Psyllid ID: psy12594


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540--
MSRKSVKNSIDHYQRARLCFVQTMSAFADKPSTIHFLKDLNVVDLIVPLLADKVPSIQHAALATLGKLMCAKHVDIRQEVLERNLVALVLKDLTKQNKHYKKTALHMLTCVAQQDERCAGLIEDKDLDSIISSLHDFDPDTRANAALALGGLAKDNKHFAERIVQCGALPPLVQILASPQLSLKHAAAFALDGIVKHSPELAESASDCDVIPLLIKALNNDEVNVKADAFLCLADIAKDSPSLASTIADGATTLAVEHLTYPHGLVQKNAATLLRDMCKHNLRLANLVVLAGGLDGLLRLIDCNGGYNSLPAIMALGYMSAQSEQIAEQIIELQGVGSLQTILQCPHKEQLQVAAAWTLGQIGKHSVDNVTALCEENVLSTLLSKITQTCVSDNLKSKCKNALNILIPKCENPKELEQMLLGNVSEELLASILCAFAKILPCDPVARRSFVTSHCLRKVQEIEPTPEIAPHLKTINACFPNEVIHFVSPHYLEDLINRLDQFNPQKSSNLPDCKDSGSGNPSGSAQSLQRSEASTTSTASIY
ccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHccHHHHHHccccccHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcHHHHHHHcccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccc
cccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHcccccccccEEEccccHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHcccccccccHHHHHHHHHHcHHHHHHHHcccccHHHHHHHHHHcccHHHHHHccccccHHHHHHHHHHcccHHHcccccccccccccccccccccccccccccccEEc
MSRKSVKNSIDHYQRARLCFVQTmsafadkpstihflkdlnvVDLIVPlladkvpsIQHAALATLGKLMCAKHVDIRQEVLERNLVALVLKDLTKQNKHYKKTALHMLTCVAQQDErcagliedkdlDSIIsslhdfdpdtRANAALALGGLAKDNKHFAERIVqcgalpplvqilaspqlsLKHAAAFALDGivkhspelaesasdcdvIPLLIKALnndevnvkADAFLCLADiakdspslasTIADGATTLAVehltyphglvqKNAATLLRDMCKHNLRLANLVVLAGGLDGLLRlidcnggynslPAIMALGYMSAQSEQIAEQIIELQgvgslqtilqcphkEQLQVAAAWTLGQIGKHSVDNVTALCEENVLSTLLSKITQTCVSDNLKSKCKNALnilipkcenpKELEQMLLGNVSEELLASILCAFAkilpcdpvarrsfvtsHCLRkvqeieptpeiaphlktinacfpnevihfvsphYLEDLINRldqfnpqkssnlpdckdsgsgnpsgsaqslqrseasttstasiy
msrksvknsidHYQRARLCFVQTMSAFADKPSTIHFLKDLNVVDLIVPLLADKVPSIQHAALATLGKLMCAKHVDIRQEVLERNLVALVLKDLTKQNKHYKKTALHMLTCVAQQDERCAGLIEDKDLDSIISSLHDFDPDTRANAALALGGLAKDNKHFAERIVQCGALPPLVQILASPQLSLKHAAAFALDGIVKHSPELAESASDCDVIPLLIKALNNDEVNVKADAFLCLADIAKDSPSLASTIADGATTLAVEHLTYPHGLVQKNAATLLRDMCKHNLRLANLVVLAGGLDGLLRLIDCNGGYNSLPAIMALGYMSAQSEQIAEQIIELQGVGSLQTILQCPHKEQLQVAAAWTLGQIGKHSVDNVTALCEENVLSTLLSKITQTCVSDNLKSKCKNALNILIPKCENPKELEQMLLGNVSEELLASILCAFAKILPCDPVARRSFVTSHCLRKVQeieptpeiapHLKTINACFPNEVIHFVSPHYLEDLINRLDQFNPQKSSNLPDCKDSGSgnpsgsaqslqrseasttstasiy
MSRKSVKNSIDHYQRARLCFVQTMSAFADKPSTIHFLKDLNVVDLIVPLLADKVPSIQHAALATLGKLMCAKHVDIRQEVLERNLVALVLKDLTKQNKHYKKTALHMLTCVAQQDERCAGLIEDKDLDSIISSLHDFDPDTRanaalalgglaKDNKHFAERIVQCGALPPLVQILASPQLSLKHAAAFALDGIVKHSPELAESASDCDVIPLLIKALNNDEVNVKADAFLCLADIAKDSPSLASTIADGATTLAVEHLTYPHGLVQKNAATLLRDMCKHnlrlanlvvlaggldgllrlIDCNGGYNSLPAIMALGYMSAQSEQIAEQIIELQGVGSLQTILQCPHKEQLQVAAAWTLGQIGKHSVDNVTALCEENVLSTLLSKITQTCVSDNLKSKCKNALNILIPKCENPKELEQMLLGNVSEELLASILCAFAKILPCDPVARRSFVTSHCLRKVQEIEPTPEIAPHLKTINACFPNEVIHFVSPHYLEDLINRLDQFNPQKSSNLPDCKDSGSGNPSGSAQSLQRSEASTTSTASIY
**********DHYQRARLCFVQTMSAFADKPSTIHFLKDLNVVDLIVPLLADKVPSIQHAALATLGKLMCAKHVDIRQEVLERNLVALVLKDLTKQNKHYKKTALHMLTCVAQQDERCAGL************************ALALGGLAKDNKHFAERIVQCGALPPLVQILASPQLSLKHAAAFALDGIVKHSPELAESASDCDVIPLLIKALNNDEVNVKADAFLCLADIAKDSPSLASTIADGATTLAVEHLTYPHGLVQKNAATLLRDMCKHNLRLANLVVLAGGLDGLLRLIDCNGGYNSLPAIMALGYMSAQSEQIAEQIIELQGVGSLQTILQCPHKEQLQVAAAWTLGQIGKHSVDNVTALCEENVLSTLLSKITQTCVSDNLKSKCKNALNILIPKCENPKELEQMLLGNVSEELLASILCAFAKILPCDPVARRSFVTSHCLRKVQEIEPTPEIAPHLKTINACFPNEVIHFVSPHYLEDLINRLD******************************************
******K****HYQRARLCFVQTMSAFADKPSTIHFLKDLNVVDLIVPLLADKVPSIQHAALATLGKLMCAKHVDIRQEVLERNLVALVLKDLTKQNKHYKKTALHMLTCVAQQDERCAGLIEDKDLDSIISSLHDFDPDTRANAALALGGLAKDNKHFAERIVQCGALPPLVQILASPQLSLKHAAAFALDGIVKHSPELAESASDCDVIPLLIKALNNDEVNVKADAFLCLADIAKDSPSLASTIADGATTLAVEHLTYPHGLVQKNAATLLRDMCKHNLRLANLVVLAGGLDGLLRLIDCNGGYNSLPAIMALGYMSAQSEQIAEQIIELQGVGSLQTILQCPHKEQLQVAAAWTLGQIGKHSVDNVTALCEENVLSTLLSKITQTCVSDNLKSKCKNALNILIPKCENPKELEQMLLGNVSEELLASILCAFAKILPCDPVARRSFVTSHCLRKVQEIEPTPEIAPHLKTINACFPNEVIHFVSPHYLEDLINRLDQFNPQK************************************
**********DHYQRARLCFVQTMSAFADKPSTIHFLKDLNVVDLIVPLLADKVPSIQHAALATLGKLMCAKHVDIRQEVLERNLVALVLKDLTKQNKHYKKTALHMLTCVAQQDERCAGLIEDKDLDSIISSLHDFDPDTRANAALALGGLAKDNKHFAERIVQCGALPPLVQILASPQLSLKHAAAFALDGIVKHSPELAESASDCDVIPLLIKALNNDEVNVKADAFLCLADIAKDSPSLASTIADGATTLAVEHLTYPHGLVQKNAATLLRDMCKHNLRLANLVVLAGGLDGLLRLIDCNGGYNSLPAIMALGYMSAQSEQIAEQIIELQGVGSLQTILQCPHKEQLQVAAAWTLGQIGKHSVDNVTALCEENVLSTLLSKITQTCVSDNLKSKCKNALNILIPKCENPKELEQMLLGNVSEELLASILCAFAKILPCDPVARRSFVTSHCLRKVQEIEPTPEIAPHLKTINACFPNEVIHFVSPHYLEDLINRLDQFNPQKSSNL********************************
**RKSVKNSIDHYQRARLCFVQTMSAFADKPSTIHFLKDLNVVDLIVPLLADKVPSIQHAALATLGKLMCAKHVDIRQEVLERNLVALVLKDLTKQNKHYKKTALHMLTCVAQQDERCAGLIEDKDLDSIISSLHDFDPDTRANAALALGGLAKDNKHFAERIVQCGALPPLVQILASPQLSLKHAAAFALDGIVKHSPELAESASDCDVIPLLIKALNNDEVNVKADAFLCLADIAKDSPSLASTIADGATTLAVEHLTYPHGLVQKNAATLLRDMCKHNLRLANLVVLAGGLDGLLRLIDCNGGYNSLPAIMALGYMSAQSEQIAEQIIELQGVGSLQTILQCPHKEQLQVAAAWTLGQIGKHSVDNVTALCEENVLSTLLSKITQTCVSDNLKSKCKNALNILIPKCENPKELEQMLLGNVSEELLASILCAFAKILPCDPVARRSFVTSHCLRKVQEIEPTPEIAPHLKTINACFPNEVIHFVSPHYLEDLINRLDQFNPQKS***********************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRKSVKNSIDHYQRARLCFVQTMSAFADKPSTIHFLKDLNVVDLIVPLLADKVPSIQHAALATLGKLMCAKHVDIRQEVLERNLVALVLKDLTKQNKHYKKTALHMLTCVAQQDERCAGLIEDKDLDSIISSLHDFDPDTRANAALALGGLAKDNKHFAERIVQCGALPPLVQILASPQLSLKHAAAFALDGIVKHSPELAESASDCDVIPLLIKALNNDEVNVKADAFLCLADIAKDSPSLASTIADGATTLAVEHLTYPHGLVQKNAATLLRDMCKHNLRLANLVVLAGGLDGLLRLIDCNGGYNSLPAIMALGYMSAQSEQIAEQIIELQGVGSLQTILQCPHKEQLQVAAAWTLGQIGKHSVDNVTALCEENVLSTLLSKITQTCVSDNLKSKCKNALNILIPKCENPKELEQMLLGNVSEELLASILCAFAKILPCDPVARRSFVTSHCLRKVQEIEPTPEIAPHLKTINACFPNEVIHFVSPHYLEDLINRLDQFNPQKSSNLPDCKDSGSGNPSGSAQSLQRSEASTTSTASIY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query542 2.2.26 [Sep-21-2011]
Q9JLI7507 Sperm-associated antigen yes N/A 0.920 0.984 0.360 6e-80
O75602509 Sperm-associated antigen yes N/A 0.920 0.980 0.356 4e-79
Q59MN0585 Vacuolar protein 8 OS=Can N/A N/A 0.599 0.555 0.266 3e-08
O04294531 Importin subunit alpha-2 yes N/A 0.448 0.457 0.223 2e-07
Q6BTZ4560 Vacuolar protein 8 OS=Deb yes N/A 0.601 0.582 0.250 2e-07
Q71VM4526 Importin subunit alpha-1a yes N/A 0.444 0.458 0.268 5e-07
C0LLJ0499 Importin subunit alpha-8 no N/A 0.444 0.482 0.247 3e-06
Q6C5Y8573 Vacuolar protein 8 OS=Yar no N/A 0.571 0.541 0.243 6e-06
Q96321532 Importin subunit alpha-1 no N/A 0.440 0.449 0.224 1e-05
Q02821542 Importin subunit alpha OS yes N/A 0.415 0.415 0.209 1e-05
>sp|Q9JLI7|SPAG6_MOUSE Sperm-associated antigen 6 OS=Mus musculus GN=Spag6 PE=1 SV=1 Back     alignment and function desciption
 Score =  298 bits (764), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 184/511 (36%), Positives = 285/511 (55%), Gaps = 12/511 (2%)

Query: 1   MSRKSVKNSIDHYQRARLCFVQTMSAFADKPSTIHFLKDLNVVDLIVPLLADKVPSIQHA 60
           MS++ V    + YQ+AR  FVQ ++  A +P  I  L++  V+ L+ PLL D VP+IQ  
Sbjct: 1   MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQNAGVMSLLRPLLLDVVPTIQQT 60

Query: 61  ALATLGKLMCAKHVDIRQEVLERNLVALVLKDLTKQNKHYKKTALHMLTCVAQQDERCAG 120
           A   LG+L    + D+ + V++ +++  ++  L +QN+ YKK A  +L  V +   + A 
Sbjct: 61  AALALGRL-ANYNDDLAEAVVKGDILPQLVYSLAEQNRFYKKAAAFVLRAVGKHSPQLAQ 119

Query: 121 LIED-KDLDSIISSLHDFDPDTRANAALALGGLAKDNKHFAERIVQCGALPPLVQILASP 179
            I D   LD+++  L DFDP  +  AA ALG +A+ N   ++ +V  GA+P LV  +  P
Sbjct: 120 AIVDCGALDTLVICLEDFDPGVKEAAAWALGYIARHNTELSQAVVDAGAIPLLVLCIQEP 179

Query: 180 QLSLKHAAAFALDGIVKHSPELAESASDCDVIPLLIKALNNDEVNVKADAFLCLADIAKD 239
           +++LK  AA AL  I KHSPELA++  D   I  L + + N +  +K      L+ IAK 
Sbjct: 180 EIALKRIAASALSDISKHSPELAQTVVDAGAIAHLAQMILNPDAKLKRQVLSALSQIAKH 239

Query: 240 SPSLASTIADGAT-TLAVEHLTYPHGLVQKNAATLLRDMCKHNLRLANLVVLAGGLDGLL 298
           S  LA  + +     + +  L      V+KNA TL+R++ KH   L+ L+V AGG+  + 
Sbjct: 240 SVDLAEMVVEAEIFPVVLTCLKDKDEYVKKNACTLIREIAKHTPELSQLIVNAGGVAAV- 298

Query: 299 RLIDCNG---GYNSLPAIMALGYMSAQSEQIAEQIIELQGVGSLQTILQCPHKEQLQVAA 355
             IDC G   G   LP IM LGY++A SE +A  +I  +GV  L   L    ++ ++ AA
Sbjct: 299 --IDCIGSCKGNIRLPGIMMLGYVAAHSENLAMAVIISKGVPQLSICLSEEPEDHIKAAA 356

Query: 356 AWTLGQIGKHSVDNVTALCEENVLSTLLSKITQTCVSDNLKSKCKNALNILIPKCENPKE 415
           AW LGQ+G+H+ ++  A+   N L  LLS       S++L+ K K A+  ++ KC     
Sbjct: 357 AWALGQLGRHTPEHARAVAVTNTLPVLLSLYMSPESSEDLQLKSKKAIKNILQKCTYLPA 416

Query: 416 LEQMLLGNVSEELLASILCAFAKILPCDPVARRSFVTSHCLRKVQEI--EPTPEIAPHLK 473
           LE  L  +    +L  ++  F+K+LP D  ARR FVTS  L+KVQEI  EP   +  ++ 
Sbjct: 417 LEPFLY-DAPPNILKHVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYIN 475

Query: 474 TINACFPNEVIHFVSPHYLEDLINRLDQFNP 504
           +IN C+P E++ + SP Y + L+ R+D + P
Sbjct: 476 SINNCYPEEIVRYYSPGYSDTLLQRVDSYQP 506




Important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.
Mus musculus (taxid: 10090)
>sp|O75602|SPAG6_HUMAN Sperm-associated antigen 6 OS=Homo sapiens GN=SPAG6 PE=2 SV=1 Back     alignment and function description
>sp|Q59MN0|VAC8_CANAL Vacuolar protein 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VAC8 PE=3 SV=3 Back     alignment and function description
>sp|O04294|IMA2_ARATH Importin subunit alpha-2 OS=Arabidopsis thaliana GN=KAP2 PE=1 SV=2 Back     alignment and function description
>sp|Q6BTZ4|VAC8_DEBHA Vacuolar protein 8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VAC8 PE=3 SV=4 Back     alignment and function description
>sp|Q71VM4|IMA1A_ORYSJ Importin subunit alpha-1a OS=Oryza sativa subsp. japonica GN=Os01g0253300 PE=1 SV=2 Back     alignment and function description
>sp|C0LLJ0|IMA8_MOUSE Importin subunit alpha-8 OS=Mus musculus GN=Kpna7 PE=1 SV=1 Back     alignment and function description
>sp|Q6C5Y8|VAC8_YARLI Vacuolar protein 8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VAC8 PE=3 SV=1 Back     alignment and function description
>sp|Q96321|IMA1_ARATH Importin subunit alpha-1 OS=Arabidopsis thaliana GN=KAP1 PE=1 SV=2 Back     alignment and function description
>sp|Q02821|IMA1_YEAST Importin subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query542
350420772535 PREDICTED: sperm-associated antigen 6-li 0.928 0.940 0.404 2e-93
328786124535 PREDICTED: sperm-associated antigen 6-li 0.928 0.940 0.398 3e-92
307184404 644 Sperm-associated antigen 6 [Camponotus f 0.909 0.765 0.389 5e-89
340724052495 PREDICTED: sperm-associated antigen 6-li 0.902 0.987 0.404 7e-88
380021974489 PREDICTED: sperm-associated antigen 6-li 0.894 0.991 0.399 2e-87
383854770534 PREDICTED: sperm-associated antigen 6-li 0.933 0.947 0.375 4e-86
405950834508 Sperm-associated antigen 6 [Crassostrea 0.929 0.992 0.378 8e-86
146085436510 putative axoneme central apparatus prote 0.931 0.990 0.366 1e-85
157868683510 putative axoneme central apparatus prote 0.931 0.990 0.364 2e-85
389603936 653 putative axoneme central apparatus prote 0.931 0.773 0.360 5e-85
>gi|350420772|ref|XP_003492620.1| PREDICTED: sperm-associated antigen 6-like [Bombus impatiens] Back     alignment and taxonomy information
 Score =  349 bits (896), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 206/509 (40%), Positives = 297/509 (58%), Gaps = 6/509 (1%)

Query: 1   MSRKSVKNSIDHYQRARLCFVQTMSAFADKPSTIHFLKDLNVVDLIVPLLADKVPSIQHA 60
           M+ +S+    D YQ+ARL FVQ+++ FA KP+TI  L+   V+DL+ PLL D VPSIQH 
Sbjct: 1   MTARSILQVFDQYQKARLFFVQSIADFASKPNTIDCLEAAGVLDLLCPLLTDPVPSIQHT 60

Query: 61  ALATLGKLMCAKHVDIRQEVLERNLVALVLKDLTKQNKHYKKTALHMLTCVAQQDERCAG 120
           A   LGKL     + + Q V+   ++  +LK++ KQNK YKK AL +L  +A+     A 
Sbjct: 61  AAVALGKL-ANNSMKLAQAVVRMGILPQLLKNIDKQNKFYKKAALFVLRAIARHSPELAS 119

Query: 121 L-IEDKDLDSIISSLHDFDPDTRANAALALGGLAKDNKHFAERIVQCGALPPLVQILASP 179
           + I++  LD+II  L DFD   +   A ALG +A+ NK  A+ IV  GA+P LV  L  P
Sbjct: 120 MVIQNNGLDTIIICLEDFDSGVKEATAWALGYIARHNKTLAQAIVDAGAVPLLVLALQEP 179

Query: 180 QLSLKHAAAFALDGIVKHSPELAESASDCDVIPLLIKALNNDEVNVKADAFLCLADIAKD 239
           +L LK  +A AL  I KH+ +LAE+  D   IP L KAL+N +  +K    L L+ IAK 
Sbjct: 180 ELCLKQISASALFDISKHNIDLAETVVDAGAIPFLAKALSNPDTKLKRQVLLALSSIAKH 239

Query: 240 SPSLASTIADGATTLAV-EHLTYPHGLVQKNAATLLRDMCKHNLRLANLVVLAGGLDGLL 298
           S  LA +I +      V  H+ +P   V K AA L R++CKH L LA L+V  GG+  L+
Sbjct: 240 SVHLAESIIEAEVFPDVLVHMAHPDECVVKAAAMLTREICKHTLELAQLIVNIGGIGALV 299

Query: 299 RLIDCNGGYNSLPAIMALGYMSAQSEQIAEQIIELQGVGSLQTILQCPHKEQLQVAAAWT 358
            LI  +     LPAIMA+GY++   +Q+A  +I  +G+  L TIL   + +       W 
Sbjct: 300 ELISTSKLTVRLPAIMAIGYIAGHLDQLAIAVIGSKGIVHLSTILYEENDDHTLAVTVWA 359

Query: 359 LGQIGKHSVDNVTALCEENVLSTLLSKITQTCVSDNLKSKCKNALNILIPKCENPKELEQ 418
           +GQIGKH+ ++  A+   N+L  LL        S++LK+KC  AL  ++ KC   + LE 
Sbjct: 360 IGQIGKHTSEHAKAVAVANILPKLLQLYNNPNSSEDLKAKCNTALKQILQKCMYIEALES 419

Query: 419 MLLGNVSEELLASILCAFAKILPCDPVARRSFVTSHCLRKVQEIE--PTPEIAPHLKTIN 476
            LL +    +L  +L  F+KILP DP ARR FVTS  L+KVQEI+  P   +  +++ IN
Sbjct: 420 -LLHDSPPNILKYVLGQFSKILPHDPRARRLFVTSGGLKKVQEIQADPGSTLLEYIQIIN 478

Query: 477 ACFPNEVIHFVSPHYLEDLINRLDQFNPQ 505
            CFP+E++ + SP Y   L+  ++Q+ P+
Sbjct: 479 CCFPDEIVRYYSPGYPNSLLEAVEQYQPK 507




Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328786124|ref|XP_394968.3| PREDICTED: sperm-associated antigen 6-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|307184404|gb|EFN70813.1| Sperm-associated antigen 6 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340724052|ref|XP_003400399.1| PREDICTED: sperm-associated antigen 6-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380021974|ref|XP_003694830.1| PREDICTED: sperm-associated antigen 6-like [Apis florea] Back     alignment and taxonomy information
>gi|383854770|ref|XP_003702893.1| PREDICTED: sperm-associated antigen 6-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|405950834|gb|EKC18795.1| Sperm-associated antigen 6 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|146085436|ref|XP_001465274.1| putative axoneme central apparatus protein [Leishmania infantum JPCM5] gi|398014591|ref|XP_003860486.1| axoneme central apparatus protein, putative [Leishmania donovani] gi|134069371|emb|CAM67523.1| putative axoneme central apparatus protein [Leishmania infantum JPCM5] gi|322498707|emb|CBZ33780.1| axoneme central apparatus protein, putative [Leishmania donovani] Back     alignment and taxonomy information
>gi|157868683|ref|XP_001682894.1| putative axoneme central apparatus protein [Leishmania major strain Friedlin] gi|68126350|emb|CAJ04349.1| putative axoneme central apparatus protein [Leishmania major strain Friedlin] Back     alignment and taxonomy information
>gi|389603936|ref|XP_003723113.1| putative axoneme central apparatus protein [Leishmania braziliensis MHOM/BR/75/M2904] gi|322504855|emb|CBZ14641.1| putative axoneme central apparatus protein [Leishmania braziliensis MHOM/BR/75/M2904] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query542
UNIPROTKB|E1C6P7508 SPAG6 "Uncharacterized protein 0.920 0.982 0.342 6.5e-74
RGD|1310892507 Spag6 "sperm associated antige 0.928 0.992 0.335 4.1e-72
UNIPROTKB|Q32L54509 SPAG6 "Sperm associated antige 0.924 0.984 0.337 1.1e-71
UNIPROTKB|C1JEX7509 SPAG6 "Sperm associated antige 0.924 0.984 0.335 2.9e-71
UNIPROTKB|O75602509 SPAG6 "Sperm-associated antige 0.920 0.980 0.332 3.7e-71
MGI|MGI:1354388507 Spag6 "sperm associated antige 0.924 0.988 0.333 4.8e-71
POMBASE|SPCC962.03c542 cut15 "karyopherin Cut15" [Sch 0.793 0.793 0.212 4.9e-07
TAIR|locus:505006475535 IMPA-2 "importin alpha isoform 0.215 0.218 0.25 8.4e-07
UNIPROTKB|E1C8F9 876 E1C8F9 "Uncharacterized protei 0.468 0.289 0.229 9.6e-07
TAIR|locus:2196140539 IMPA-6 "importin alpha isoform 0.485 0.487 0.207 3.6e-06
UNIPROTKB|E1C6P7 SPAG6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 746 (267.7 bits), Expect = 6.5e-74, P = 6.5e-74
 Identities = 175/511 (34%), Positives = 273/511 (53%)

Query:     1 MSRKSVKNSIDHYQRARLCFVQTMSAFADKPSTIHFLKDLNVVDLIVPLLADKVPSIQHA 60
             MS++ V    + YQ AR  FVQ ++  + +P  I  L++  V+ L+ PLL D VP+IQ  
Sbjct:     1 MSQRQVLQVFEQYQSARTHFVQAVAELSARPQNIGTLREAGVISLLRPLLLDVVPTIQQT 60

Query:    61 ALATLGKLMCAKHVDIRQEVLERNLVALVLKDLTKQNKHYKKTALHMLTCVAQQDERCA- 119
             A   LG+L      D+ + V++ +++  ++  L++QN+ YKK A  +L  V +   + A 
Sbjct:    61 AALALGRLAYFND-DLAEAVVKEDILPQLVCSLSEQNRFYKKAAAFVLRAVGKHSPQLAQ 119

Query:   120 GLIEDKDLDSIISSLHDFDPDTRXXXXXXXXXXXKDNKHFAERIVQCGALPPLVQILASP 179
              ++E   L++++  L DFDP  +           + N   ++ +V  GA+P LV  +  P
Sbjct:   120 AIVECGALEALVICLEDFDPGVKEGAAWALGYIARHNSELSQAVVDAGAVPLLVLCIQEP 179

Query:   180 QLSLKHAAAFALDGIVKHSPELAESASDCDVIPLLIKALNNDEVNVKADAFLCLADIAKD 239
             +++LK  AA  L  I KHSPELA++  D   I  L + + N +  +K      L+ IAK 
Sbjct:   180 EIALKRIAASTLSDISKHSPELAQTVVDAGAIAYLAQMILNPDAKLKCQVLSALSQIAKH 239

Query:   240 SPSLASTIADGAT-TLAVEHLTYPHGLVQKNAATLLRDMCKHXXXXXXXXXXXXXXXXXX 298
             S  LA  + +     + +  +      V+KN ATL+R++ KH                  
Sbjct:   240 SVDLAELVVEAEIFPVVLTCMKDSDEYVKKNGATLIREIAKHSPELSQFIVNAGGVAAV- 298

Query:   299 XXIDCNG---GYNSLPAIMALGYMSAQSEQIAEQIIELQGVGSLQTILQCPHKEQLQVAA 355
               IDC G   G   LP IM LGY++A SE ++  +I  +G+  L T L   H++ ++ AA
Sbjct:   299 --IDCIGSCKGTVRLPGIMMLGYVAAHSENLSMAVIVSKGIPPLCTCLLEEHEDHIKAAA 356

Query:   356 AWTLGQIGKHSVDNVTALCEENVLSTLLSKITQTCVSDNLKSKCKNALNILIPKCENPKE 415
             AW LGQIG+H+ ++  A+ E NVL TLLS       S++L+ K K AL  ++ KC     
Sbjct:   357 AWALGQIGRHTPEHARAVAETNVLGTLLSMYMDIRSSEDLQLKAKRALKNILQKCTYLPA 416

Query:   416 LEQMLLGNVSEELLASILCAFAKILPCDPVARRSFVTSHCLRKVQEI--EPTPEIAPHLK 473
             LE  LL +    ++  I+  F+K+LP D  ARR FVTS  L+KVQEI  EP   +  ++ 
Sbjct:   417 LEP-LLHDAPPNIMKHIVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYIN 475

Query:   474 TINACFPNEVIHFVSPHYLEDLINRLDQFNP 504
             TIN C+P EV+ + SP Y E L+ R++ + P
Sbjct:   476 TINNCYPEEVVRYYSPGYSEMLLERVENYQP 506




GO:0015630 "microtubule cytoskeleton" evidence=IEA
RGD|1310892 Spag6 "sperm associated antigen 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q32L54 SPAG6 "Sperm associated antigen 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|C1JEX7 SPAG6 "Sperm associated antigen 6" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O75602 SPAG6 "Sperm-associated antigen 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1354388 Spag6 "sperm associated antigen 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
POMBASE|SPCC962.03c cut15 "karyopherin Cut15" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TAIR|locus:505006475 IMPA-2 "importin alpha isoform 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8F9 E1C8F9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
TAIR|locus:2196140 IMPA-6 "importin alpha isoform 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9JLI7SPAG6_MOUSENo assigned EC number0.36000.92060.9842yesN/A
O75602SPAG6_HUMANNo assigned EC number0.35610.92060.9803yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query542
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 1e-09
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-09
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 3e-08
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 1e-06
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 1e-05
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-05
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 5e-05
COG1413335 COG1413, COG1413, FOG: HEAT repeat [Energy product 2e-04
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 4e-04
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 6e-04
pfam1364688 pfam13646, HEAT_2, HEAT repeats 0.003
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
 Score = 55.8 bits (135), Expect = 1e-09
 Identities = 28/119 (23%), Positives = 56/119 (47%), Gaps = 1/119 (0%)

Query: 161 ERIVQCGALPPLVQILASPQLSLKHAAAFALDGIVKHSPELAESASDCDVIPLLIKALNN 220
           E ++Q G LP LV +L+S   +++  AA+AL  +   + +  ++  +   +P L++ L +
Sbjct: 1   EAVIQAGGLPALVSLLSSSDENVQREAAWALSNLSAGNNDNIQAVVEAGGLPALVQLLKS 60

Query: 221 DEVNVKADAFLCLADIAKDSPSLASTIAD-GATTLAVEHLTYPHGLVQKNAATLLRDMC 278
           ++  V   A   L ++A         + + G     V  L   +  +QKNA   L ++ 
Sbjct: 61  EDEEVVKAALWALRNLAAGPEDNKLIVLEAGGVPKLVNLLDSSNEDIQKNATGALSNLA 119


An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model. Length = 120

>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|224331 COG1413, COG1413, FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|222285 pfam13646, HEAT_2, HEAT repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 542
KOG0166|consensus514 100.0
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 100.0
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 100.0
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 100.0
KOG0166|consensus514 100.0
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 100.0
KOG4224|consensus550 100.0
KOG4224|consensus550 100.0
PF05804708 KAP: Kinesin-associated protein (KAP) 99.96
PF05804708 KAP: Kinesin-associated protein (KAP) 99.95
KOG1048|consensus717 99.9
KOG1048|consensus717 99.85
KOG2122|consensus 2195 99.79
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.78
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.77
KOG4199|consensus461 99.76
PRK09687280 putative lyase; Provisional 99.75
KOG4199|consensus461 99.75
KOG2171|consensus 1075 99.74
KOG4500|consensus604 99.73
KOG4500|consensus604 99.71
PRK09687280 putative lyase; Provisional 99.71
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.71
KOG1222|consensus791 99.69
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.66
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.65
KOG2122|consensus 2195 99.63
PTZ00429 746 beta-adaptin; Provisional 99.62
KOG1222|consensus791 99.62
KOG0168|consensus 1051 99.61
KOG1293|consensus678 99.58
KOG1061|consensus 734 99.58
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.57
KOG2171|consensus 1075 99.56
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.51
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.5
KOG1293|consensus678 99.5
KOG2023|consensus 885 99.49
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.49
KOG1241|consensus859 99.49
KOG2023|consensus 885 99.45
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.45
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.45
KOG1241|consensus 859 99.45
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.44
KOG0168|consensus 1051 99.41
PTZ00429 746 beta-adaptin; Provisional 99.37
KOG1060|consensus 968 99.28
KOG0946|consensus 970 99.26
KOG2759|consensus442 99.26
COG5215858 KAP95 Karyopherin (importin) beta [Intracellular t 99.23
KOG0946|consensus 970 99.22
KOG1062|consensus 866 99.21
KOG2160|consensus342 99.19
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 99.18
KOG1062|consensus 866 99.12
KOG2759|consensus442 99.12
KOG2160|consensus342 99.09
KOG1059|consensus 877 99.08
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 99.05
KOG4413|consensus524 99.03
KOG0213|consensus1172 98.93
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.92
TIGR02270410 conserved hypothetical protein. Members are found 98.9
KOG1789|consensus2235 98.89
TIGR02270410 conserved hypothetical protein. Members are found 98.85
KOG0212|consensus675 98.84
KOG3678|consensus 832 98.82
KOG3678|consensus 832 98.82
KOG0212|consensus 675 98.8
KOG0213|consensus1172 98.76
KOG4413|consensus524 98.75
KOG1824|consensus1233 98.75
PF05536543 Neurochondrin: Neurochondrin 98.73
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 98.71
KOG1242|consensus569 98.7
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 98.7
KOG2973|consensus353 98.67
KOG1824|consensus 1233 98.66
KOG1517|consensus 1387 98.63
KOG1061|consensus 734 98.62
KOG2973|consensus353 98.62
COG1413335 FOG: HEAT repeat [Energy production and conversion 98.6
KOG1059|consensus 877 98.6
KOG2259|consensus 823 98.6
COG1413335 FOG: HEAT repeat [Energy production and conversion 98.55
COG5096 757 Vesicle coat complex, various subunits [Intracellu 98.53
KOG1242|consensus569 98.52
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 98.51
KOG4535|consensus728 98.51
KOG1517|consensus 1387 98.49
KOG1058|consensus 948 98.49
KOG1077|consensus 938 98.48
COG5369743 Uncharacterized conserved protein [Function unknow 98.47
KOG2259|consensus 823 98.44
KOG0567|consensus289 98.41
KOG1943|consensus 1133 98.38
KOG0211|consensus759 98.37
COG5369743 Uncharacterized conserved protein [Function unknow 98.37
KOG0211|consensus759 98.34
KOG1060|consensus 968 98.33
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 98.31
KOG4646|consensus173 98.27
KOG4646|consensus173 98.27
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 98.27
KOG2734|consensus536 98.21
KOG1077|consensus 938 98.2
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.19
KOG2734|consensus536 98.18
KOG0915|consensus 1702 98.18
PF05536 543 Neurochondrin: Neurochondrin 98.17
KOG1789|consensus2235 98.16
KOG1240|consensus 1431 98.16
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.11
COG5096 757 Vesicle coat complex, various subunits [Intracellu 98.07
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 98.04
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.02
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.98
KOG0567|consensus289 97.98
KOG4535|consensus 728 97.98
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.96
KOG1240|consensus 1431 97.94
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 97.93
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.92
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 97.84
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 97.83
KOG1058|consensus 948 97.81
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.79
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.77
KOG1078|consensus 865 97.75
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.74
PRK14707 2710 hypothetical protein; Provisional 97.67
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 97.63
KOG0915|consensus 1702 97.58
PF05918556 API5: Apoptosis inhibitory protein 5 (API5); Inter 97.52
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 97.49
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 97.45
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.44
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 97.44
KOG1020|consensus 1692 97.41
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 97.41
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 97.35
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 97.34
KOG4151|consensus748 97.32
PF05918556 API5: Apoptosis inhibitory protein 5 (API5); Inter 97.3
KOG1943|consensus 1133 97.28
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.27
KOG1991|consensus 1010 97.25
KOG4151|consensus748 97.21
KOG3036|consensus293 97.2
KOG1991|consensus1010 97.18
KOG1248|consensus 1176 97.12
PF11841160 DUF3361: Domain of unknown function (DUF3361) 97.11
KOG4653|consensus982 97.07
KOG2274|consensus1005 97.07
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 97.06
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 97.05
KOG1020|consensus 1692 97.04
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 97.04
KOG4653|consensus982 97.04
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 97.03
KOG3036|consensus293 97.02
KOG2062|consensus 929 97.0
PF11841160 DUF3361: Domain of unknown function (DUF3361) 96.98
KOG2062|consensus 929 96.96
KOG1967|consensus1030 96.96
KOG2274|consensus 1005 96.93
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 96.88
KOG1248|consensus1176 96.87
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 96.8
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 96.76
KOG1078|consensus 865 96.73
KOG1967|consensus1030 96.72
PF08045257 CDC14: Cell division control protein 14, SIN compo 96.69
PRK14707 2710 hypothetical protein; Provisional 96.64
KOG1832|consensus 1516 96.64
PF05004309 IFRD: Interferon-related developmental regulator ( 96.57
KOG1566|consensus342 96.53
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 96.53
PF11701157 UNC45-central: Myosin-binding striated muscle asse 96.51
KOG1243|consensus690 96.47
KOG3665|consensus699 96.47
KOG0414|consensus1251 96.46
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 96.45
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 96.42
KOG2032|consensus533 96.38
KOG2032|consensus533 96.33
smart00638574 LPD_N Lipoprotein N-terminal Domain. 96.33
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 96.31
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 96.25
KOG0414|consensus1251 96.25
PF05004309 IFRD: Interferon-related developmental regulator ( 96.2
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 96.14
PF07814361 WAPL: Wings apart-like protein regulation of heter 96.0
KOG2956|consensus516 95.95
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 95.9
PF07814361 WAPL: Wings apart-like protein regulation of heter 95.87
PF11701157 UNC45-central: Myosin-binding striated muscle asse 95.86
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 95.85
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 95.82
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 95.78
COG50981128 Chromosome condensation complex Condensin, subunit 95.71
smart00638574 LPD_N Lipoprotein N-terminal Domain. 95.65
COG5116 926 RPN2 26S proteasome regulatory complex component [ 95.61
KOG3665|consensus699 95.57
PF08045257 CDC14: Cell division control protein 14, SIN compo 95.46
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 95.44
KOG1832|consensus 1516 95.37
KOG2999|consensus 713 95.35
KOG1243|consensus690 95.18
KOG2956|consensus516 95.05
KOG2025|consensus 892 95.03
PF11864464 DUF3384: Domain of unknown function (DUF3384); Int 94.99
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 94.97
COG50981128 Chromosome condensation complex Condensin, subunit 94.95
KOG2025|consensus 892 94.84
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 94.58
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 94.48
KOG2999|consensus 713 94.47
COG5656 970 SXM1 Importin, protein involved in nuclear import 94.46
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 94.39
KOG2611|consensus 698 94.37
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 94.14
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 94.04
COG5116926 RPN2 26S proteasome regulatory complex component [ 94.01
KOG1820|consensus815 93.87
KOG1949|consensus 1005 93.75
KOG1788|consensus 2799 93.48
PLN030761780 ARF guanine nucleotide exchange factor (ARF-GEF); 93.47
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 93.45
KOG0891|consensus 2341 93.35
KOG1788|consensus 2799 93.06
KOG1820|consensus 815 93.03
KOG2137|consensus700 92.7
KOG1992|consensus 960 92.57
PF14500262 MMS19_N: Dos2-interacting transcription regulator 92.51
PF01603409 B56: Protein phosphatase 2A regulatory B subunit ( 92.46
KOG4464|consensus532 92.37
PF1036392 DUF2435: Protein of unknown function (DUF2435) 92.3
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 92.17
COG5209315 RCD1 Uncharacterized protein involved in cell diff 92.14
PF08167165 RIX1: rRNA processing/ribosome biogenesis 92.13
COG5209315 RCD1 Uncharacterized protein involved in cell diff 92.12
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 92.07
KOG2137|consensus700 91.86
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 91.76
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 91.7
PF1036392 DUF2435: Protein of unknown function (DUF2435) 91.48
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 91.47
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 90.99
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 90.97
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 90.88
KOG1822|consensus 2067 90.61
PF13251182 DUF4042: Domain of unknown function (DUF4042) 90.51
KOG2933|consensus334 90.4
KOG2933|consensus334 90.4
KOG1822|consensus 2067 90.15
KOG1566|consensus342 90.13
PF13251182 DUF4042: Domain of unknown function (DUF4042) 89.89
PF08167165 RIX1: rRNA processing/ribosome biogenesis 89.7
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 89.26
PF14500262 MMS19_N: Dos2-interacting transcription regulator 89.19
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 89.02
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 88.78
cd03567139 VHS_GGA VHS domain family, GGA subfamily; GGA (Gol 87.98
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 87.75
cd03561133 VHS VHS domain family; The VHS domain is present i 87.23
KOG2611|consensus 698 87.19
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 87.0
PF01603409 B56: Protein phosphatase 2A regulatory B subunit ( 86.8
COG5656970 SXM1 Importin, protein involved in nuclear import 86.74
PF14225262 MOR2-PAG1_C: Cell morphogenesis C-terminal 86.68
KOG0891|consensus 2341 86.08
KOG0413|consensus 1529 84.91
KOG1993|consensus978 84.4
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 84.31
PF13001501 Ecm29: Proteasome stabiliser; InterPro: IPR024372 83.8
PF06685249 DUF1186: Protein of unknown function (DUF1186); In 83.76
smart00288133 VHS Domain present in VPS-27, Hrs and STAM. Unpubl 83.73
KOG1525|consensus 1266 83.51
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 83.24
PLN03076 1780 ARF guanine nucleotide exchange factor (ARF-GEF); 82.99
PF10274183 ParcG: Parkin co-regulated protein; InterPro: IPR0 82.18
PF08216108 CTNNBL: Catenin-beta-like, Arm-motif containing nu 81.11
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 80.85
>KOG0166|consensus Back     alignment and domain information
Probab=100.00  E-value=1.2e-51  Score=397.65  Aligned_cols=397  Identities=19%  Similarity=0.279  Sum_probs=361.0

Q ss_pred             HHHHHHhhccCCHHHHHHHHHHHHHHhcC--ChhhhhHhhcCChHHHHhhhcCC-CHHHHHHHHHHHHHhhcCChHHHHH
Q psy12594         86 VALVLKDLTKQNKHYKKTALHMLTCVAQQ--DERCAGLIEDKDLDSIISSLHDF-DPDTRANAALALGGLAKDNKHFAER  162 (542)
Q Consensus        86 l~~Lv~~L~~~~~~~~~~a~~~L~~l~~~--~~~~~~~~~~g~v~~Lv~lL~~~-~~~~~~~a~~~L~~l~~~~~~~~~~  162 (542)
                      .+.++..+.+.++..+..+...++.+.+.  ++.+..++..|+++.+|..|... ++.++..|+|+|.|+++++.+..+.
T Consensus        68 ~~~~~~~~~S~~~~~q~~a~~~~rkllS~~~~ppi~~vi~~G~v~~lV~~l~~~~~~~lq~eAAWaLTnIAsgtse~T~~  147 (514)
T KOG0166|consen   68 LELMLAALYSDDPQQQLTATQAFRKLLSKERNPPIDEVIQSGVVPRLVEFLSRDDNPTLQFEAAWALTNIASGTSEQTKV  147 (514)
T ss_pred             hHHHHHHHhCCCHHHHHHHHHHHHHHHccCCCCCHHHHHHcCcHHHHHHHHccCCChhHHHHHHHHHHHHhcCchhhccc
Confidence            67778888888988899999999997644  35555666779999999999755 5999999999999999999999999


Q ss_pred             HHHcCChHHHHHhccCCCHhHHHHHHHHHHHHhcCCHHHHHHhhhCCChHHHHHhhcCCCH-HHHHHHHHHHHHHhcCCh
Q psy12594        163 IVQCGALPPLVQILASPQLSLKHAAAFALDGIVKHSPELAESASDCDVIPLLIKALNNDEV-NVKADAFLCLADIAKDSP  241 (542)
Q Consensus       163 i~~~g~i~~L~~ll~~~~~~~~~~a~~~L~nl~~~~~~~~~~~~~~~~i~~L~~ll~~~~~-~~~~~a~~~L~~l~~~~~  241 (542)
                      +++.|++|.|++++.+++..+++.|.|+|+|++.+++.++..+++.|++++|+.++..++. .+.+.+.|+|+|||++..
T Consensus       148 vv~agavp~fi~Ll~s~~~~v~eQavWALgNIagds~~~Rd~vl~~g~l~pLl~~l~~~~~~~~lRn~tW~LsNlcrgk~  227 (514)
T KOG0166|consen  148 VVDAGAVPIFIQLLSSPSADVREQAVWALGNIAGDSPDCRDYVLSCGALDPLLRLLNKSDKLSMLRNATWTLSNLCRGKN  227 (514)
T ss_pred             cccCCchHHHHHHhcCCcHHHHHHHHHHHhccccCChHHHHHHHhhcchHHHHHHhccccchHHHHHHHHHHHHHHcCCC
Confidence            9999999999999999999999999999999999999999999999999999999997765 799999999999999874


Q ss_pred             hhHHHHHhhchHH-HHHhhcCCChhHHHHHHHHHHHHhcCChHHHHHHHhcCCHHHHHHhhhcCCccchHHHHHHHhHhh
Q psy12594        242 SLASTIADGATTL-AVEHLTYPHGLVQKNAATLLRDMCKHNLRLANLVVLAGGLDGLLRLIDCNGGYNSLPAIMALGYMS  320 (542)
Q Consensus       242 ~~~~~~~~~~~i~-L~~lL~~~~~~v~~~a~~~L~~L~~~~~~~~~~~~~~~~i~~Lv~lL~~~~~~~~~~a~~~L~~l~  320 (542)
                      .....-.-..++| |..++.+.|+++...++|++++|+.++++..+.+++.|++++|+.+|.+.++.++.+|++++||++
T Consensus       228 P~P~~~~v~~iLp~L~~ll~~~D~~Vl~Da~WAlsyLsdg~ne~iq~vi~~gvv~~LV~lL~~~~~~v~~PaLRaiGNIv  307 (514)
T KOG0166|consen  228 PSPPFDVVAPILPALLRLLHSTDEEVLTDACWALSYLTDGSNEKIQMVIDAGVVPRLVDLLGHSSPKVVTPALRAIGNIV  307 (514)
T ss_pred             CCCcHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHhcCChHHHHHHHHccchHHHHHHHcCCCcccccHHHhhcccee
Confidence            3444444468999 999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCChHHHHHHHhhCchHHHHHhhcCCChhhHHHHHHHHHHHhhcCChHHHHHHHHcCChHHHHHHHhcCCCChHHHHHHH
Q psy12594        321 AQSEQIAEQIIELQGVGSLQTILQCPHKEQLQVAAAWTLGQIGKHSVDNVTALCEENVLSTLLSKITQTCVSDNLKSKCK  400 (542)
Q Consensus       321 ~~~~~~~~~~~~~~~l~~L~~ll~~~~~~~v~~~a~~~L~~l~~~~~~~~~~l~~~~~l~~L~~ll~~~~~~~~v~~~a~  400 (542)
                      .+++.+++.+++.++++.|..++..++...++++|||+++||++|++++++.+++.|++|.|+.+|.+.  ++++|++|+
T Consensus       308 tG~d~QTq~vi~~~~L~~l~~ll~~s~~~~ikkEAcW~iSNItAG~~~qiqaVida~l~p~Li~~l~~~--ef~~rKEAa  385 (514)
T KOG0166|consen  308 TGSDEQTQVVINSGALPVLSNLLSSSPKESIKKEACWTISNITAGNQEQIQAVIDANLIPVLINLLQTA--EFDIRKEAA  385 (514)
T ss_pred             eccHHHHHHHHhcChHHHHHHHhccCcchhHHHHHHHHHHHhhcCCHHHHHHHHHcccHHHHHHHHhcc--chHHHHHHH
Confidence            999999999999999999999999766668999999999999999999999999999999999999988  479999999


Q ss_pred             HHHHHHHh-----------hCCCchhhHHhhcCCCCHHHHHHHHHHHHhhCCCChhhh--------hHHHHhcchHHhhh
Q psy12594        401 NALNILIP-----------KCENPKELEQMLLGNVSEELLASILCAFAKILPCDPVAR--------RSFVTSHCLRKVQE  461 (542)
Q Consensus       401 ~aL~nl~~-----------~~~~i~~L~~lL~~~~~~~v~~~~l~~l~~ll~~~~~~~--------~~~~~~g~~~~l~~  461 (542)
                      ||++|+..           ..+.+++||.+|. ..|.++...++.++.+++..++...        ..+.+.||+++++.
T Consensus       386 waIsN~ts~g~~~qi~yLv~~giI~plcdlL~-~~D~~ii~v~Ld~l~nil~~~e~~~~~~~n~~~~~IEe~ggldkiE~  464 (514)
T KOG0166|consen  386 WAISNLTSSGTPEQIKYLVEQGIIKPLCDLLT-CPDVKIILVALDGLENILKVGEAEKNRGTNPLAIMIEEAGGLDKIEN  464 (514)
T ss_pred             HHHHhhcccCCHHHHHHHHHcCCchhhhhccc-CCChHHHHHHHHHHHHHHHHHHHhccccccHHHHHHHHccChhHHHH
Confidence            99999953           4678999999999 9999999999999999998765433        47889999999999


Q ss_pred             cC--CCCcHH-HHHHHHhccCccchhc
Q psy12594        462 IE--PTPEIA-PHLKTINACFPNEVIH  485 (542)
Q Consensus       462 l~--~~~~~~-~a~~~l~~~~~~~~~~  485 (542)
                      ++  .|.+++ +|..+|++||++|...
T Consensus       465 LQ~hen~~Iy~~A~~II~~yf~~e~~~  491 (514)
T KOG0166|consen  465 LQSHENEEIYKKAYKIIDTYFSEEDDE  491 (514)
T ss_pred             hhccccHHHHHHHHHHHHHhcCCCccc
Confidence            99  777888 5999999999977444



>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG1048|consensus Back     alignment and domain information
>KOG1048|consensus Back     alignment and domain information
>KOG2122|consensus Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG4199|consensus Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG4199|consensus Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>KOG4500|consensus Back     alignment and domain information
>KOG4500|consensus Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG1222|consensus Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2122|consensus Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG1222|consensus Back     alignment and domain information
>KOG0168|consensus Back     alignment and domain information
>KOG1293|consensus Back     alignment and domain information
>KOG1061|consensus Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG1293|consensus Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG0168|consensus Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG1060|consensus Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>KOG2759|consensus Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>KOG1062|consensus Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1062|consensus Back     alignment and domain information
>KOG2759|consensus Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>KOG1059|consensus Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG4413|consensus Back     alignment and domain information
>KOG0213|consensus Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information
>KOG3678|consensus Back     alignment and domain information
>KOG3678|consensus Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information
>KOG0213|consensus Back     alignment and domain information
>KOG4413|consensus Back     alignment and domain information
>KOG1824|consensus Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG2973|consensus Back     alignment and domain information
>KOG1824|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1061|consensus Back     alignment and domain information
>KOG2973|consensus Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG1059|consensus Back     alignment and domain information
>KOG2259|consensus Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG4535|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1058|consensus Back     alignment and domain information
>KOG1077|consensus Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2259|consensus Back     alignment and domain information
>KOG0567|consensus Back     alignment and domain information
>KOG1943|consensus Back     alignment and domain information
>KOG0211|consensus Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0211|consensus Back     alignment and domain information
>KOG1060|consensus Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>KOG4646|consensus Back     alignment and domain information
>KOG4646|consensus Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG2734|consensus Back     alignment and domain information
>KOG1077|consensus Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG2734|consensus Back     alignment and domain information
>KOG0915|consensus Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG0567|consensus Back     alignment and domain information
>KOG4535|consensus Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1058|consensus Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG1078|consensus Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG0915|consensus Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG1020|consensus Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG4151|consensus Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG1943|consensus Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1991|consensus Back     alignment and domain information
>KOG4151|consensus Back     alignment and domain information
>KOG3036|consensus Back     alignment and domain information
>KOG1991|consensus Back     alignment and domain information
>KOG1248|consensus Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG4653|consensus Back     alignment and domain information
>KOG2274|consensus Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG1020|consensus Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG4653|consensus Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG3036|consensus Back     alignment and domain information
>KOG2062|consensus Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG2062|consensus Back     alignment and domain information
>KOG1967|consensus Back     alignment and domain information
>KOG2274|consensus Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>KOG1248|consensus Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>KOG1078|consensus Back     alignment and domain information
>KOG1967|consensus Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG1566|consensus Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG0414|consensus Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2032|consensus Back     alignment and domain information
>KOG2032|consensus Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>KOG0414|consensus Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>KOG2956|consensus Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG2999|consensus Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>KOG2956|consensus Back     alignment and domain information
>KOG2025|consensus Back     alignment and domain information
>PF11864 DUF3384: Domain of unknown function (DUF3384); InterPro: IPR024584 This entry represents the N-terminal domain of tuberin which is functionally uncharacterised Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2025|consensus Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>KOG2999|consensus Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>KOG2611|consensus Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1820|consensus Back     alignment and domain information
>KOG1949|consensus Back     alignment and domain information
>KOG1788|consensus Back     alignment and domain information
>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>KOG0891|consensus Back     alignment and domain information
>KOG1788|consensus Back     alignment and domain information
>KOG1820|consensus Back     alignment and domain information
>KOG2137|consensus Back     alignment and domain information
>KOG1992|consensus Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>PF01603 B56: Protein phosphatase 2A regulatory B subunit (B56 family); InterPro: IPR002554 Protein phosphatase 2A (PP2A) is a major intracellular protein phosphatase that regulates multiple aspects of cell growth and metabolism Back     alignment and domain information
>KOG4464|consensus Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>KOG2137|consensus Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>KOG1822|consensus Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>KOG2933|consensus Back     alignment and domain information
>KOG2933|consensus Back     alignment and domain information
>KOG1822|consensus Back     alignment and domain information
>KOG1566|consensus Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>KOG2611|consensus Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>PF01603 B56: Protein phosphatase 2A regulatory B subunit (B56 family); InterPro: IPR002554 Protein phosphatase 2A (PP2A) is a major intracellular protein phosphatase that regulates multiple aspects of cell growth and metabolism Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14225 MOR2-PAG1_C: Cell morphogenesis C-terminal Back     alignment and domain information
>KOG0891|consensus Back     alignment and domain information
>KOG0413|consensus Back     alignment and domain information
>KOG1993|consensus Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>PF13001 Ecm29: Proteasome stabiliser; InterPro: IPR024372 The proteasome (or macropain) (3 Back     alignment and domain information
>PF06685 DUF1186: Protein of unknown function (DUF1186); InterPro: IPR010602 This family consists of several hypothetical bacterial proteins of around 250 residues in length and is found in several Chlamydia and Anabaena species Back     alignment and domain information
>smart00288 VHS Domain present in VPS-27, Hrs and STAM Back     alignment and domain information
>KOG1525|consensus Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional Back     alignment and domain information
>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter Back     alignment and domain information
>PF08216 CTNNBL: Catenin-beta-like, Arm-motif containing nuclear; InterPro: IPR013180 This domain is found in eukaryotic proteins Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query542
4db9_A210 Designed Armadillo Repeat Protein (Yiiim3aiii) Leng 6e-07
4b8j_A528 Rimp_alpha1a Length = 528 8e-06
4dba_A210 Designed Armadillo Repeat Protein (Yiim3aii) Length 9e-06
2yns_A490 Rimp_alpha_b54nls Length = 490 1e-05
4db6_A210 Designed Armadillo Repeat Protein (Yiiim3aii) Lengt 1e-05
4db8_A252 Designed Armadillo-Repeat Protein Length = 252 2e-05
1wa5_B530 Crystal Structure Of The Exportin Cse1p Complexed W 7e-05
2c1t_A454 Structure Of The Kap60p:nup2 Complex Length = 454 9e-05
1ee5_A424 Yeast Karyopherin (Importin) Alpha In A Complex Wit 1e-04
1un0_A443 Crystal Structure Of Yeast Karyopherin (Importin) A 1e-04
1ee4_A423 Crystal Structure Of Yeast Karyopherin (Importin) A 1e-04
1bk6_A422 Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Leng 1e-04
1bk5_A422 Karyopherin Alpha From Saccharomyces Cerevisiae Len 1e-04
>pdb|4DB9|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aiii) Length = 210 Back     alignment and structure

Iteration: 1

Score = 52.4 bits (124), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 41/194 (21%), Positives = 83/194 (42%), Gaps = 2/194 (1%) Query: 89 VLKDLTKQNKHYKKTALHMLTCVAQQ-DERCAGLIEDKDLDSIISSLHDFDPDTRXXXXX 147 +++ L ++ ++AL L+ +A +E+ +I+ L +++ L + Sbjct: 17 MVQQLNSPDQQELQSALRKLSQIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALW 76 Query: 148 XXXXXXKDNKHFAERIVQCGALPPLVQILASPQLSLKHAAAFALDGIVKHSPELAESASD 207 + ++ GALP LVQ+L+SP + A +AL I E ++ D Sbjct: 77 ALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVID 136 Query: 208 CDVIPLLIKALNNDEVNVKADAFLCLADIAKDSPSLASTIADGATTLAVEHL-TYPHGLV 266 +P L++ L++ + +A L++IA + + A+E L + P+ + Sbjct: 137 AGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGAEPALEQLQSSPNEKI 196 Query: 267 QKNAATLLRDMCKH 280 QK A L + H Sbjct: 197 QKEAQEALEKIQSH 210
>pdb|4B8J|A Chain A, Rimp_alpha1a Length = 528 Back     alignment and structure
>pdb|4DBA|A Chain A, Designed Armadillo Repeat Protein (Yiim3aii) Length = 210 Back     alignment and structure
>pdb|2YNS|A Chain A, Rimp_alpha_b54nls Length = 490 Back     alignment and structure
>pdb|4DB6|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aii) Length = 210 Back     alignment and structure
>pdb|4DB8|A Chain A, Designed Armadillo-Repeat Protein Length = 252 Back     alignment and structure
>pdb|1WA5|B Chain B, Crystal Structure Of The Exportin Cse1p Complexed With Its Cargo (Kap60p) And Rangtp Length = 530 Back     alignment and structure
>pdb|2C1T|A Chain A, Structure Of The Kap60p:nup2 Complex Length = 454 Back     alignment and structure
>pdb|1EE5|A Chain A, Yeast Karyopherin (Importin) Alpha In A Complex With A Nucleoplasmin Nls Peptide Length = 424 Back     alignment and structure
>pdb|1UN0|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In Complex With A Nup2p N-Terminal Fragment Length = 443 Back     alignment and structure
>pdb|1EE4|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In A Complex With A C-Myc Nls Peptide Length = 423 Back     alignment and structure
>pdb|1BK6|A Chain A, Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Length = 422 Back     alignment and structure
>pdb|1BK5|A Chain A, Karyopherin Alpha From Saccharomyces Cerevisiae Length = 422 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query542
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 3e-44
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 1e-30
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 1e-42
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 1e-39
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 4e-31
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 2e-09
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 7e-05
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-35
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 4e-25
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-24
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 5e-18
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 6e-18
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-35
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-26
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-18
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-10
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 3e-09
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 1e-34
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 6e-30
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 2e-27
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 3e-34
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 3e-26
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 4e-24
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 5e-17
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 3e-16
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-27
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-15
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 4e-11
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 8e-20
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 1e-16
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 1e-16
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 5e-18
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 1e-10
3nmz_A458 APC variant protein; protein-protein complex, arma 9e-18
3nmz_A458 APC variant protein; protein-protein complex, arma 3e-16
3nmz_A458 APC variant protein; protein-protein complex, arma 3e-14
3nmz_A458 APC variant protein; protein-protein complex, arma 3e-13
3nmz_A458 APC variant protein; protein-protein complex, arma 6e-12
3nmz_A458 APC variant protein; protein-protein complex, arma 5e-10
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 1e-17
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 1e-17
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 6e-15
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 6e-14
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 5e-15
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 4e-06
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 5e-06
2db0_A253 253AA long hypothetical protein; heat repeats, hel 1e-14
2db0_A253 253AA long hypothetical protein; heat repeats, hel 5e-13
2db0_A253 253AA long hypothetical protein; heat repeats, hel 2e-10
2db0_A253 253AA long hypothetical protein; heat repeats, hel 9e-07
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-14
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 8e-08
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-07
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-06
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 2e-13
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 2e-12
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 8e-12
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 1e-11
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 4e-10
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 4e-06
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 1e-11
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 6e-10
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 3e-06
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 5e-10
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 2e-08
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 5e-07
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 4e-06
3grl_A 651 General vesicular transport factor P115; vesicle t 3e-08
3grl_A651 General vesicular transport factor P115; vesicle t 5e-05
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 4e-08
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 2e-07
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 7e-06
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 3e-05
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 4e-04
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 1e-05
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 1e-04
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 7e-04
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
 Score =  161 bits (410), Expect = 3e-44
 Identities = 73/402 (18%), Positives = 152/402 (37%), Gaps = 9/402 (2%)

Query: 23  TMSAFADKPSTIHFLKDLNVVDLIVPLLADKVPSIQHAALATLGKLMCAKHV-DIRQEVL 81
            M     + + +       +   ++ ++  K P  Q +A     KL+  +    I + + 
Sbjct: 2   AMGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVIS 61

Query: 82  ERNLVALVLKDLTK-QNKHYKKTALHMLTCVAQQD-ERCAGLIEDKDLDSIISSLHDFDP 139
              +VA  ++ L + +N   +  +  +LT +A  +  +   +I+   +   I  L     
Sbjct: 62  TPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFE 121

Query: 140 DTRANAALALGGLAKDNKHFAERIVQCGALPPLVQILASP-QLSLKHAAAFALDGIVKHS 198
           D +  A  ALG +A D+    + ++ C  LPPL+Q+ +   +L++   A +AL  + +  
Sbjct: 122 DVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGK 181

Query: 199 PELAESASDCDVIPLLIKALNNDEVNVKADAFLCLADIAKDSPSLASTIAD-GATTLAVE 257
               E A     + +L   L   + +V ADA   L+ ++         + D G     VE
Sbjct: 182 SPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVE 241

Query: 258 HLTYPHGLVQKNAATLLRDMCKHNLRLANLVVLAGGLDGLLRLIDCNGGYNSLPAIMALG 317
            L +    V   A   + ++   +     +++    L  LL L+          A   + 
Sbjct: 242 LLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTIS 301

Query: 318 YMSAQSEQIAEQIIELQGVGSLQTILQCPHKEQLQVAAAWTLGQ-IGKHSVDNVTALCEE 376
            ++A +    + +I+     +L +ILQ       +  AAW +       S + +  L E 
Sbjct: 302 NITAGNRAQIQTVIDANIFPALISILQTAEFR-TRKEAAWAITNATSGGSAEQIKYLVEL 360

Query: 377 NVLSTLLSKITQTCVSDNLKSKCKNALNILIPKCENPKELEQ 418
             +  L   +  T +   +     N L  ++   E   +   
Sbjct: 361 GCIKPLCDLL--TVMDSKIVQVALNGLENILRLGEQEAKRNG 400


>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Length = 651 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Length = 651 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Length = 861 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Length = 861 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Length = 861 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query542
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 100.0
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 100.0
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 100.0
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 100.0
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 100.0
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 100.0
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 100.0
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 100.0
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 100.0
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 100.0
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 100.0
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 100.0
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 100.0
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 100.0
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 100.0
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 100.0
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 100.0
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 100.0
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 100.0
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 100.0
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.98
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.97
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.96
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.96
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.96
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.95
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.95
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.94
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.92
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.92
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.9
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.89
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.89
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.86
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.83
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.82
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.82
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.82
3grl_A651 General vesicular transport factor P115; vesicle t 99.81
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.79
3grl_A651 General vesicular transport factor P115; vesicle t 99.78
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.77
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.74
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.74
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 99.69
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 99.67
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 99.65
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 99.64
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.62
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.62
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.61
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.59
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.57
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.54
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 99.52
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.51
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.5
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.5
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.48
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 99.47
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 99.2
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 99.14
2db0_A253 253AA long hypothetical protein; heat repeats, hel 99.14
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 99.07
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 99.06
2db0_A253 253AA long hypothetical protein; heat repeats, hel 99.05
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 99.02
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 99.01
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.75
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.73
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.7
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.7
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.69
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.62
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.6
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.56
2x1g_F 971 Cadmus; transport protein, developmental protein, 98.51
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.46
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.4
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 98.34
1wa5_C960 Importin alpha RE-exporter; nuclear transport/comp 98.31
2x19_B 963 Importin-13; nuclear transport, protein transport; 98.28
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.23
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 98.21
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 98.09
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 98.09
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 98.04
2x1g_F 971 Cadmus; transport protein, developmental protein, 98.03
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.0
2x19_B 963 Importin-13; nuclear transport, protein transport; 97.96
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 97.86
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 97.8
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 97.75
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 97.59
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 97.44
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 97.35
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 97.33
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 97.26
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 97.26
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 97.21
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 97.13
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 97.08
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 97.0
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 96.94
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 96.93
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 96.83
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 96.79
3u0r_A507 Apoptosis inhibitor 5; heat repeat, armadillo repe 96.74
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 96.72
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 96.6
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 96.52
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 96.33
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 95.64
3u0r_A507 Apoptosis inhibitor 5; heat repeat, armadillo repe 95.6
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 95.54
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 95.25
3c2g_A619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 95.04
3c2g_A619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 94.3
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 94.19
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 93.9
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 92.91
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 92.87
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 90.15
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 89.36
3o2t_A386 Symplekin; heat repeat, scaffold, protein binding; 88.07
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 87.88
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 86.16
2npp_B449 PP2A, B subunit, serine/threonine-protein phosphat 84.97
1x5b_A163 Signal transducing adaptor molecule 2; VHS domain, 84.57
1mhq_A148 ADP-ribosylation factor binding protein GGA2; supe 84.26
3o2t_A386 Symplekin; heat repeat, scaffold, protein binding; 84.19
3g2s_A149 C-terminal fragment of sortilin-related receptor; 84.18
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 80.76
1juq_A171 ADP-ribosylation factor binding protein GGA3; prot 80.5
3qml_C315 Protein SLS1, nucleotide exchange factor SIL1; arm 80.46
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
Probab=100.00  E-value=4.6e-46  Score=384.74  Aligned_cols=395  Identities=16%  Similarity=0.231  Sum_probs=355.7

Q ss_pred             cHHHHHHhhccCCHHHHHHHHHHHHHHhcC--ChhhhhHhhcCChHHHHhhhcCC-CHHHHHHHHHHHHHhhcCChHHHH
Q psy12594         85 LVALVLKDLTKQNKHYKKTALHMLTCVAQQ--DERCAGLIEDKDLDSIISSLHDF-DPDTRANAALALGGLAKDNKHFAE  161 (542)
Q Consensus        85 ~l~~Lv~~L~~~~~~~~~~a~~~L~~l~~~--~~~~~~~~~~g~v~~Lv~lL~~~-~~~~~~~a~~~L~~l~~~~~~~~~  161 (542)
                      .++.+++.+.+++++.+..|+..++++.+.  ++.+..+++.|++|.|+++|++. ++.++..|+|+|+|++.++++.++
T Consensus        58 ~i~~~v~~l~s~d~~~q~~a~~~~rklls~e~~ppi~~ii~~G~ip~LV~lL~~~~~~~lq~~Aa~aL~nias~~~e~~~  137 (510)
T 3ul1_B           58 SVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTK  137 (510)
T ss_dssp             CHHHHHHHHTSSCHHHHHHHHHHHHHHHTCSSCCCHHHHHHTTHHHHHHHHTTCTTCHHHHHHHHHHHHHHHTSCHHHHH
T ss_pred             hHHHHHHHhcCCCHHHHHHHHHHHHHHhcCCCCchHHHHHHCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHhcCCHHHHH
Confidence            489999999999999999999999997643  45566699999999999999755 589999999999999999999999


Q ss_pred             HHHHcCChHHHHHhccCCCHhHHHHHHHHHHHHhcCCHHHHHHhhhCCChHHHHHhhcCCC-----HHHHHHHHHHHHHH
Q psy12594        162 RIVQCGALPPLVQILASPQLSLKHAAAFALDGIVKHSPELAESASDCDVIPLLIKALNNDE-----VNVKADAFLCLADI  236 (542)
Q Consensus       162 ~i~~~g~i~~L~~ll~~~~~~~~~~a~~~L~nl~~~~~~~~~~~~~~~~i~~L~~ll~~~~-----~~~~~~a~~~L~~l  236 (542)
                      .+++.|++|.|+++|+++++.+++.|+|+|+||+.++++.+..+.+.|+++.|+.++..++     ..+++.++|+++++
T Consensus       138 ~vv~~GaIp~Lv~lL~s~~~~v~e~A~~aL~nLa~d~~~~r~~v~~~G~i~~Ll~lL~~~~~~~~~~~~~~~a~~~L~nl  217 (510)
T 3ul1_B          138 AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNL  217 (510)
T ss_dssp             HHHHTTHHHHHHHHTTCSCHHHHHHHHHHHHHHHTTCHHHHHHHHHTTCHHHHHHHTCSSCGGGSCHHHHHHHHHHHHHH
T ss_pred             HHHHCCCHHHHHHHHcCCCHHHHHHHHHHHHHHHhCCHHHHHHHHHcCChHHHHHHHHhccchhhhHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999988999999999999999999998654     45789999999999


Q ss_pred             hcCChhhHHHHHhhchHH-HHHhhcCCChhHHHHHHHHHHHHhcCChHHHHHHHhcCCHHHHHHhhhcCCccchHHHHHH
Q psy12594        237 AKDSPSLASTIADGATTL-AVEHLTYPHGLVQKNAATLLRDMCKHNLRLANLVVLAGGLDGLLRLIDCNGGYNSLPAIMA  315 (542)
Q Consensus       237 ~~~~~~~~~~~~~~~~i~-L~~lL~~~~~~v~~~a~~~L~~L~~~~~~~~~~~~~~~~i~~Lv~lL~~~~~~~~~~a~~~  315 (542)
                      +.+...........++++ |+.++.+++++++..++|+|++|+.+..+..+.+.+.|+++.|+.++.+++..++..++++
T Consensus       218 ~~~~~~~~~~~~~~~~lp~L~~LL~~~~~~v~~~A~~aL~~L~~~~~~~~~~i~~~g~i~~Lv~lL~~~~~~v~~~al~a  297 (510)
T 3ul1_B          218 CRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRA  297 (510)
T ss_dssp             HCCCSSCCCHHHHHHHHHHHHHHTTCSCHHHHHHHHHHHHHHTSSCHHHHHHHHTTTCHHHHHHHHTCSCHHHHHHHHHH
T ss_pred             hhcccchhHHHHHHhHHHHHHHHHhcCCHHHHHHHHHHHHHHhhchhhhHHHHHhcccchhhhhhhcCCChhhhhHHHHH
Confidence            987654555555578999 9999999999999999999999999998888888899999999999999999999999999


Q ss_pred             HhHhhcCChHHHHHHHhhCchHHHHHhhcCCChhhHHHHHHHHHHHhhcCChHHHHHHHHcCChHHHHHHHhcCCCChHH
Q psy12594        316 LGYMSAQSEQIAEQIIELQGVGSLQTILQCPHKEQLQVAAAWTLGQIGKHSVDNVTALCEENVLSTLLSKITQTCVSDNL  395 (542)
Q Consensus       316 L~~l~~~~~~~~~~~~~~~~l~~L~~ll~~~~~~~v~~~a~~~L~~l~~~~~~~~~~l~~~~~l~~L~~ll~~~~~~~~v  395 (542)
                      |+|++.+++.....+++.|+++.|+.++.++ ++.++..|+|+|+|++.+++.+.+.+++.|+++.|+.++.++  +.++
T Consensus       298 L~nl~~~~~~~~~~i~~~g~l~~L~~LL~~~-~~~v~~~A~~aL~nl~a~~~~~~~~v~~~g~i~~Lv~lL~~~--~~~v  374 (510)
T 3ul1_B          298 IGNIVTGTDEQTQKVIDAGALAVFPSLLTNP-KTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKA--DFKT  374 (510)
T ss_dssp             HHHHTTSCHHHHHHHHHTTGGGGCC-CTTCS-SHHHHHHHHHHHHHHTTSCHHHHHHHHHTTHHHHHHHHHHSS--CHHH
T ss_pred             HHHhhcCCHHHHHHHhhccchHHHHHHhcCC-CHHHHHHHHHHHHHHHcCcHHHHHHHHhcCCHHHHHHHHcCC--CHHH
Confidence            9999999999999999999999999999985 469999999999999999999999999999999999999987  5799


Q ss_pred             HHHHHHHHHHHHh-----------hCCCchhhHHhhcCCCCHHHHHHHHHHHHhhCCCC------hhhhhHHHHhcchHH
Q psy12594        396 KSKCKNALNILIP-----------KCENPKELEQMLLGNVSEELLASILCAFAKILPCD------PVARRSFVTSHCLRK  458 (542)
Q Consensus       396 ~~~a~~aL~nl~~-----------~~~~i~~L~~lL~~~~~~~v~~~~l~~l~~ll~~~------~~~~~~~~~~g~~~~  458 (542)
                      |++|+|+|+|++.           +.+.+++|+++|. +.|++++..++++|.|++..+      ++.+..|.++||+++
T Consensus       375 ~~~Aa~aL~Nl~~~~~~~~~~~L~~~g~i~~L~~LL~-~~d~~i~~~~L~aL~nil~~~~~~~~~~~~~~~iee~ggl~~  453 (510)
T 3ul1_B          375 QKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLS-AKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDK  453 (510)
T ss_dssp             HHHHHHHHHHHHHHCCHHHHHHHHHTTCHHHHHHGGG-CSCHHHHHHHHHHHHHHHHHHHTTTCHHHHHHHHHHTTHHHH
T ss_pred             HHHHHHHHHHHHccCCHHHHHHHHHCCCHHHHHHHhc-CCCHHHHHHHHHHHHHHHHHhHhccchHHHHHHHHHcCcHHH
Confidence            9999999999963           3588999999999 999999999999999998643      234457889999999


Q ss_pred             hhhcC--CCCcHH-HHHHHHhccCccch
Q psy12594        459 VQEIE--PTPEIA-PHLKTINACFPNEV  483 (542)
Q Consensus       459 l~~l~--~~~~~~-~a~~~l~~~~~~~~  483 (542)
                      |+.++  +|.+++ +|..+|++||+++.
T Consensus       454 ie~Lq~~~n~~i~~~A~~iie~yf~~~~  481 (510)
T 3ul1_B          454 IEALQRHENESVYKASLNLIEKYFSVEE  481 (510)
T ss_dssp             HHHGGGCSSHHHHHHHHHHHHHHCC---
T ss_pred             HHHHHcCCCHHHHHHHHHHHHHHCCCcc
Confidence            99999  788888 59999999998554



>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 Back     alignment and structure
>2npp_B PP2A, B subunit, serine/threonine-protein phosphatase 2A 56 kDa RE subunit gamma isoform; heat repeat, signaling protein, hydrolase-hydrolase inhibito; HET: 1ZN; 3.30A {Homo sapiens} SCOP: a.118.1.20 Back     alignment and structure
>1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B Back     alignment and structure
>1mhq_A ADP-ribosylation factor binding protein GGA2; super helix, protein transport; 2.20A {Homo sapiens} SCOP: a.118.9.2 Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>3g2s_A C-terminal fragment of sortilin-related receptor; ADP-ribosylation factor binding protein GGA1, VHS, acidic- cluster dileucine signal, sorla; 1.70A {Homo sapiens} SCOP: a.118.9.2 PDB: 3g2t_A* 3g2u_A 3g2v_A* 3g2w_A 1ujk_A* 1jwf_A 1ujj_A 1jwg_A* 1py1_A* Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>1juq_A ADP-ribosylation factor binding protein GGA3; protein-peptide compelx, VHS domain, DXXLL sorting signal, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.9.2 PDB: 1jpl_A 1lf8_A* Back     alignment and structure
>3qml_C Protein SLS1, nucleotide exchange factor SIL1; armadillo like repeats, chaperone-protein transport complex; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 542
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-13
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-06
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 2e-06
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 2e-13
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 3e-11
d1wa5b_ 503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 0.003
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 4e-10
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 7e-07
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 1e-09
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 3e-09
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 0.002
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 2e-09
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 1e-04
d1u6gc_1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 6e-04
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 3e-09
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 4e-05
d2vglb_579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 4e-09
d2vglb_ 579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 2e-07
d1qbkb_888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 4e-09
d1qbkb_ 888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 1e-05
d1qbkb_888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 2e-04
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 2e-07
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 3e-05
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 0.002
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 0.002
d1oyza_276 a.118.1.16 (A:) Hypothetical protein YibA {Escheri 6e-07
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 8e-06
d1lrva_233 a.118.1.5 (A:) Leucine-rich repeat variant {Azotob 0.004
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Plakophilin 1 helical region
domain: Plakophilin 1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 70.6 bits (171), Expect = 1e-13
 Identities = 43/325 (13%), Positives = 98/325 (30%), Gaps = 29/325 (8%)

Query: 126 DLDSIISSLHDFDPDTRANAALALGGLAKDNKHFAERIVQCGALPPLVQILASPQLSLKH 185
            +   +  L   D   +A  A  +      ++   +++ Q G +  LV +L SP  +++ 
Sbjct: 3   TIPKAVQYLSSQDEKYQAIGAYYIQHTCFQDESAKQQVYQLGGICKLVDLLRSPNQNVQQ 62

Query: 186 AAAFALDGIVKHSPELAESASDCDVIPLLIKALNN-DEVNVKADAFLCLADIAKDSPSLA 244
           AAA AL  +V  S          + I   +  L       ++      L +++       
Sbjct: 63  AAAGALRNLVFRSTTNKLETRRQNGIREAVSLLRRTGNAEIQKQLTGLLWNLSSTDELKE 122

Query: 245 STIADGATTLAVEHLTYPHGL---------------VQKNAATLLRDMCKHNLRLANLVV 289
             IAD    LA   +    G                V  NA   LR++   +     +  
Sbjct: 123 ELIADALPVLADRVIIPFSGWCDGNSNMSREVVDPEVFFNATGCLRNLSSADAGRQTMRN 182

Query: 290 LAGGLDGLLRLIDC---NGGYNSLPAIMALGYMSAQSEQIAEQIIELQGVGSLQTILQCP 346
            +G +D L+  +         +       +  +   S ++  ++                
Sbjct: 183 YSGLIDSLMAYVQNCVAASRCDDKSVENCMCVLHNLSYRLDAEVPTRYRQLEYNARNAYT 242

Query: 347 H----------KEQLQVAAAWTLGQIGKHSVDNVTALCEENVLSTLLSKITQTCVSDNLK 396
                       +++            + +      L   + + T L+ + ++     L+
Sbjct: 243 EKSSTGCFSNKSDKMMNNNYDCPLPEEETNPKGSGWLYHSDAIRTYLNLMGKSKKDATLE 302

Query: 397 SKCKNALNILIPKCENPKELEQMLL 421
           +      N+   K      + Q++ 
Sbjct: 303 ACAGALQNLTASKGLMSSGMSQLIG 327


>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Length = 276 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Length = 233 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query542
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 100.0
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 100.0
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 100.0
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 100.0
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.85
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.84
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.74
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.73
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 99.72
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 99.67
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.51
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.46
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.46
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 99.37
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.35
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.26
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 99.22
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 99.2
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.12
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.09
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 99.09
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.98
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.81
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.47
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.46
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.43
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 97.57
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 97.52
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 97.43
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 97.4
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 97.31
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 97.11
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 96.75
d1wa5c_959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 95.71
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 91.56
d1ujka_145 ADP-ribosylation factor binding protein Gga1 {Huma 81.16
d1mhqa_143 ADP-ribosylation factor binding protein Gga2 {Huma 80.32
d1dvpa1145 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 80.18
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Karyopherin alpha
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00  E-value=3.8e-38  Score=324.40  Aligned_cols=397  Identities=15%  Similarity=0.195  Sum_probs=354.9

Q ss_pred             cCcHHHHHHhhccCCHHHHHHHHHHHHHHhcC--ChhhhhHhhcCChHHHHhhhcCC-CHHHHHHHHHHHHHhhcCChHH
Q psy12594         83 RNLVALVLKDLTKQNKHYKKTALHMLTCVAQQ--DERCAGLIEDKDLDSIISSLHDF-DPDTRANAALALGGLAKDNKHF  159 (542)
Q Consensus        83 ~~~l~~Lv~~L~~~~~~~~~~a~~~L~~l~~~--~~~~~~~~~~g~v~~Lv~lL~~~-~~~~~~~a~~~L~~l~~~~~~~  159 (542)
                      ...++.++..+.+++...+..++..++++...  .+....+++.|+++.|+++++.. ++.++..|+++|.+++..++..
T Consensus        75 ~~~l~~~~~~~~s~~~~~~~~a~~~~r~~ls~~~~~~i~~ii~~g~i~~Lv~~l~~~~~~~iq~~a~~~L~ni~~~~~~~  154 (503)
T d1wa5b_          75 QQELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQ  154 (503)
T ss_dssp             -CCHHHHHHHHSCSSHHHHHHHHHHHHHHTCCSSSCSHHHHHHTTCHHHHHHTTSTTSCHHHHHHHHHHHHHHTTSCHHH
T ss_pred             HHHHHHHHHHhcCCCHHHHHHHHHHHHHHHhcCCCchHHHHHHCCChHHHHHHHcCCCCHHHHHHHHHHHHHHHcCCHHH
Confidence            45788999999999999999999999998643  33344488999999999999854 6889999999999999988888


Q ss_pred             HHHHHHcCChHHHHHhccCCCHhHHHHHHHHHHHHhcCCHHHHHHhhhCCChHHHHHhhcCCCHHHHHHHHHHHHHHhcC
Q psy12594        160 AERIVQCGALPPLVQILASPQLSLKHAAAFALDGIVKHSPELAESASDCDVIPLLIKALNNDEVNVKADAFLCLADIAKD  239 (542)
Q Consensus       160 ~~~i~~~g~i~~L~~ll~~~~~~~~~~a~~~L~nl~~~~~~~~~~~~~~~~i~~L~~ll~~~~~~~~~~a~~~L~~l~~~  239 (542)
                      ...+.+.|+++.++.++.+++.+++..|+|+|+||+..+++.+..+.+.|+++.|+.++.+.+..+++.++|+|++++..
T Consensus       155 ~~~~~~~g~i~~l~~lL~s~~~~i~~~a~~~L~nia~~~~~~r~~l~~~~~~~~L~~ll~~~~~~~~~~~~~~l~nl~~~  234 (503)
T d1wa5b_         155 TKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRG  234 (503)
T ss_dssp             HHHHHHTTCHHHHHHHHHHCCHHHHHHHHHHHHHHHTTCHHHHHHHHHTTCHHHHHHGGGSCCHHHHHHHHHHHHHHHCC
T ss_pred             HHHHHhCCChHHHHHHhcCCChhHHHHHHHHHHHHhhhhHHHHHHHHhhcccccchhhcccCCHHHHHHHHHHHHHHhcC
Confidence            89999999999999999999999999999999999998899999999999999999999999999999999999999987


Q ss_pred             ChhhHHHHHhhchHH-HHHhhcCCChhHHHHHHHHHHHHhcCChHHHHHHHhcCCHHHHHHhhhcCCccchHHHHHHHhH
Q psy12594        240 SPSLASTIADGATTL-AVEHLTYPHGLVQKNAATLLRDMCKHNLRLANLVVLAGGLDGLLRLIDCNGGYNSLPAIMALGY  318 (542)
Q Consensus       240 ~~~~~~~~~~~~~i~-L~~lL~~~~~~v~~~a~~~L~~L~~~~~~~~~~~~~~~~i~~Lv~lL~~~~~~~~~~a~~~L~~  318 (542)
                      ...........++++ ++.++.+.+++++..++|+|.+++.+.++....+.+.++++.++.++.++++.++..++.++++
T Consensus       235 ~~~~~~~~~~~~~l~~l~~~l~~~d~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~l~~ll~~~~~~v~~~al~~l~n  314 (503)
T d1wa5b_         235 KKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGN  314 (503)
T ss_dssp             SSSCCCHHHHGGGHHHHHHHTTCCCHHHHHHHHHHHHHHHSSCHHHHHHHHHTTCHHHHHHGGGCSCHHHHHHHHHHHHH
T ss_pred             CccchHHHHHHHHHHHHHHHhccccHHHHHHHHHHHHhhccCCchhhhhhhhhhhhhhhhhcccCCchhhhhhHHHHHHH
Confidence            654444455568899 9999999999999999999999999888888888999999999999999999999999999999


Q ss_pred             hhcCChHHHHHHHhhCchHHHHHhhcCCChhhHHHHHHHHHHHhhcCChHHHHHHHHcCChHHHHHHHhcCCCChHHHHH
Q psy12594        319 MSAQSEQIAEQIIELQGVGSLQTILQCPHKEQLQVAAAWTLGQIGKHSVDNVTALCEENVLSTLLSKITQTCVSDNLKSK  398 (542)
Q Consensus       319 l~~~~~~~~~~~~~~~~l~~L~~ll~~~~~~~v~~~a~~~L~~l~~~~~~~~~~l~~~~~l~~L~~ll~~~~~~~~v~~~  398 (542)
                      ++.+++.....+++.|+++.|..++.++ ++.++..++|+++|++.+++.....+++.++++.++.++.++  +.+++.+
T Consensus       315 l~~~~~~~~~~~~~~~~l~~l~~ll~~~-~~~i~~~~~~~l~nl~~~~~~~~~~i~~~~~l~~li~~l~~~--~~~v~~~  391 (503)
T d1wa5b_         315 IVTGNDLQTQVVINAGVLPALRLLLSSP-KENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVA--EYKTKKE  391 (503)
T ss_dssp             HTTSCHHHHHHHHHTTHHHHHHHHTTCS-CHHHHHHHHHHHHHHTTSCHHHHHHHHHTTCHHHHHHHHHHS--CHHHHHH
T ss_pred             HHHHHHHHHHhhhccchHHHHHHHhcCC-CHHHHHHHHHHHHHHhhccHHHHHHHHHccccchhHHhcccC--ChhHHHH
Confidence            9999999999999999999999999885 568999999999999999999999999999999999999987  5699999


Q ss_pred             HHHHHHHHHh-------------hCCCchhhHHhhcCCCCHHHHHHHHHHHHhhCCCChh-----------hhhHHHHhc
Q psy12594        399 CKNALNILIP-------------KCENPKELEQMLLGNVSEELLASILCAFAKILPCDPV-----------ARRSFVTSH  454 (542)
Q Consensus       399 a~~aL~nl~~-------------~~~~i~~L~~lL~~~~~~~v~~~~l~~l~~ll~~~~~-----------~~~~~~~~g  454 (542)
                      |+|+|+|++.             +.+.+++|+++|. ..|++++..++.+|.+++..+..           ....|.+.|
T Consensus       392 a~~~l~nl~~~~~~~~~~~~~l~~~~~l~~l~~~L~-~~d~~~~~~~L~~l~~ll~~~~~~~~~~~~~~~~~~~~iee~g  470 (503)
T d1wa5b_         392 ACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLE-IADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAG  470 (503)
T ss_dssp             HHHHHHHHHHHTTTCTHHHHHHHHTTCHHHHHHHTT-TCCHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCHHHHHHHHTT
T ss_pred             HHHHHHHHHhcccccHHHHHHHHHCCcHHHHHHHhc-CCCHHHHHHHHHHHHHHHHHHHHHhhhhcccchHHHHHHHHCC
Confidence            9999999963             2467889999999 99999999999999999864432           234678999


Q ss_pred             chHHhhhcC--CCCcHH-HHHHHHhccCccch
Q psy12594        455 CLRKVQEIE--PTPEIA-PHLKTINACFPNEV  483 (542)
Q Consensus       455 ~~~~l~~l~--~~~~~~-~a~~~l~~~~~~~~  483 (542)
                      |++.|+.++  ++.+++ +|..+|++||++|.
T Consensus       471 ~~~~i~~Lq~~~~~~i~~~A~~il~~~f~~~~  502 (503)
T d1wa5b_         471 GMEKIFNCQQNENDKIYEKAYKIIETYFGEEE  502 (503)
T ss_dssp             HHHHHHGGGGCSCHHHHHHHHHHHHHHSSSCC
T ss_pred             CHHHHHHHHcCCCHHHHHHHHHHHHHHcCCcC
Confidence            999999998  677787 59999999998764



>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujka_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mhqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure