
Query: 117 FNLILPCILINCIALLVFYVPSESGEKVTLGISALLSMTVFLMTIRETLPPTEN---ISE 173
FNLILPCILIN IALLVFYVPSESGEKVTLGISALLSMTVFLMTIRETLPPTE IS
Sbjct: 232 FNLILPCILINGIALLVFYVPSESGEKVTLGISALLSMTVFLMTIRETLPPTEKTPLISM 291
Query: 174 YVLVSSD--HFRVKYIIVADELLPTRYRGRAQSQ--EFTLPEQVRPLASL--ETSHKTLN 227
Y VS F +V + RG A + + +++ PL + ET+++ N
Sbjct: 292 YYGVSICLVSFASGLSVVTLNIYHRGVRGSAVPKIIRTVVLDKLAPLVFMRFETNNRHRN 351
Query: 228 KVIRQTNQRVNALEYVVIPRLARTLDYIKSELDEMEREEFYRLKKIQDKKREALERRTRE 287
I++ N P+ LD D+M +E+ Y L++ Q + + R E
Sbjct: 352 SQIQEIN-----------PQTGTRLDCPWPWTDKMPQEDGYCLQQRQQRSPRFVPRHRVE 400
Query: 288 QIE 290
++
Sbjct: 401 DLD 403
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|221222645|gb|ACM09845.1| nicotinic acetylcholine receptor subunit a5 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|157954039|ref|NP_001103252.1| nicotinic acetylcholine receptor alpha 5 subunit isoform 1 precursor [Tribolium castaneum] gi|154810977|gb|ABS86907.1| nicotinic acetylcholine receptor subunit alpha5 [Tribolium castaneum] gi|270006448|gb|EFA02896.1| nicotinic acetylcholine receptor subunit alpha5 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|157783832|gb|ABV72687.1| nicotinic acetylcholine receptor alpha 5 subunit [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|290560638|ref|NP_001166811.1| nicotinic acetylcholine receptor subunit alpha 5 isoform A precursor [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|158186750|ref|NP_001103392.1| nicotinic acetylcholine receptor subunit alpha 5 isoform B precursor [Bombyx mori] gi|157367296|gb|ABV45516.1| nicotinic acetylcholine receptor subunit alpha 5 mRNA transcript variant 1 [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|383858569|ref|XP_003704773.1| PREDICTED: neuronal acetylcholine receptor subunit alpha-7-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|66537889|ref|XP_625040.1| PREDICTED: neuronal acetylcholine receptor subunit alpha-10, partial [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|45686195|gb|AAS75781.1| neuronal nicotinic acetylcholine Apisa7-2 subunit [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|340725535|ref|XP_003401124.1| PREDICTED: neuronal acetylcholine receptor subunit alpha-7-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 309 | ||||||
| FB|FBgn0040377 | 249 | Vha36-3 "Vacuolar H[+] ATPase | 0.245 | 0.305 | 0.644 | 1e-20 | |
| FB|FBgn0022097 | 246 | Vha36-1 "Vacuolar H[+] ATPase | 0.210 | 0.264 | 0.753 | 1.7e-20 | |
| ZFIN|ZDB-GENE-040426-727 | 248 | atp6v1d "ATPase, H+ transporti | 0.385 | 0.479 | 0.468 | 3.5e-20 | |
| UNIPROTKB|E1BT00 | 247 | ATP6V1D "Uncharacterized prote | 0.375 | 0.469 | 0.464 | 1.9e-19 | |
| RGD|735119 | 247 | Atp6v1d "ATPase, H+ transporti | 0.381 | 0.477 | 0.453 | 2.5e-19 | |
| UNIPROTKB|G3V2S6 | 192 | ATP6V1D "V-type proton ATPase | 0.381 | 0.614 | 0.453 | 4e-19 | |
| UNIPROTKB|H0YJH8 | 153 | ATP6V1D "V-type proton ATPase | 0.381 | 0.771 | 0.453 | 4e-19 | |
| UNIPROTKB|Q9Y5K8 | 247 | ATP6V1D "V-type proton ATPase | 0.381 | 0.477 | 0.453 | 4e-19 | |
| UNIPROTKB|F1SA40 | 247 | ATP6V1D "Uncharacterized prote | 0.381 | 0.477 | 0.453 | 4e-19 | |
| MGI|MGI:1921084 | 247 | Atp6v1d "ATPase, H+ transporti | 0.381 | 0.477 | 0.453 | 5.1e-19 |
| FB|FBgn0040377 Vha36-3 "Vacuolar H[+] ATPase 36kD subunit 3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 244 (91.0 bits), Expect = 1.0e-20, P = 1.0e-20
Identities = 49/76 (64%), Positives = 64/76 (84%)
Query: 216 LASLETSHKTLNKVIRQTNQRVNALEYVVIPRLARTLDYIKSELDEMEREEFYRLKKIQD 275
LASL+TS TL+ VI+ TN+RVNA+E+V+IPR+ RT++YI SELDE+EREEFYRLKKIQD
Sbjct: 148 LASLQTSFVTLDDVIKVTNRRVNAIEHVIIPRINRTIEYIISELDELEREEFYRLKKIQD 207
Query: 276 KKREALERRTREQIER 291
KKREA + + + E+
Sbjct: 208 KKREARKASDKLRAEQ 223
|
|
| FB|FBgn0022097 Vha36-1 "Vacuolar H[+] ATPase 36kD subunit 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-727 atp6v1d "ATPase, H+ transporting, V1 subunit D" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BT00 ATP6V1D "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|735119 Atp6v1d "ATPase, H+ transporting, lysosomal V1 subunit D" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V2S6 ATP6V1D "V-type proton ATPase subunit D" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YJH8 ATP6V1D "V-type proton ATPase subunit D" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y5K8 ATP6V1D "V-type proton ATPase subunit D" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SA40 ATP6V1D "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1921084 Atp6v1d "ATPase, H+ transporting, lysosomal V1 subunit D" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 309 | |||
| TIGR00860 | 459 | TIGR00860, LIC, Cation transporter family protein | 7e-27 | |
| pfam01813 | 191 | pfam01813, ATP-synt_D, ATP synthase subunit D | 7e-25 | |
| COG1394 | 211 | COG1394, NtpD, Archaeal/vacuolar-type H+-ATPase su | 2e-20 | |
| pfam02932 | 228 | pfam02932, Neur_chan_memb, Neurotransmitter-gated | 1e-18 | |
| TIGR00309 | 209 | TIGR00309, V_ATPase_subD, H(+)-transporting ATP sy | 3e-18 | |
| PRK00373 | 204 | PRK00373, PRK00373, V-type ATP synthase subunit D; | 5e-18 | |
| pfam02931 | 215 | pfam02931, Neur_chan_LBD, Neurotransmitter-gated i | 3e-08 |
| >gnl|CDD|233155 TIGR00860, LIC, Cation transporter family protein | Back alignment and domain information |
|---|
Score = 109 bits (273), Expect = 7e-27
Identities = 39/120 (32%), Positives = 64/120 (53%), Gaps = 5/120 (4%)
Query: 62 KEREEGDTTNYQVNGEFDLLSYSSVKNVVNYSCCVEPYPDITYYISLRRRPMFYVFNLIL 121
+ + D + + EF+LL + YP +T+ LRRRP++Y+ L +
Sbjct: 191 QGAVQVDDSLFISLPEFELLGVYGTRYC-TSETNTGEYPCLTFSFVLRRRPLYYLLQLYI 249
Query: 122 PCILINCIALLVFYVPSE-SGEKVTLGISALLSMTVFLMTIRETLPPTEN---ISEYVLV 177
P ILI ++ + F++P++ SG +V+LGI+ LL+MT F +RE+LP I Y V
Sbjct: 250 PSILIVILSWVSFWLPADASGARVSLGITTLLTMTTFSSGVRESLPAVSYVKAIDVYFAV 309
|
The Ligand-gated Ion Channel (LIC) Family of Neurotransmitter Receptors TC 1.A.9)Members of the LIC family of ionotropic neurotransmitter receptors are found only in vertebrate and invertebrate animals. They exhibit receptor specificity for (1)acetylcholine, (2) serotonin, (3) glycine, (4) glutamate and (5) g-aminobutyric acid (GABA). All of these receptor channels are probably hetero- orhomopentameric. The best characterized are the nicotinic acetyl-choline receptors which are pentameric channels of a2bgd subunit composition. All subunits arehomologous. The three dimensional structures of the protein complex in both the open and closed configurations have been solved at 0.9 nm resolution.The channel protein complexes of the LIC family preferentially transport cations or anions depending on the channel (e.g., the acetylcholine receptors are cationselective while glycine receptors are anion selective) [Transport and binding proteins, Cations and iron carrying compounds]. Length = 459 |
| >gnl|CDD|201987 pfam01813, ATP-synt_D, ATP synthase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|224312 COG1394, NtpD, Archaeal/vacuolar-type H+-ATPase subunit D [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|202474 pfam02932, Neur_chan_memb, Neurotransmitter-gated ion-channel transmembrane region | Back alignment and domain information |
|---|
| >gnl|CDD|129409 TIGR00309, V_ATPase_subD, H(+)-transporting ATP synthase, vacuolar type, subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|178991 PRK00373, PRK00373, V-type ATP synthase subunit D; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217293 pfam02931, Neur_chan_LBD, Neurotransmitter-gated ion-channel ligand binding domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 309 | |||
| KOG3646|consensus | 486 | 100.0 | ||
| KOG3643|consensus | 459 | 100.0 | ||
| TIGR00860 | 459 | LIC Cation transporter family protein. selective w | 100.0 | |
| KOG3645|consensus | 449 | 100.0 | ||
| KOG3644|consensus | 457 | 100.0 | ||
| KOG3642|consensus | 466 | 100.0 | ||
| KOG1647|consensus | 255 | 99.81 | ||
| COG1394 | 211 | NtpD Archaeal/vacuolar-type H+-ATPase subunit D [E | 99.77 | |
| TIGR00309 | 209 | V_ATPase_subD H(+)-transporting ATP synthase, vacu | 99.76 | |
| PRK02195 | 201 | V-type ATP synthase subunit D; Provisional | 99.74 | |
| PF01813 | 196 | ATP-synt_D: ATP synthase subunit D ; InterPro: IPR | 99.73 | |
| PRK00373 | 204 | V-type ATP synthase subunit D; Reviewed | 99.72 | |
| PF02932 | 237 | Neur_chan_memb: Neurotransmitter-gated ion-channel | 99.72 | |
| PF02931 | 217 | Neur_chan_LBD: Neurotransmitter-gated ion-channel | 99.68 | |
| PF14494 | 256 | DUF4436: Domain of unknown function (DUF4436) | 93.9 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 81.91 |
| >KOG3646|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.1e-42 Score=319.95 Aligned_cols=196 Identities=32% Similarity=0.523 Sum_probs=182.0
Q ss_pred CCCceEEEEcceeE-EeeCCCCCCCCccc-eeeEEeeecCcccccccceeEeecCCcceeEEEecCCC--CCccceeecC
Q psy12586 1 MNTEHATVDLPIRS-SKKPLPIRKIPSEI-KLSLTSEEWVPTYLRFPNLIIYFPLFLLQLDLLKEREE--GDTTNYQVNG 76 (309)
Q Consensus 1 ~~dG~V~~~~~~~~-~~C~mdl~~fPfD~-~C~l~~~S~~p~~~~~~~~~~~~~~~~~~v~l~~~~~~--~~~~~~~~~~ 76 (309)
+|||.|.|.+|... ++|.+|.+.||||. .|.++|||| +| +|..+||+...+. +|++.|..||
T Consensus 134 ~~tG~v~~vPPGIfk~sCkiDItwFPFD~Q~C~mKFGSW----TY----------~G~~lDL~~~~~~g~~Dls~yi~NG 199 (486)
T KOG3646|consen 134 YSTGSVLWVPPGIFKSSCKIDITWFPFDDQVCYLKFGSW----TY----------AGILLDLRIDDEDGGIDLSTYIPNG 199 (486)
T ss_pred ccCCeeeecCCceeeeeeEEEEEEecccccEEEEEeeeE----EE----------cceeeeeeeccccCCcchhhcccCC
Confidence 58999999999999 99999999999999 999999999 54 6777777654443 6799999999
Q ss_pred eEEEeeeeEEEEEEeccCCCCCcceEEEEEEEEeecceEEEeeehhhHHHhhhheeeEEecCCCCceEEEEehhHHHHHH
Q psy12586 77 EFDLLSYSSVKNVVNYSCCVEPYPDITYYISLRRRPMFYVFNLILPCILINCIALLVFYVPSESGEKVTLGISALLSMTV 156 (309)
Q Consensus 77 eW~l~~~~~~~~~~~~~~~~~~y~~l~~~~~l~R~~~~y~~~~iiP~~li~~ls~i~Fwlp~~~~~Ri~l~it~lLt~~~ 156 (309)
||++.+.++.+....|+||+++|++++|++.+||+..||.+|+++||.++.++++.||.+|+|+|||+++++|++|+.++
T Consensus 200 EW~Ll~~pakr~~~~y~cC~epY~dv~F~l~irRRTLyYgfNlIiP~lLIs~m~lLgFtlppD~gEKitL~iTilLsvc~ 279 (486)
T KOG3646|consen 200 EWDLLGTPAKREEKTYDCCPEPYPDVTFYLHIRRRTLYYGFNLIIPSLLISLMSLLGFTLPPDAGEKITLQITILLSVCF 279 (486)
T ss_pred ceeeccccccceeeecccCCCCcceeEEEEEEEehhhHHHHHHHHHHHHHHHHHHhccccCccccceeeeeeehHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHhhcCCCCcc----ccchhhhhhhHHHHHHHHHhhcccceeeeCCccccccccccccc
Q psy12586 157 FLMTIRETLPPTEN----ISEYVLVSSDHFRVKYIIVADELLPTRYRGRAQSQEFTLPEQVR 214 (309)
Q Consensus 157 ~l~~l~~~lP~~s~----i~~y~~~~~~~v~~s~ii~~~~v~n~~~r~~~~~~~~~l~~~l~ 214 (309)
|+..+++..|++|. +|.||..||+++.+| +..|++|+|+|+|++.. +.+.+|.+
T Consensus 280 FL~mvse~~PpTSeaVPllg~fFsc~m~iv~~S-vvfTv~vLn~h~R~p~~---h~m~p~~r 337 (486)
T KOG3646|consen 280 FLTMVSEMTPPTSEAVPLLGAFFSCCMFIVAAS-VVFTVIVLNLHHRTPET---HEMSPWTR 337 (486)
T ss_pred HHHHHHhhcCCccccccHHHHHHHHHHHHHHhh-heeEEEEEeeeccCccc---cccCHHHH
Confidence 99999999999999 999999999999998 89999999999998876 44444444
|
|
| >KOG3643|consensus | Back alignment and domain information |
|---|
| >TIGR00860 LIC Cation transporter family protein | Back alignment and domain information |
|---|
| >KOG3645|consensus | Back alignment and domain information |
|---|
| >KOG3644|consensus | Back alignment and domain information |
|---|
| >KOG3642|consensus | Back alignment and domain information |
|---|
| >KOG1647|consensus | Back alignment and domain information |
|---|
| >COG1394 NtpD Archaeal/vacuolar-type H+-ATPase subunit D [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00309 V_ATPase_subD H(+)-transporting ATP synthase, vacuolar type, subunit D | Back alignment and domain information |
|---|
| >PRK02195 V-type ATP synthase subunit D; Provisional | Back alignment and domain information |
|---|
| >PF01813 ATP-synt_D: ATP synthase subunit D ; InterPro: IPR002699 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >PRK00373 V-type ATP synthase subunit D; Reviewed | Back alignment and domain information |
|---|
| >PF02932 Neur_chan_memb: Neurotransmitter-gated ion-channel transmembrane region ion channel family signature gamma-aminobutyric acid (GABA) receptor signature nicotinic acetylcholine receptor signature; InterPro: IPR006029 Neurotransmitter ligand-gated ion channels are transmembrane receptor-ion channel complexes that open transiently upon binding of specific ligands, allowing rapid transmission of signals at chemical synapses [, ] | Back alignment and domain information |
|---|
| >PF02931 Neur_chan_LBD: Neurotransmitter-gated ion-channel ligand binding domain ion channel family signature gamma-aminobutyric acid (GABA) receptor signature nicotinic acetylcholine receptor signature; InterPro: IPR006202 Neurotransmitter ligand-gated ion channels are transmembrane receptor-ion channel complexes that open transiently upon binding of specific ligands, allowing rapid transmission of signals at chemical synapses [, ] | Back alignment and domain information |
|---|
| >PF14494 DUF4436: Domain of unknown function (DUF4436) | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 309 | ||||
| 4aq5_A | 461 | Gating Movement In Acetylcholine Receptor Analysed | 7e-14 | ||
| 2bg9_A | 370 | Refined Structure Of The Nicotinic Acetylcholine Re | 7e-13 | ||
| 4aq5_C | 522 | Gating Movement In Acetylcholine Receptor Analysed | 1e-09 | ||
| 2bg9_C | 369 | Refined Structure Of The Nicotinic Acetylcholine Re | 2e-09 | ||
| 1oed_A | 227 | Structure Of Acetylcholine Receptor Pore From Elect | 5e-09 | ||
| 3a5c_G | 223 | Inter-Subunit Interaction And Quaternary Rearrangem | 3e-07 | ||
| 3vr6_G | 217 | Crystal Structure Of Amp-pnp Bound Enterococcus Hir | 1e-06 | ||
| 2bg9_E | 370 | Refined Structure Of The Nicotinic Acetylcholine Re | 2e-06 | ||
| 4aq5_E | 488 | Gating Movement In Acetylcholine Receptor Analysed | 2e-06 | ||
| 3aon_A | 217 | Crystal Structure Of The Central Axis (Ntpd-Ntpg) I | 4e-06 | ||
| 1oed_B | 250 | Structure Of Acetylcholine Receptor Pore From Elect | 5e-06 | ||
| 4aq5_B | 493 | Gating Movement In Acetylcholine Receptor Analysed | 5e-05 | ||
| 2bg9_B | 370 | Refined Structure Of The Nicotinic Acetylcholine Re | 5e-05 | ||
| 1oed_C | 260 | Structure Of Acetylcholine Receptor Pore From Elect | 6e-05 | ||
| 1dxz_A | 33 | M2 Transmembrane Segment Of Alpha-Subunit Of Nicoti | 2e-04 | ||
| 2ksr_A | 164 | Nmr Structures Of Tm Domain Of The N-Acetylcholine | 4e-04 |
| >pdb|4AQ5|A Chain A, Gating Movement In Acetylcholine Receptor Analysed By Time- Resolved Electron Cryo-Microscopy (Closed Class) Length = 461 | Back alignment and structure |
|
| >pdb|2BG9|A Chain A, Refined Structure Of The Nicotinic Acetylcholine Receptor At 4a Resolution. Length = 370 | Back alignment and structure |
| >pdb|4AQ5|C Chain C, Gating Movement In Acetylcholine Receptor Analysed By Time- Resolved Electron Cryo-Microscopy (Closed Class) Length = 522 | Back alignment and structure |
| >pdb|2BG9|C Chain C, Refined Structure Of The Nicotinic Acetylcholine Receptor At 4a Resolution Length = 369 | Back alignment and structure |
| >pdb|1OED|A Chain A, Structure Of Acetylcholine Receptor Pore From Electron Images Length = 227 | Back alignment and structure |
| >pdb|3A5C|G Chain G, Inter-Subunit Interaction And Quaternary Rearrangement Defined By The Central Stalk Of Prokaryotic V1-Atpase Length = 223 | Back alignment and structure |
| >pdb|3VR6|G Chain G, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 217 | Back alignment and structure |
| >pdb|2BG9|E Chain E, Refined Structure Of The Nicotinic Acetylcholine Receptor At 4a Resolution Length = 370 | Back alignment and structure |
| >pdb|4AQ5|E Chain E, Gating Movement In Acetylcholine Receptor Analysed By Time- Resolved Electron Cryo-Microscopy (Closed Class) Length = 488 | Back alignment and structure |
| >pdb|3AON|A Chain A, Crystal Structure Of The Central Axis (Ntpd-Ntpg) In The Catalytic Portion Of Enterococcus Hirae V-Type Sodium Atpase Length = 217 | Back alignment and structure |
| >pdb|1OED|B Chain B, Structure Of Acetylcholine Receptor Pore From Electron Images Length = 250 | Back alignment and structure |
| >pdb|4AQ5|B Chain B, Gating Movement In Acetylcholine Receptor Analysed By Time- Resolved Electron Cryo-Microscopy (Closed Class) Length = 493 | Back alignment and structure |
| >pdb|2BG9|B Chain B, Refined Structure Of The Nicotinic Acetylcholine Receptor At 4a Resolution Length = 370 | Back alignment and structure |
| >pdb|1OED|C Chain C, Structure Of Acetylcholine Receptor Pore From Electron Images Length = 260 | Back alignment and structure |
| >pdb|1DXZ|A Chain A, M2 Transmembrane Segment Of Alpha-Subunit Of Nicotinic Acetylcholine Receptor From Torpedo Californica, Nmr, 20 Structures Length = 33 | Back alignment and structure |
| >pdb|2KSR|A Chain A, Nmr Structures Of Tm Domain Of The N-Acetylcholine Receptor B2 Subunit Length = 164 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 309 | |||
| 4aq5_A | 461 | Acetylcholine receptor subunit alpha; membrane pro | 6e-46 | |
| 2bg9_A | 370 | Acetylcholine receptor protein, alpha chain; ION c | 4e-43 | |
| 3tlw_A | 321 | GLR4197 protein, GLIC; Cys-loop receptor family, m | 8e-42 | |
| 2bg9_E | 370 | Acetylcholine receptor protein, gamma chain; ION c | 8e-40 | |
| 2bg9_B | 370 | Acetylcholine receptor protein, beta chain; ION ch | 9e-40 | |
| 2bg9_C | 369 | Acetylcholine receptor protein, delta chain; ION c | 2e-39 | |
| 4aq5_C | 522 | Acetylcholine receptor delta subunit; membrane pro | 6e-38 | |
| 4aq5_B | 493 | Acetylcholine receptor beta subunit; membrane prot | 2e-36 | |
| 4aq5_E | 488 | Acetylcholine receptor gamma subunit; membrane pro | 1e-35 | |
| 2ksr_A | 164 | Neuronal acetylcholine receptor subunit beta-2; ni | 8e-35 | |
| 2lkg_A | 140 | Acetylcholine receptor; transmembrane domain, SIGN | 2e-31 | |
| 3rqw_A | 322 | ELIC pentameric ligand gated ION channel from ERW | 6e-30 | |
| 2lly_A | 137 | Neuronal acetylcholine receptor subunit alpha-4; t | 9e-27 | |
| 3rhw_A | 347 | Avermectin-sensitive glutamate-gated chloride CHA | 6e-26 | |
| 3aon_A | 217 | V-type sodium ATPase subunit D; V-ATPase, coiled-c | 2e-23 | |
| 3a5c_G | 223 | V-type ATP synthase subunit D; V-ATPase, asymmetri | 4e-23 | |
| 2wn9_A | 228 | Soluble acetylcholine receptor; 4-0H-DMXBA, acetyl | 5e-23 | |
| 1oed_B | 250 | Acetylcholine receptor protein, beta chain; ION ch | 7e-23 | |
| 4afh_A | 230 | ACHBP; acetylcholine-binding protein, nicotinic re | 1e-22 | |
| 1oed_A | 227 | Acetylcholine receptor protein, alpha chain; ION c | 1e-22 | |
| 1oed_C | 260 | Acetylcholine receptor protein, delta chain; ION c | 1e-22 | |
| 1oed_E | 260 | Acetylcholine receptor protein, gamma chain; ION c | 1e-19 | |
| 1uw6_A | 211 | Acetylcholine-binding protein; pentamer, IGG fold, | 1e-18 | |
| 2qc1_B | 212 | Acetylcholine receptor subunit alpha; nicotinic ac | 5e-17 | |
| 2bj0_A | 203 | Acetylcholine-binding protein; 3D-structure, glyco | 4e-16 | |
| 3sq6_A | 204 | ACHBP, neuronal acetylcholine receptor subunit alp | 4e-14 | |
| 3igq_A | 201 | GLR4197 protein; plgic Cys-loop, membrane protein, | 6e-14 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 5e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-04 |
| >4aq5_A Acetylcholine receptor subunit alpha; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_A Length = 461 | Back alignment and structure |
|---|
Score = 160 bits (406), Expect = 6e-46
Identities = 48/113 (42%), Positives = 79/113 (69%), Gaps = 1/113 (0%)
Query: 57 QLDLLKEREEGDTTNYQVNGEFDLLSYSSVKNVVNYSCCVE-PYPDITYYISLRRRPMFY 115
++ + E + D + + +GE+ + Y K+ V Y+CC + PY DITY+ ++R P+++
Sbjct: 179 KVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRIPLYF 238
Query: 116 VFNLILPCILINCIALLVFYVPSESGEKVTLGISALLSMTVFLMTIRETLPPT 168
V N+I+PC+L + + +LVFY+P++SGEK+TL IS LLS+TVFL+ I E +P T
Sbjct: 239 VVNVIIPCLLFSFLTVLVFYLPTDSGEKMTLSISVLLSLTVFLLVIVELIPST 291
|
| >2bg9_A Acetylcholine receptor protein, alpha chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Length = 370 | Back alignment and structure |
|---|
| >3tlw_A GLR4197 protein, GLIC; Cys-loop receptor family, membrane protein, transport protei; HET: LMT; 2.60A {Gloeobacter violaceus} PDB: 3uu4_A* 3uub_A* 3tlv_A* 3uu6_A* 3uu5_A* 3uu3_A* 3tlu_A* 3uu8_A* 3tls_A* 3tlt_A* 3p4w_A* 3p50_A* 3eam_A* 3ehz_A 2xq4_A 2xq5_A 2xq6_A 2xq3_A 2xq8_A 2xqa_A ... Length = 321 | Back alignment and structure |
|---|
| >2bg9_E Acetylcholine receptor protein, gamma chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Length = 370 | Back alignment and structure |
|---|
| >2bg9_B Acetylcholine receptor protein, beta chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Length = 370 | Back alignment and structure |
|---|
| >2bg9_C Acetylcholine receptor protein, delta chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Length = 369 | Back alignment and structure |
|---|
| >4aq5_C Acetylcholine receptor delta subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_C Length = 522 | Back alignment and structure |
|---|
| >4aq5_B Acetylcholine receptor beta subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_B Length = 493 | Back alignment and structure |
|---|
| >4aq5_E Acetylcholine receptor gamma subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_E Length = 488 | Back alignment and structure |
|---|
| >2ksr_A Neuronal acetylcholine receptor subunit beta-2; nicotinic acetylcholine receptors, transmembrane domain, HFI junction, cell membrane; NMR {Homo sapiens} PDB: 2lm2_A Length = 164 | Back alignment and structure |
|---|
| >2lkg_A Acetylcholine receptor; transmembrane domain, SIGN protein; NMR {Torpedo marmorata} PDB: 2lkh_A Length = 140 | Back alignment and structure |
|---|
| >3rqw_A ELIC pentameric ligand gated ION channel from ERW chrysanthemi; membrane, transport protein; HET: ACH MES; 2.91A {Dickeya dadantii} PDB: 3rqu_A* 3uq4_A 3uq5_A 3uq7_A 2vl0_A 2yks_A Length = 322 | Back alignment and structure |
|---|
| >2lly_A Neuronal acetylcholine receptor subunit alpha-4; transmembrane domain, transport PROT; NMR {Homo sapiens} Length = 137 | Back alignment and structure |
|---|
| >3rhw_A Avermectin-sensitive glutamate-gated chloride CHA alpha; membrane protein, transport protein, Cys-loop receptor, LIGA ION channel, neurotransmitter receptor; HET: NAG IVM LMT UND; 3.26A {Caenorhabditis elegans} PDB: 3ri5_A* 3ria_A* 3rif_A* Length = 347 | Back alignment and structure |
|---|
| >3aon_A V-type sodium ATPase subunit D; V-ATPase, coiled-coil, alpha/beta fold, hydrol Na(+)-ATPase, NTPA3-NTPB3, NTPC, central AXIS; HET: MSE; 2.00A {Enterococcus hirae} Length = 217 | Back alignment and structure |
|---|
| >3a5c_G V-type ATP synthase subunit D; V-ATPase, asymmetric, rotation, vacuolar type, hydrolase, ATP synthesis, ATP-binding, hydrogen ION transport; HET: ADP; 4.51A {Thermus thermophilus} PDB: 3a5d_G 3j0j_G* Length = 223 | Back alignment and structure |
|---|
| >2wn9_A Soluble acetylcholine receptor; 4-0H-DMXBA, acetylcholine binding protein; HET: ZY5 NAG BMA MAN; 1.75A {Aplysia californica} PDB: 2wnj_A* 2wzy_A* 2x00_A* 3peo_A* 2pgz_A* 2ph9_A* 4dbm_A* 3c84_A* 2byq_A* 2byr_A* 2bys_A* 2wnc_A* 2wnl_A* 3c79_A* 2byn_A* 3pmz_A* 2x00_D* 2xnv_A* 2xnt_A* 2xnu_A* ... Length = 228 | Back alignment and structure |
|---|
| >1oed_B Acetylcholine receptor protein, beta chain; ION channel/receptor, ION channel, tubular crystal, transmembrane; 4.0A {Torpedo marmorata} SCOP: f.36.1.1 PDB: 2k58_B Length = 250 | Back alignment and structure |
|---|
| >4afh_A ACHBP; acetylcholine-binding protein, nicotinic receptor, ION chann; HET: NAG BMA MAN L0B; 1.88A {Capitella teleta} PDB: 4afg_A* Length = 230 | Back alignment and structure |
|---|
| >1oed_A Acetylcholine receptor protein, alpha chain; ION channel/receptor, ION channel, tubular crystal, transmembrane; 4.0A {Torpedo marmorata} SCOP: f.36.1.1 PDB: 1dxz_A 3mra_A 2k59_B Length = 227 | Back alignment and structure |
|---|
| >1oed_C Acetylcholine receptor protein, delta chain; ION channel/receptor, ION channel, tubular crystal, transmembrane; 4.0A {Torpedo marmorata} SCOP: f.36.1.1 PDB: 1a11_A 1cek_A 1eq8_A Length = 260 | Back alignment and structure |
|---|
| >1oed_E Acetylcholine receptor protein, gamma chain; ION channel/receptor, ION channel, tubular crystal, transmembrane; 4.0A {Torpedo marmorata} SCOP: f.36.1.1 Length = 260 | Back alignment and structure |
|---|
| >1uw6_A Acetylcholine-binding protein; pentamer, IGG fold, nicotine, glycoprotein; HET: NCT; 2.2A {Lymnaea stagnalis} SCOP: b.96.1.1 PDB: 1i9b_A* 1ux2_A* 3u8l_A* 1yi5_A 1uv6_A* 3u8k_A* 3u8j_B* 3u8m_A* 3u8n_A* 2zju_A* 2zjv_A* Length = 211 | Back alignment and structure |
|---|
| >2qc1_B Acetylcholine receptor subunit alpha; nicotinic acetylcholine receptor, glycosylated protein, beta sandwich, Cys-loop, buried hydrophilic residues; HET: NAG MAN; 1.94A {Mus musculus} PDB: 1l4w_B 1ljz_B Length = 212 | Back alignment and structure |
|---|
| >2bj0_A Acetylcholine-binding protein; 3D-structure, glycoprotein, glycprotein, IGG fold, immunoglobulin domain, pentamer, signal; HET: CXS; 2.0A {Bulinus truncatus} Length = 203 | Back alignment and structure |
|---|
| >3sq6_A ACHBP, neuronal acetylcholine receptor subunit alpha-7, acetylcholine-binding protein; nicotinic receptor; HET: EPJ NAG; 2.80A {Homo sapiens} PDB: 3sq9_A* Length = 204 | Back alignment and structure |
|---|
| >3igq_A GLR4197 protein; plgic Cys-loop, membrane protein, transport protein; 2.30A {Gloeobacter violaceus} Length = 201 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 309 | |||
| 4aq5_A | 461 | Acetylcholine receptor subunit alpha; membrane pro | 100.0 | |
| 2bg9_A | 370 | Acetylcholine receptor protein, alpha chain; ION c | 100.0 | |
| 2bg9_C | 369 | Acetylcholine receptor protein, delta chain; ION c | 100.0 | |
| 2bg9_E | 370 | Acetylcholine receptor protein, gamma chain; ION c | 100.0 | |
| 2bg9_B | 370 | Acetylcholine receptor protein, beta chain; ION ch | 100.0 | |
| 4aq5_B | 493 | Acetylcholine receptor beta subunit; membrane prot | 100.0 | |
| 4aq5_C | 522 | Acetylcholine receptor delta subunit; membrane pro | 100.0 | |
| 4aq5_E | 488 | Acetylcholine receptor gamma subunit; membrane pro | 100.0 | |
| 3tlw_A | 321 | GLR4197 protein, GLIC; Cys-loop receptor family, m | 100.0 | |
| 3rqw_A | 322 | ELIC pentameric ligand gated ION channel from ERW | 100.0 | |
| 3rhw_A | 347 | Avermectin-sensitive glutamate-gated chloride CHA | 100.0 | |
| 2ksr_A | 164 | Neuronal acetylcholine receptor subunit beta-2; ni | 99.91 | |
| 2lkg_A | 140 | Acetylcholine receptor; transmembrane domain, SIGN | 99.9 | |
| 2lly_A | 137 | Neuronal acetylcholine receptor subunit alpha-4; t | 99.87 | |
| 3igq_A | 201 | GLR4197 protein; plgic Cys-loop, membrane protein, | 99.85 | |
| 2qc1_B | 212 | Acetylcholine receptor subunit alpha; nicotinic ac | 99.84 | |
| 4aoe_A | 205 | Acetylcholine-binding protein type 2; ligand gated | 99.84 | |
| 4aod_A | 205 | Acetylcholine-binding protein type 1; ligand gated | 99.84 | |
| 1oed_A | 227 | Acetylcholine receptor protein, alpha chain; ION c | 99.81 | |
| 3sq6_A | 204 | ACHBP, neuronal acetylcholine receptor subunit alp | 99.81 | |
| 1oed_B | 250 | Acetylcholine receptor protein, beta chain; ION ch | 99.81 | |
| 1oed_E | 260 | Acetylcholine receptor protein, gamma chain; ION c | 99.8 | |
| 2wn9_A | 228 | Soluble acetylcholine receptor; 4-0H-DMXBA, acetyl | 99.8 | |
| 1oed_C | 260 | Acetylcholine receptor protein, delta chain; ION c | 99.8 | |
| 3a5c_G | 223 | V-type ATP synthase subunit D; V-ATPase, asymmetri | 99.79 | |
| 3aon_A | 217 | V-type sodium ATPase subunit D; V-ATPase, coiled-c | 99.78 | |
| 1uw6_A | 211 | Acetylcholine-binding protein; pentamer, IGG fold, | 99.78 | |
| 4afh_A | 230 | ACHBP; acetylcholine-binding protein, nicotinic re | 99.77 | |
| 2bj0_A | 203 | Acetylcholine-binding protein; 3D-structure, glyco | 99.75 | |
| 1vry_A | 76 | Glycine receptor alpha-1 chain; second transmembra | 98.99 | |
| 1mot_A | 28 | Glycine receptor alpha-1 chain; second transmembra | 91.35 |
| >4aq5_A Acetylcholine receptor subunit alpha; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-44 Score=348.85 Aligned_cols=200 Identities=33% Similarity=0.572 Sum_probs=175.5
Q ss_pred CCCceEEEEcceeE-EeeCCCCCCCCccc-eeeEEeeecCcccccccceeEeecCCcceeEEEecCCCCCccceeecCeE
Q psy12586 1 MNTEHATVDLPIRS-SKKPLPIRKIPSEI-KLSLTSEEWVPTYLRFPNLIIYFPLFLLQLDLLKEREEGDTTNYQVNGEF 78 (309)
Q Consensus 1 ~~dG~V~~~~~~~~-~~C~mdl~~fPfD~-~C~l~~~S~~p~~~~~~~~~~~~~~~~~~v~l~~~~~~~~~~~~~~~~eW 78 (309)
++||+|.|.+|+++ ++|+||+++||||+ +|+++|+|| +|+..++.+.+ ..+.+++++|..++||
T Consensus 135 ~~dG~V~~~~~~~~~s~C~mdl~~FPfD~Q~C~l~f~S~----~y~~~~v~l~~----------~~~~~~l~~~~~~~eW 200 (461)
T 4aq5_A 135 DYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIW----TYDGTKVSISP----------ESDRPDLSTFMESGEW 200 (461)
T ss_dssp CSBCCEEECCEEEEEEECCCCGGGSSSSCEEEEEEEEES----SCCTTTEEEEC----------CCCCCSGGGCCTTCSS
T ss_pred cCCccEEEeccccccccccccccCCCCccCccCeEEecc----ccCCceEEEEe----------ccccccHHhhhccCce
Confidence 48999999999999 99999999999999 999999999 77665555543 3456778889999999
Q ss_pred EEeeeeEEEEEEeccCCCC-CcceEEEEEEEEeecceEEEeeehhhHHHhhhheeeEEecCCCCceEEEEehhHHHHHHH
Q psy12586 79 DLLSYSSVKNVVNYSCCVE-PYPDITYYISLRRRPMFYVFNLILPCILINCIALLVFYVPSESGEKVTLGISALLSMTVF 157 (309)
Q Consensus 79 ~l~~~~~~~~~~~~~~~~~-~y~~l~~~~~l~R~~~~y~~~~iiP~~li~~ls~i~Fwlp~~~~~Ri~l~it~lLt~~~~ 157 (309)
++.+.+..++...|.||++ +|++++++|.++|+++||++++++||+++++++|++||+|+++++|+++|+|++|++++|
T Consensus 201 ~l~~~~~~~~~~~y~~~~~~~y~~l~~~~~l~R~~~~Y~i~l~iP~~liv~ls~lsF~Lp~~s~eRv~LgiT~LLt~tvf 280 (461)
T 4aq5_A 201 VMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRIPLYFVVNVIIPCLLFSFLTVLVFYLPTDSGEKMTLSISVLLSLTVF 280 (461)
T ss_dssp EEEEEEEEEEECCCSSSSSCCCEEEEEEEEEECCCTHHHHHHHHHHHHHHHHHHHHHHHHHHCGGGTTHHHHHHHHHHHH
T ss_pred EEeeeeeEEEEEeecCcCCCCcceEEEEEEEEecccceeeehhhhHHHHHHHHHheEeccccccceeehhHHHHHHHHHH
Confidence 9999999888888999988 999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHhhcCCCCc-c---ccchhhhhhhHHHHHHHHHhhcccceeeeCCccccccccccccccccc
Q psy12586 158 LMTIRETLPPTE-N---ISEYVLVSSDHFRVKYIIVADELLPTRYRGRAQSQEFTLPEQVRPLAS 218 (309)
Q Consensus 158 l~~l~~~lP~~s-~---i~~y~~~~~~~v~~s~ii~~~~v~n~~~r~~~~~~~~~l~~~l~~la~ 218 (309)
+..+++.+|++| + ||+|+++||+++++| ++.+++|+|+++|++.. +++|.|++++.-
T Consensus 281 l~~v~~~LP~tS~~vplI~~y~~~~m~~v~~s-ll~tv~Vl~l~~r~~~~---~~mp~w~r~~~l 341 (461)
T 4aq5_A 281 LLVIVELIPSTSSAVPLIGKYMLFTMIFVISS-IIVTVVVINTHHRSPST---HTMPQWVRKIFI 341 (461)
T ss_dssp HHHHHHHHHHHHHHSCCCGGGHHHHHHHHHHH-HHHHHHHHHHHHCCTTT---C-----------
T ss_pred HHHHHhhcCcccCCcCHHHHHHHHHHHHHHHH-HHHHhhheeeeccCCCC---CCCCHHHHHHHH
Confidence 999999999998 4 999999999999998 89999999999998765 789999998653
|
| >2bg9_A Acetylcholine receptor protein, alpha chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} | Back alignment and structure |
|---|
| >2bg9_C Acetylcholine receptor protein, delta chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} | Back alignment and structure |
|---|
| >2bg9_E Acetylcholine receptor protein, gamma chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} | Back alignment and structure |
|---|
| >2bg9_B Acetylcholine receptor protein, beta chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} | Back alignment and structure |
|---|
| >4aq5_B Acetylcholine receptor beta subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_B | Back alignment and structure |
|---|
| >4aq5_C Acetylcholine receptor delta subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_C | Back alignment and structure |
|---|
| >4aq5_E Acetylcholine receptor gamma subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_E | Back alignment and structure |
|---|
| >3tlw_A GLR4197 protein, GLIC; Cys-loop receptor family, membrane protein, transport protei; HET: LMT; 2.60A {Gloeobacter violaceus} PDB: 3uu4_A* 3uub_A* 3tlv_A* 3uu6_A* 3uu5_A* 3uu3_A* 3tlu_A* 3uu8_A* 3tls_A* 3tlt_A* 3p4w_A* 3p50_A* 3eam_A* 4f8h_A* 2xq4_A 2xq5_A 2xq6_A 2xq3_A 2xq8_A 2xqa_A ... | Back alignment and structure |
|---|
| >3rqw_A ELIC pentameric ligand gated ION channel from ERW chrysanthemi; membrane, transport protein; HET: ACH MES; 2.91A {Dickeya dadantii} PDB: 2yn6_A* 3rqu_A* 3uq4_A 3uq5_A 3uq7_A 2vl0_A 2yks_A 4a97_A* 4a96_A* 2yoe_A* 4a98_A* | Back alignment and structure |
|---|
| >3rhw_A Avermectin-sensitive glutamate-gated chloride CHA alpha; membrane protein, transport protein, Cys-loop receptor, LIGA ION channel, neurotransmitter receptor; HET: NAG IVM LMT UND; 3.26A {Caenorhabditis elegans} PDB: 3ri5_A* 3ria_A* 3rif_A* | Back alignment and structure |
|---|
| >2ksr_A Neuronal acetylcholine receptor subunit beta-2; nicotinic acetylcholine receptors, transmembrane domain, HFI junction, cell membrane; NMR {Homo sapiens} PDB: 2lm2_A | Back alignment and structure |
|---|
| >2lkg_A Acetylcholine receptor; transmembrane domain, SIGN protein; NMR {Torpedo marmorata} PDB: 2lkh_A | Back alignment and structure |
|---|
| >2lly_A Neuronal acetylcholine receptor subunit alpha-4; transmembrane domain, transport PROT; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3igq_A GLR4197 protein; plgic Cys-loop, membrane protein, transport protein; 2.30A {Gloeobacter violaceus} | Back alignment and structure |
|---|
| >2qc1_B Acetylcholine receptor subunit alpha; nicotinic acetylcholine receptor, glycosylated protein, beta sandwich, Cys-loop, buried hydrophilic residues; HET: NAG MAN; 1.94A {Mus musculus} PDB: 1l4w_B 1ljz_B | Back alignment and structure |
|---|
| >4aoe_A Acetylcholine-binding protein type 2; ligand gated ION channel, LGI Cys-loop receptor, ACHBP, ACHR, acetylcholin receptor; 5.80A {Biomphalaria glabrata} | Back alignment and structure |
|---|
| >4aod_A Acetylcholine-binding protein type 1; ligand gated ION channel, LGI Cys-loop receptor, ACHBP, ACHR, acetylcholine receptor; 6.00A {Biomphalaria glabrata} | Back alignment and structure |
|---|
| >1oed_A Acetylcholine receptor protein, alpha chain; ION channel/receptor, ION channel, tubular crystal, transmembrane; 4.0A {Torpedo marmorata} SCOP: f.36.1.1 PDB: 1dxz_A 3mra_A 2k59_B | Back alignment and structure |
|---|
| >3sq6_A ACHBP, neuronal acetylcholine receptor subunit alpha-7, acetylcholine-binding protein; nicotinic receptor; HET: EPJ NAG; 2.80A {Homo sapiens} SCOP: b.96.1.1 PDB: 3sq9_A* | Back alignment and structure |
|---|
| >1oed_B Acetylcholine receptor protein, beta chain; ION channel/receptor, ION channel, tubular crystal, transmembrane; 4.0A {Torpedo marmorata} SCOP: f.36.1.1 PDB: 2k58_B | Back alignment and structure |
|---|
| >1oed_E Acetylcholine receptor protein, gamma chain; ION channel/receptor, ION channel, tubular crystal, transmembrane; 4.0A {Torpedo marmorata} SCOP: f.36.1.1 | Back alignment and structure |
|---|
| >2wn9_A Soluble acetylcholine receptor; 4-0H-DMXBA, acetylcholine binding protein; HET: ZY5 NAG BMA MAN; 1.75A {Aplysia californica} PDB: 2wnj_A* 2wzy_A* 2x00_A* 3peo_A* 2pgz_A* 2ph9_A* 4dbm_A* 3c84_A* 2byq_A* 2byr_A* 2bys_A* 2wnc_A* 2wnl_A* 3c79_A* 2byn_A* 3pmz_A* 2x00_D* 2xnv_A* 2xnt_A* 2xnu_A* ... | Back alignment and structure |
|---|
| >1oed_C Acetylcholine receptor protein, delta chain; ION channel/receptor, ION channel, tubular crystal, transmembrane; 4.0A {Torpedo marmorata} SCOP: f.36.1.1 PDB: 1a11_A 1cek_A 1eq8_A | Back alignment and structure |
|---|
| >3a5c_G V-type ATP synthase subunit D; V-ATPase, asymmetric, rotation, vacuolar type, hydrolase, ATP synthesis, ATP-binding, hydrogen ION transport; HET: ADP; 4.51A {Thermus thermophilus} PDB: 3a5d_G 3j0j_G* | Back alignment and structure |
|---|
| >3aon_A V-type sodium ATPase subunit D; V-ATPase, coiled-coil, alpha/beta fold, hydrol Na(+)-ATPase, NTPA3-NTPB3, NTPC, central AXIS; HET: MSE; 2.00A {Enterococcus hirae} | Back alignment and structure |
|---|
| >1uw6_A Acetylcholine-binding protein; pentamer, IGG fold, nicotine, glycoprotein; HET: NCT; 2.2A {Lymnaea stagnalis} SCOP: b.96.1.1 PDB: 1i9b_A* 1ux2_A* 3u8l_A* 1yi5_A 1uv6_A* 3u8k_A* 3u8j_B* 3u8m_A* 3u8n_A* 2zju_A* 2zjv_A* | Back alignment and structure |
|---|
| >4afh_A ACHBP; acetylcholine-binding protein, nicotinic receptor, ION chann; HET: NAG BMA MAN L0B; 1.88A {Capitella teleta} PDB: 4afg_A* 4b5d_A* | Back alignment and structure |
|---|
| >2bj0_A Acetylcholine-binding protein; 3D-structure, glycoprotein, glycprotein, IGG fold, immunoglobulin domain, pentamer, signal; HET: CXS; 2.0A {Bulinus truncatus} | Back alignment and structure |
|---|
| >1vry_A Glycine receptor alpha-1 chain; second transmembrane domain, third transmembrane domain, membrane protein; NMR {Homo sapiens} SCOP: j.35.1.1 | Back alignment and structure |
|---|
| >1mot_A Glycine receptor alpha-1 chain; second transmembrane domain, micelles, membrane protein; NMR {Homo sapiens} SCOP: j.35.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 309 | ||||
| d1oedc_ | 260 | f.36.1.1 (C:) Acetylcholine receptor protein, delt | 2e-23 | |
| d1oedb_ | 250 | f.36.1.1 (B:) Acetylcholine receptor protein, beta | 3e-23 | |
| d1oeda_ | 227 | f.36.1.1 (A:) Acetylcholine receptor protein, alph | 4e-23 | |
| d1oede_ | 260 | f.36.1.1 (E:) Acetylcholine receptor protein, gamm | 2e-21 | |
| d1uw6a_ | 208 | b.96.1.1 (A:) Acetylcholine binding protein (ACHBP | 1e-13 |
| >d1oedc_ f.36.1.1 (C:) Acetylcholine receptor protein, delta chain {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 260 | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Neurotransmitter-gated ion-channel transmembrane pore superfamily: Neurotransmitter-gated ion-channel transmembrane pore family: Neurotransmitter-gated ion-channel transmembrane pore domain: Acetylcholine receptor protein, delta chain species: Marbled electric ray (Torpedo marmorata) [TaxId: 7788]
Score = 94.5 bits (234), Expect = 2e-23
Identities = 32/79 (40%), Positives = 47/79 (59%), Gaps = 3/79 (3%)
Query: 112 PMFYVFNLILPCILINCIALLVFYVPSESGEKVTLGISALLSMTVFLMTIRETLPPTENI 171
P+FYV N I PC+LI+ +A L FY+P+ESGEK++ IS LL+ VFL+ + LP T
Sbjct: 1 PLFYVINFITPCVLISFLASLAFYLPAESGEKMSTAISVLLAQAVFLLLTSQRLPET--- 57
Query: 172 SEYVLVSSDHFRVKYIIVA 190
+ V + + +V
Sbjct: 58 ALAVPLIGKYLMFIMSLVT 76
|
| >d1oedb_ f.36.1.1 (B:) Acetylcholine receptor protein, beta chain {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 250 | Back information, alignment and structure |
|---|
| >d1oeda_ f.36.1.1 (A:) Acetylcholine receptor protein, alpha chain {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 227 | Back information, alignment and structure |
|---|
| >d1oede_ f.36.1.1 (E:) Acetylcholine receptor protein, gamma chain {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 260 | Back information, alignment and structure |
|---|
| >d1uw6a_ b.96.1.1 (A:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} Length = 208 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 309 | |||
| d1oedc_ | 260 | Acetylcholine receptor protein, delta chain {Marbl | 99.82 | |
| d1oede_ | 260 | Acetylcholine receptor protein, gamma chain {Marbl | 99.81 | |
| d1oeda_ | 227 | Acetylcholine receptor protein, alpha chain {Marbl | 99.8 | |
| d1oedb_ | 250 | Acetylcholine receptor protein, beta chain {Marble | 99.8 | |
| d1uw6a_ | 208 | Acetylcholine binding protein (ACHBP) {Great pond | 99.76 |
| >d1oedc_ f.36.1.1 (C:) Acetylcholine receptor protein, delta chain {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Neurotransmitter-gated ion-channel transmembrane pore superfamily: Neurotransmitter-gated ion-channel transmembrane pore family: Neurotransmitter-gated ion-channel transmembrane pore domain: Acetylcholine receptor protein, delta chain species: Marbled electric ray (Torpedo marmorata) [TaxId: 7788]
Probab=99.82 E-value=2.6e-23 Score=184.01 Aligned_cols=103 Identities=36% Similarity=0.641 Sum_probs=85.6
Q ss_pred cceEEEeeehhhHHHhhhheeeEEecCCCCceEEEEehhHHHHHHHHHHHhhcCCCCcc----ccchhhhhhhHHHHHHH
Q psy12586 112 PMFYVFNLILPCILINCIALLVFYVPSESGEKVTLGISALLSMTVFLMTIRETLPPTEN----ISEYVLVSSDHFRVKYI 187 (309)
Q Consensus 112 ~~~y~~~~iiP~~li~~ls~i~Fwlp~~~~~Ri~l~it~lLt~~~~l~~l~~~lP~~s~----i~~y~~~~~~~v~~s~i 187 (309)
|+||++++++||+++++++|++||+|+|+|||+++|+|++|++++|+..+++.+|++|+ ||+|+++||++++++ +
T Consensus 1 pl~y~~n~~~P~~~~~~l~~~~f~lp~~~~~r~~l~it~lLs~~vf~~~v~~~lP~tS~~vPli~~y~~~~~~~v~~s-~ 79 (260)
T d1oedc_ 1 PLFYVINFITPCVLISFLASLAFYLPAESGEKMSTAISVLLAQAVFLLLTSQRLPETALAVPLIGKYLMFIMSLVTGV-I 79 (260)
T ss_dssp CTHHHHHHHHHHHHHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCCTHHHHHHHHHHHHH-H
T ss_pred CceEEEhHHHHHHHHHHHHHHHeeeCCCCCCcEEeeHHHHHHHHHHHHHHHHhCCCCCCCcchHHHHHHHHHHHHHHH-H
Confidence 78999999999999999999999999999999999999999999999999999999985 899999999999998 8
Q ss_pred HHhhcccceeeeCCccccccccccccccccc
Q psy12586 188 IVADELLPTRYRGRAQSQEFTLPEQVRPLAS 218 (309)
Q Consensus 188 i~~~~v~n~~~r~~~~~~~~~l~~~l~~la~ 218 (309)
+.+++|+|+++|++.. +++|.|++++.-
T Consensus 80 ~~t~~Vl~~~~~~~~~---~~~p~w~R~~~l 107 (260)
T d1oedc_ 80 VNCGIVLNFHFRTPST---HVLSTRVKQIFL 107 (260)
T ss_dssp HHHHHHHHHHHHC------------------
T ss_pred HHHHhheeeeeccccc---CccchHHHHHHH
Confidence 9999999999998654 679999997653
|
| >d1oede_ f.36.1.1 (E:) Acetylcholine receptor protein, gamma chain {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d1oeda_ f.36.1.1 (A:) Acetylcholine receptor protein, alpha chain {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d1oedb_ f.36.1.1 (B:) Acetylcholine receptor protein, beta chain {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d1uw6a_ b.96.1.1 (A:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} | Back information, alignment and structure |
|---|