Psyllid ID: psy12639


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAFVDVNTVAQVKQEYEELPVKVELNEFDLD
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccHHHHHHHHcccccccccccccccc
ccccEEEcccccccccccccccEccccHHHHEEEEcHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHcccccccccccEccccHHHHHHHHccccccEccccccccc
meshlmlhtgakpyactecdqkfnrnsklKIHYNLAhctgemyecchcarsfpcksyliphlrvhtgekpyacnlctvRYLRSYELVLHLKKChredarnpyapafvdvNTVAQVKQEYEelpvkvelnefdld
meshlmlhtgakpyactECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAFVDVNTVAQVKQEyeelpvkvelnefdld
MESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAFVDVNTVAQVKQEYEELPVKVELNEFDLD
*******HTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAFVDVNTVAQVKQEYEELPVK*********
MESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAFVDVNTVAQVKQEYEELPVKVELNEFDL*
********TGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAFVDVNTVAQVKQEYEELPVKVELNEFDLD
MESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAFVDVNTVAQVKQEYEELPVKVELNEFDL*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAFVDVNTVAQVKQEYEELPVKVELNEFDLD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query134 2.2.26 [Sep-21-2011]
Q5R670563 Zinc finger protein with yes N/A 0.776 0.184 0.424 5e-17
Q4KLI1562 Zinc finger protein with yes N/A 0.776 0.185 0.424 6e-17
Q6NX49715 Zinc finger protein 544 O yes N/A 0.738 0.138 0.405 7e-17
Q8BGS3561 Zinc finger protein with no N/A 0.776 0.185 0.405 8e-17
O95201554 Zinc finger protein 205 O no N/A 0.641 0.155 0.471 9e-17
Q58DK7550 Zinc finger protein 205 O no N/A 0.641 0.156 0.471 1e-16
P17029563 Zinc finger protein with no N/A 0.768 0.182 0.409 1e-16
Q86W11494 Zinc finger and SCAN doma no N/A 0.686 0.186 0.457 1e-16
P10754512 Zinc finger protein 13 OS no N/A 0.641 0.167 0.459 1e-16
Q5R5U3 672 Zinc finger protein 271 O no N/A 0.641 0.127 0.449 1e-16
>sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 Back     alignment and function desciption
 Score = 86.3 bits (212), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 61/106 (57%), Gaps = 2/106 (1%)

Query: 4   HLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLR 63
           H  +H+G KPY C EC + F+++S L  H  + H   + YEC  C ++F   SYLI H R
Sbjct: 451 HQRIHSGEKPYECNECGKAFSQSSDLTKHQRI-HTGEKPYECSECGKAFNRNSYLILHRR 509

Query: 64  VHTGEKPYACNLCTVRYLRSYELVLHLKKCHREDARNPYAPAFVDV 109
           +HT EKPY C  C   + RS  L LH +   RE A + Y+PA +D 
Sbjct: 510 IHTREKPYKCTKCGKAFTRSSTLTLHHRIHARERA-SEYSPASLDA 554




May be involved in transcriptional regulation.
Pongo abelii (taxid: 9601)
>sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=2 SV=1 Back     alignment and function description
>sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=2 SV=1 Back     alignment and function description
>sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 Back     alignment and function description
>sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 Back     alignment and function description
>sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 Back     alignment and function description
>sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 Back     alignment and function description
>sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=2 SV=1 Back     alignment and function description
>sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 Back     alignment and function description
>sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query134
395516196 1798 PREDICTED: uncharacterized protein LOC10 0.634 0.047 0.476 9e-17
297283336 1466 PREDICTED: hypothetical protein LOC70097 0.641 0.058 0.482 1e-16
326666706 335 PREDICTED: zinc finger protein 85-like [ 0.649 0.259 0.431 1e-16
321478428 865 falls into Kruppel clade in ML phylogeny 0.664 0.102 0.455 2e-16
334333685 638 PREDICTED: zinc finger protein 470-like 0.634 0.133 0.476 3e-16
326680459 288 PREDICTED: gastrula zinc finger protein 0.641 0.298 0.471 3e-16
326666769 346 PREDICTED: oocyte zinc finger protein Xl 0.649 0.251 0.443 4e-16
326666919217 PREDICTED: zinc finger protein 681-like, 0.641 0.396 0.448 4e-16
148688931 941 mCG1029863 [Mus musculus] 0.865 0.123 0.398 5e-16
326667351 345 PREDICTED: gastrula zinc finger protein 0.641 0.249 0.448 6e-16
>gi|395516196|ref|XP_003762278.1| PREDICTED: uncharacterized protein LOC100917234 [Sarcophilus harrisii] Back     alignment and taxonomy information
 Score = 91.7 bits (226), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 41/86 (47%), Positives = 55/86 (63%), Gaps = 1/86 (1%)

Query: 4    HLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLR 63
            H  +HTG KPY C EC + F+R+S+L +H  + H   + YEC  C ++F C SYLI H R
Sbjct: 1695 HQGVHTGEKPYECQECGKTFSRSSRLIVHQRI-HTGEKPYECNECGKAFSCSSYLIVHQR 1753

Query: 64   VHTGEKPYACNLCTVRYLRSYELVLH 89
            +HTGEKPY CN C   + +S  L+ H
Sbjct: 1754 IHTGEKPYRCNECGKAFGQSSHLIFH 1779




Source: Sarcophilus harrisii

Species: Sarcophilus harrisii

Genus: Sarcophilus

Family: Dasyuridae

Order: Dasyuromorphia

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|297283336|ref|XP_001091860.2| PREDICTED: hypothetical protein LOC700976 [Macaca mulatta] Back     alignment and taxonomy information
>gi|326666706|ref|XP_003198344.1| PREDICTED: zinc finger protein 85-like [Danio rerio] Back     alignment and taxonomy information
>gi|321478428|gb|EFX89385.1| falls into Kruppel clade in ML phylogeny [Daphnia pulex] Back     alignment and taxonomy information
>gi|334333685|ref|XP_003341751.1| PREDICTED: zinc finger protein 470-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|326680459|ref|XP_003201525.1| PREDICTED: gastrula zinc finger protein XlCGF57.1-like [Danio rerio] Back     alignment and taxonomy information
>gi|326666769|ref|XP_003198370.1| PREDICTED: oocyte zinc finger protein XlCOF6-like [Danio rerio] Back     alignment and taxonomy information
>gi|326666919|ref|XP_003198418.1| PREDICTED: zinc finger protein 681-like, partial [Danio rerio] Back     alignment and taxonomy information
>gi|148688931|gb|EDL20878.1| mCG1029863 [Mus musculus] Back     alignment and taxonomy information
>gi|326667351|ref|XP_003198578.1| PREDICTED: gastrula zinc finger protein XlCGF57.1-like [Danio rerio] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query134
ZFIN|ZDB-GENE-110914-34322 si:dkey-149m13.4 "si:dkey-149m 0.641 0.267 0.471 8e-21
ZFIN|ZDB-GENE-110914-22340 si:dkey-269o24.6 "si:dkey-269o 0.656 0.258 0.461 1e-20
ZFIN|ZDB-GENE-110914-33 350 si:ch211-161m3.1 "si:ch211-161 0.634 0.242 0.477 2.7e-20
ZFIN|ZDB-GENE-080215-12 600 zgc:173710 "zgc:173710" [Danio 0.641 0.143 0.471 6.4e-20
ZFIN|ZDB-GENE-110913-180339 si:ch73-266f23.1 "si:ch73-266f 0.701 0.277 0.458 1.2e-19
UNIPROTKB|F1M5S6308 F1M5S6 "Uncharacterized protei 0.686 0.298 0.457 1.9e-19
ZFIN|ZDB-GENE-110914-134218 si:ch211-208f21.2 "si:ch211-20 0.686 0.422 0.437 1.9e-19
UNIPROTKB|B3KRF7350 ZKSCAN1 "Zinc finger protein w 0.761 0.291 0.433 2e-19
ZFIN|ZDB-GENE-080305-5320 zgc:174275 "zgc:174275" [Danio 0.664 0.278 0.434 3.1e-19
ZFIN|ZDB-GENE-080219-37339 zgc:171604 "zgc:171604" [Danio 0.708 0.280 0.443 3.1e-19
ZFIN|ZDB-GENE-110914-34 si:dkey-149m13.4 "si:dkey-149m13.4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 245 (91.3 bits), Expect = 8.0e-21, P = 8.0e-21
 Identities = 42/89 (47%), Positives = 59/89 (66%)

Query:     4 HLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEM-YECCHCARSFPCKSYLIPHL 62
             H+M+HTG KP+ CT+C + FN++S L +H  + H TGE  + C HC +SF C S+LI H 
Sbjct:   140 HMMIHTGKKPFTCTQCAKSFNQSSHLNLHM-MIH-TGEKPFTCTHCGKSFNCSSHLIQHT 197

Query:    63 RVHTGEKPYACNLCTVRYLRSYELVLHLK 91
             R+HTGEKP+ C  C   +  S  L LH++
Sbjct:   198 RIHTGEKPFTCTQCGKSFSHSSHLNLHMR 226


GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
ZFIN|ZDB-GENE-110914-22 si:dkey-269o24.6 "si:dkey-269o24.6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110914-33 si:ch211-161m3.1 "si:ch211-161m3.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080215-12 zgc:173710 "zgc:173710" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-180 si:ch73-266f23.1 "si:ch73-266f23.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1M5S6 F1M5S6 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110914-134 si:ch211-208f21.2 "si:ch211-208f21.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|B3KRF7 ZKSCAN1 "Zinc finger protein with KRAB and SCAN domains 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080305-5 zgc:174275 "zgc:174275" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080219-37 zgc:171604 "zgc:171604" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
COG5189423 COG5189, SFP1, Putative transcriptional repressor 0.003
>gnl|CDD|227516 COG5189, SFP1, Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
 Score = 35.8 bits (82), Expect = 0.003
 Identities = 22/87 (25%), Positives = 31/87 (35%), Gaps = 12/87 (13%)

Query: 10  GAKPYAC--TECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTG 67
             KPY C    C++K+   + LK H    H   +++E                       
Sbjct: 346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHE----------NPSPEKMNIFSAK 395

Query: 68  EKPYACNLCTVRYLRSYELVLHLKKCH 94
           +KPY C +C  RY     L  H K  H
Sbjct: 396 DKPYRCEVCDKRYKNLNGLKYHRKHSH 422


Length = 423

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 134
KOG2462|consensus279 99.93
KOG2462|consensus279 99.89
KOG3576|consensus267 99.71
KOG3623|consensus1007 99.67
KOG1074|consensus 958 99.67
KOG1074|consensus958 99.65
KOG3576|consensus267 99.6
KOG3623|consensus 1007 99.59
KOG3608|consensus 467 99.56
KOG3608|consensus467 99.45
PHA00733128 hypothetical protein 99.42
PHA0276855 hypothetical protein; Provisional 99.1
PLN03086567 PRLI-interacting factor K; Provisional 99.07
PLN03086567 PRLI-interacting factor K; Provisional 99.04
PHA00733128 hypothetical protein 98.99
PHA0276855 hypothetical protein; Provisional 98.97
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.91
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.89
PHA0061644 hypothetical protein 98.81
KOG3993|consensus500 98.69
PHA0061644 hypothetical protein 98.58
PHA0073279 hypothetical protein 98.49
PHA0073279 hypothetical protein 98.49
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.48
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.37
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.29
KOG3993|consensus500 98.24
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 98.17
COG5189423 SFP1 Putative transcriptional repressor regulating 98.16
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.12
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.99
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.97
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.79
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.79
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.71
smart0035526 ZnF_C2H2 zinc finger. 97.55
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.28
smart0035526 ZnF_C2H2 zinc finger. 97.1
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.03
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.02
PRK04860160 hypothetical protein; Provisional 96.97
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.96
KOG4173|consensus253 96.76
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 96.73
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.69
PRK04860160 hypothetical protein; Provisional 96.66
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.61
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.25
COG404965 Uncharacterized protein containing archaeal-type C 95.85
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 95.53
COG5189423 SFP1 Putative transcriptional repressor regulating 95.32
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 95.05
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 95.01
KOG1146|consensus 1406 94.86
KOG1146|consensus 1406 94.01
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 93.44
COG404965 Uncharacterized protein containing archaeal-type C 93.37
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 93.05
COG5048467 FOG: Zn-finger [General function prediction only] 92.98
PF1371937 zinc_ribbon_5: zinc-ribbon domain 92.69
KOG2231|consensus 669 92.62
COG5048467 FOG: Zn-finger [General function prediction only] 92.61
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 92.06
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 91.71
PF1371736 zinc_ribbon_4: zinc-ribbon domain 91.29
COG1592166 Rubrerythrin [Energy production and conversion] 91.07
KOG2893|consensus 341 91.04
KOG2186|consensus 276 90.93
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 90.86
COG5236 493 Uncharacterized conserved protein, contains RING Z 90.27
smart00531147 TFIIE Transcription initiation factor IIE. 89.69
PF09986214 DUF2225: Uncharacterized protein conserved in bact 89.54
PRK06266178 transcription initiation factor E subunit alpha; V 89.5
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 89.5
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 88.93
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 88.34
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 87.73
PRK06266178 transcription initiation factor E subunit alpha; V 87.43
KOG2482|consensus 423 87.2
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 86.31
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 86.24
PHA0062659 hypothetical protein 85.8
PRK00464154 nrdR transcriptional regulator NrdR; Validated 85.47
COG5236 493 Uncharacterized conserved protein, contains RING Z 85.25
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 85.19
KOG2893|consensus 341 84.44
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 84.15
KOG2186|consensus 276 83.95
KOG2785|consensus 390 83.85
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 83.49
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 83.46
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 83.01
KOG2231|consensus 669 82.8
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 82.54
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 81.14
COG0068 750 HypF Hydrogenase maturation factor [Posttranslatio 80.12
>KOG2462|consensus Back     alignment and domain information
Probab=99.93  E-value=1e-26  Score=148.32  Aligned_cols=115  Identities=23%  Similarity=0.460  Sum_probs=105.3

Q ss_pred             ChhHhhhccC---CCceeCccchhhccChHHHHHHHhccccCCCceecCCCCCccCChhhHHhHHhhhcCCCCcccCccc
Q psy12639          1 MESHLMLHTG---AKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCT   77 (134)
Q Consensus         1 l~~h~~~h~~---~~~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~   77 (134)
                      |.+|.++|..   .+-+.|+.|++.|.+...|..|+++ |+  .++.|.+||+.|...=.|+.|+|+|+|+|||.|+.|+
T Consensus       146 LsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirT-H~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~  222 (279)
T KOG2462|consen  146 LSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRT-HT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCG  222 (279)
T ss_pred             cchhhcccccccccccccCCCCCceeeehHHHhhHhhc-cC--CCcccccccccccchHHhhcccccccCCCCccCCccc
Confidence            5677777763   4668999999999999999999997 76  4789999999999999999999999999999999999


Q ss_pred             hhhcCHHHHHHHHHhhcCCCCCCCC--CCCcccchhhhhhhhh
Q psy12639         78 VRYLRSYELVLHLKKCHREDARNPY--APAFVDVNTVAQVKQE  118 (134)
Q Consensus        78 ~~f~~~~~l~~H~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~  118 (134)
                      |+|..+++|+.|+++|.+.+.|.|.  ++.|....-|.+|...
T Consensus       223 kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  223 KAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             chhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            9999999999999999999999999  8899999999998754



>KOG2462|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-12
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 3e-12
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 4e-12
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 5e-12
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 5e-12
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 7e-12
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 8e-12
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-11
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-11
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 5e-11
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 8e-10
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-09
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 1e-08
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 3e-08
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 6e-08
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 7e-08
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 3e-07
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 3e-07
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 6e-07
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 1e-06
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 3e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 3e-06
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 4e-06
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 7e-06
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 8e-06
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 9e-06
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 9e-06
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 2e-05
2eog_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-05
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 9e-05
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 1e-04
2ytq_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 2e-04
2ytp_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2epu_A45 Solution Structure Of The Secound C2h2 Type Zinc Fi 5e-04
2emw_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 6e-04
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 9e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 67.8 bits (164), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 35/91 (38%), Positives = 49/91 (53%), Gaps = 1/91 (1%) Query: 1 MESHLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIP 60 + +H HTG KPYAC EC + F++ + L+ H H + Y+C C +SF + L Sbjct: 93 LRAHQRTHTGEKPYACPECGKSFSQLAHLRAH-QRTHTGEKPYKCPECGKSFSREDNLHT 151 Query: 61 HLRVHTGEKPYACNLCTVRYLRSYELVLHLK 91 H R HTGEKPY C C + R L +H + Sbjct: 152 HQRTHTGEKPYKCPECGKSFSRRDALNVHQR 182
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2EOG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 693- 723) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2YTQ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 775- 807) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2YTP|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 687- 719) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EPU|A Chain A, Solution Structure Of The Secound C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 32 Length = 45 Back     alignment and structure
>pdb|2EMW|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 301- 331) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 9e-25
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-21
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-17
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-13
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-23
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-21
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-23
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-23
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-23
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-18
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 4e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-23
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-05
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-22
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 8e-22
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-22
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-17
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-12
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-21
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-20
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-09
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-21
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-21
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 7e-21
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-17
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 7e-13
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-20
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-12
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-20
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-12
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-20
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-19
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-18
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-19
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-18
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 9e-19
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-11
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-18
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-16
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 9e-16
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-18
1tf6_A190 Protein (transcription factor IIIA); complex (tran 9e-18
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-15
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-18
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-04
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-17
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-15
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-17
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-16
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-12
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-16
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-16
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-16
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-11
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-15
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-15
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-11
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-13
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-13
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-13
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 9e-13
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-12
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-12
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-12
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-12
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-12
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-12
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-12
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-12
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-12
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-12
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-12
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-12
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 6e-12
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 6e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-12
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-12
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-11
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-11
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-11
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-11
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-11
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-11
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-11
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-11
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-11
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-11
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-11
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-11
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-11
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-11
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-11
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-11
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-11
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-11
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-11
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-11
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-11
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-11
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-11
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-11
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-11
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-11
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-11
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-11
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-11
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-11
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-11
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-11
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-11
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-11
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-11
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-11
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-11
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 8e-11
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-11
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-10
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-10
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-10
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-10
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-10
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-10
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 9e-10
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 6e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-09
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-09
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-09
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-09
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 7e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-08
2epa_A72 Krueppel-like factor 10; transforming growth facto 4e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 5e-08
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 6e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-06
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 4e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 6e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 9e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 6e-04
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
 Score = 90.6 bits (226), Expect = 9e-25
 Identities = 30/94 (31%), Positives = 47/94 (50%), Gaps = 4/94 (4%)

Query: 4   HLMLHTGAKPYACTECDQKFNRNSKLKIH--YNLAHCTGEM-YECCHCARSFPCKSYLIP 60
           H   HTG KP+ C +C + + R   L  H   N  +   E  + C  C  +F  +  L  
Sbjct: 26  HNRKHTGEKPFECPKCGKCYFRKENLLEHEARNCMN-RSEQVFTCSVCQETFRRRMELRL 84

Query: 61  HLRVHTGEKPYACNLCTVRYLRSYELVLHLKKCH 94
           H+  HTGE PY C+ C+ ++++  +L  H+ K H
Sbjct: 85  HMVSHTGEMPYKCSSCSQQFMQKKDLQSHMIKLH 118


>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query134
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.95
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.94
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.93
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.92
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.92
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.91
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.91
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.9
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.9
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.9
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.9
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.9
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.9
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.9
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.9
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.9
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.89
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.89
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.89
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.88
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.88
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.87
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.87
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.84
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.84
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.84
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.83
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.82
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.81
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.81
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.79
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.79
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.74
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.74
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.74
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.74
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.73
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.73
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.73
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.72
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.72
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.72
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.72
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.71
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.71
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.71
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.71
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.71
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.7
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.7
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.69
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.68
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.68
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.68
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.68
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.67
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.67
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.67
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.66
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.66
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.66
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.66
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.65
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.64
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.64
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.64
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.64
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.63
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.62
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.61
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.61
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.61
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.59
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.58
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.58
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.54
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.54
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.53
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.52
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.51
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.5
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.49
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.48
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.48
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.48
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.48
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.47
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.47
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.47
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.47
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.47
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.47
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.46
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.46
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.46
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.46
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.46
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.46
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.45
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.45
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.45
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.45
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.45
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.45
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.45
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.45
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.45
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.45
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.44
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.44
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.44
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.44
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.44
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.44
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.44
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.44
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.43
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.43
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.43
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.43
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.43
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.42
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.41
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.41
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.41
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.4
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.4
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.4
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.4
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.4
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.39
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.39
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.39
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.39
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.39
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.39
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.39
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.38
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.38
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.38
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.38
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.38
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.38
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.38
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.38
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.38
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.37
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.37
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.37
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.36
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.36
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.36
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.36
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.35
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.35
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.35
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.35
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.35
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.35
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.34
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.34
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.34
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.34
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.34
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.34
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.34
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.33
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.33
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.32
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.31
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.31
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.3
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.3
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.3
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.29
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.29
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.29
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.29
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.29
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.29
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.29
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.28
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.28
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.28
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.28
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.28
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.28
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.28
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.28
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.28
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.27
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.27
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.27
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.27
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.26
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.25
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.25
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.24
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.23
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.23
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.22
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.21
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.2
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.19
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.19
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.18
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.18
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.18
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.17
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.14
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.14
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.06
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.06
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.05
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.04
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.0
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.99
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.98
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.98
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.98
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.97
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.96
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.96
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.91
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.91
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.91
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.9
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.87
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.87
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.86
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.86
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.85
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.84
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.84
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.81
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.81
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.78
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.77
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.77
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.76
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.75
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.73
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.72
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.71
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.71
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.7
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.68
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.67
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.66
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.65
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.65
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.65
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.64
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.63
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.63
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.62
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.62
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.6
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.6
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.57
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.57
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.57
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.57
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.56
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.56
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.53
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.94
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.52
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.91
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.51
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.48
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.43
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.43
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.8
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.42
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.42
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.41
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.39
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.37
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.37
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.36
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.34
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.32
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.65
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.64
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.28
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.27
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.26
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.52
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.18
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.03
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.99
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.36
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.32
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.07
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.05
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.64
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.2
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.79
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.29
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.02
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.8
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 92.58
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 91.4
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 90.14
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 88.88
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 88.44
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 88.35
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 87.92
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 87.52
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 87.29
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 86.28
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 85.47
2k5c_A95 Uncharacterized protein PF0385; structural genomic 84.51
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 84.01
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 83.35
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 82.7
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 81.36
1wir_A121 Protein arginine N-methyltransferase 3; C2H2 zinc 80.52
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
Probab=99.95  E-value=1.6e-28  Score=145.73  Aligned_cols=97  Identities=27%  Similarity=0.565  Sum_probs=91.2

Q ss_pred             HhhhccCCCceeCccchhhccChHHHHHHHhccccCCCceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhcCH
Q psy12639          4 HLMLHTGAKPYACTECDQKFNRNSKLKIHYNLAHCTGEMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRS   83 (134)
Q Consensus         4 h~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~~h~~~~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~   83 (134)
                      |..+|.|+++|.|++|++.|.....|..|+++ |+++++|.|..|++.|.....|..|++.|.+++||.|+.|++.|.+.
T Consensus        13 ~~~~h~Gek~y~C~~C~k~F~~~~~L~~H~~~-H~~~k~~~C~~C~k~F~~~~~L~~H~~~H~~~k~~~C~~C~k~F~~~   91 (133)
T 2lt7_A           13 YELIVDGRVYYICIVCKRSYVCLTSLRRHFNI-HSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINY   91 (133)
T ss_dssp             EEEEETTEEEEEETTTCCEESCHHHHHHHHHH-HHCCSCEECSSSSCEESSHHHHHHHHHHHHTCCCEEESSSCCEESSH
T ss_pred             ceeecCCCcCeECCCCCCCcCCHHHHHHHHHH-cCCCCCeeCCccCeecccccchhhhccccCCCccccCCCCCCCcCCH
Confidence            44678999999999999999999999999997 99999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhcCCCCCCC
Q psy12639         84 YELVLHLKKCHREDARNP  101 (134)
Q Consensus        84 ~~l~~H~~~~~~~~~~~~  101 (134)
                      +.|..|+++++++.|..+
T Consensus        92 ~~L~~H~~~hh~~~p~~~  109 (133)
T 2lt7_A           92 QFMSSHIKSVHSQDPSGD  109 (133)
T ss_dssp             HHHHHHHHHHTCCCTTSS
T ss_pred             HHHHHHhHHhcCCCCCCC
Confidence            999999999998766443



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wir_A Protein arginine N-methyltransferase 3; C2H2 zinc finger domain, PRMT3, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.37.1.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 134
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-08
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 4e-07
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-07
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-04
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 9e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.003
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.004
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 7e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 5e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.003
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 7e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 4e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.002
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 7e-05
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 3e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 4e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 6e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 7e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.004
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.002
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.004
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 44.6 bits (106), Expect = 3e-08
 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 43 YECCHCARSFPCKSYLIPHLR-VHTGEKPYACNL 75
          Y C  C + F    +L  H++ VHT E+P+ C +
Sbjct: 6  YICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQV 39


>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query134
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.75
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.73
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.46
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.44
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.43
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.42
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.41
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.36
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.35
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.33
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.32
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.32
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.29
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.28
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.26
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.26
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.24
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.2
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.18
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.14
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.14
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.13
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.11
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.1
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.07
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.06
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.05
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.03
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.96
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.95
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.85
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.84
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.84
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.79
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.75
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.7
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.65
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.63
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.59
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.5
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.45
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.44
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.34
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.32
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.3
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.28
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.19
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.18
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.15
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.13
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.09
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.08
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.95
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.95
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.94
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.91
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.85
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.84
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.83
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.81
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.78
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.76
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.75
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.71
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.67
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.67
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.6
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.57
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.5
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.49
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.46
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.45
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.45
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.44
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.32
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.23
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.22
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.19
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.17
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.11
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.05
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.94
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.89
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.88
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.86
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 96.72
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.71
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.68
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.65
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.65
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.43
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.4
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.18
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 96.18
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.05
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.92
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.91
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 95.59
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.5
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.44
d1y0jb136 U-shaped transcription factor, different fingers { 95.33
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.18
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 95.11
d1y0jb136 U-shaped transcription factor, different fingers { 95.08
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.8
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.61
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 94.5
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 94.47
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 94.33
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 94.28
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 93.69
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 93.36
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 92.87
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 92.73
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 92.48
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 90.88
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.04
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 89.51
d2yrka148 Zinc finger homeobox protein 4, ZFHX4 {Human (Homo 86.53
d2glia132 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 83.9
d1wjpa226 Zinc finger protein 295, ZNF295 {Human (Homo sapie 82.94
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 82.31
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 81.66
d1fu9a_36 U-shaped transcription factor, different fingers { 80.64
d1iroa_53 Rubredoxin {Clostridium pasteurianum [TaxId: 1501] 80.54
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.75  E-value=5.4e-19  Score=87.22  Aligned_cols=52  Identities=35%  Similarity=0.728  Sum_probs=30.1

Q ss_pred             CceecCCCCCccCChhhHHhHHhhhcCCCCcccCccchhhcCHHHHHHHHHhh
Q psy12639         41 EMYECCHCARSFPCKSYLIPHLRVHTGEKPYACNLCTVRYLRSYELVLHLKKC   93 (134)
Q Consensus        41 ~~~~C~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~   93 (134)
                      +||.|. ||+.|.....|..|++.|.+++||.|..||+.|...+.|..|+++|
T Consensus         2 K~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           2 KLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             cCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            455553 5555555555555555555555555555555555555555555543



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia1 g.37.1.1 (A:103-134) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa2 g.37.1.1 (A:43-66) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure