Psyllid ID: psy12680
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 2567 | 2.2.26 [Sep-21-2011] | |||||||
| Q8WXX0 | 4024 | Dynein heavy chain 7, axo | yes | N/A | 0.234 | 0.149 | 0.515 | 0.0 | |
| Q63170 | 4057 | Dynein heavy chain 7, axo | yes | N/A | 0.230 | 0.145 | 0.522 | 0.0 | |
| Q8BW94 | 4083 | Dynein heavy chain 3, axo | no | N/A | 0.315 | 0.198 | 0.377 | 1e-158 | |
| Q8TD57 | 4116 | Dynein heavy chain 3, axo | no | N/A | 0.240 | 0.150 | 0.447 | 1e-156 | |
| Q923J6 | 3092 | Dynein heavy chain 12, ax | no | N/A | 0.154 | 0.128 | 0.484 | 1e-113 | |
| Q3V0Q1 | 3086 | Dynein heavy chain 12, ax | no | N/A | 0.154 | 0.128 | 0.474 | 1e-110 | |
| Q6ZR08 | 3092 | Dynein heavy chain 12, ax | no | N/A | 0.164 | 0.136 | 0.442 | 1e-109 | |
| Q63164 | 4516 | Dynein heavy chain 1, axo | no | N/A | 0.239 | 0.136 | 0.359 | 1e-106 | |
| Q9C0G6 | 4158 | Dynein heavy chain 6, axo | no | N/A | 0.235 | 0.145 | 0.317 | 1e-101 | |
| P0C6F1 | 4456 | Dynein heavy chain 2, axo | no | N/A | 0.231 | 0.133 | 0.349 | 1e-100 |
| >sp|Q8WXX0|DYH7_HUMAN Dynein heavy chain 7, axonemal OS=Homo sapiens GN=DNAH7 PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 662 bits (1709), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 344/667 (51%), Positives = 448/667 (67%), Gaps = 64/667 (9%)
Query: 1935 EPQDLEVASPATITDESMVEDLSNLLNSGEVPNIFASDEKAEICEKMGVIDRQKDKSMQT 1994
E Q + + + I +ES +ED+SNLLN+GE+PN+FA DEK EIC+KM +DRQ+DK+ QT
Sbjct: 2391 EMQGVFLFTDTQIKEESFLEDVSNLLNAGEIPNLFALDEKQEICDKMRQLDRQRDKTKQT 2450
Query: 1995 DGTMMALFKFFVD--------------------------------------TPWPPDALL 2016
DG+ +ALF F+D WP DAL
Sbjct: 2451 DGSPIALFNMFIDHCRSQLHVVLAMSPIGDAFRNRLRKFPALVNCCTIDWFQSWPEDALQ 2510
Query: 2017 AVATRFLNEVELSEAERQISIDMCQNFHVSTQNLSDEFLVKTSRHVYVTPTSYLELISTF 2076
AVA+RFL E+E+SE R IDMC++FH ST +LS F V+ R+ YVTPTSYLELISTF
Sbjct: 2511 AVASRFLEEIEMSEEIRDGCIDMCKSFHTSTIDLSKSFFVELQRYNYVTPTSYLELISTF 2570
Query: 2077 KQLLKVKQEEVLNGKNRYTVGLEKLDKAASQIAVMREEIEYLQPFLMVSAANIKELMVTV 2136
K LL+ K+ EV+ K RY VGLEKLD A+SQ+A M+ E+E L P L V++ + E+M+ +
Sbjct: 2571 KLLLEKKRSEVMKMKKRYEVGLEKLDSASSQVATMQMELEALHPQLKVASKEVDEMMIMI 2630
Query: 2137 EKESAEAAIVAEGVKKDEEVANEQALAAQAMKSVAEGVKKDEEVANEQALAAQAMKSECE 2196
EKES E A K E++ VK DE +ANEQA+A++A+K EC+
Sbjct: 2631 EKESVEVA-------KTEKI-----------------VKADETIANEQAMASKAIKDECD 2666
Query: 2197 EILSEAIPILEAAEAALNTLTSNDITVVKTMKSPPDIVKLVMKAVCILKGVKSERVPD-- 2254
L+ A+PILE+A AAL+TLT+ DITVVK+MKSPP VKLVM+A+CILKG+K++++PD
Sbjct: 2667 ADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPT 2726
Query: 2255 AGGQLVEDYWGPSKKLLGDIKFLEGLTNFNKDNVPAAVIKRLEDEFLSREDFDPEVVKKS 2314
G+ +ED+WGP+K+LLGD++FL+ L ++KDN+P A + + ++ DF PE ++ +
Sbjct: 2727 GSGKKIEDFWGPAKRLLGDMRFLQSLHEYDKDNIPPAYMNIIRKNYIPNPDFVPEKIRNA 2786
Query: 2315 STAAEGLCKWVIAICKYDKVAKIVGPKKEALRQAEEKLQLAMSALHEKQEQNRIVQEKLQ 2374
STAAEGLCKWVIA+ YDKVAKIV PKK L AE +L++AM L +KQ + VQ+KL
Sbjct: 2787 STAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGELKIAMDGLRKKQAALKEVQDKLA 2846
Query: 2375 KLQNTLDAKKKELKDLQDELDLCVKKKQRAEDLIGKLGGEKERWSSTAKMLNEKYYQLTG 2434
+LQ+TL+ K++ DL++++DLC KK +RAE LIG LGGEK RWS TA L + Y LTG
Sbjct: 2847 RLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSHTALELGQLYINLTG 2906
Query: 2435 DVLIAAGVVAYLGPFTVAFRQQQVSTWVKEVAACNIVCTKDFQLGAVMGNPVEIRAWNIF 2494
D+LI++GVVAYLG FT +RQ Q W +I C+ D L +G V IR WNI
Sbjct: 2907 DILISSGVVAYLGAFTSTYRQNQTKEWTTLCKGRDIPCSDDCSLMGTLGEAVTIRTWNIA 2966
Query: 2495 GLPCDSFSIDNGIIIKNSRRWPLMIDPQEQANKWIKNMEKANGLNVIRLSNTDYMRILEG 2554
GLP DSFSIDNGIII N+RRWPLMIDPQ QANKWIKNMEKAN L VI+LS DY+R LE
Sbjct: 2967 GLPSDSFSIDNGIIIMNARRWPLMIDPQSQANKWIKNMEKANSLYVIKLSEPDYVRTLEN 3026
Query: 2555 AIGFGFP 2561
I FG P
Sbjct: 3027 CIQFGTP 3033
|
Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Homo sapiens (taxid: 9606) |
| >sp|Q63170|DYH7_RAT Dynein heavy chain 7, axonemal OS=Rattus norvegicus GN=Dnah7 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q8BW94|DYH3_MOUSE Dynein heavy chain 3, axonemal OS=Mus musculus GN=Dnah3 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q8TD57|DYH3_HUMAN Dynein heavy chain 3, axonemal OS=Homo sapiens GN=DNAH3 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q923J6|DYH12_RAT Dynein heavy chain 12, axonemal OS=Rattus norvegicus GN=Dnah12 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q3V0Q1|DYH12_MOUSE Dynein heavy chain 12, axonemal OS=Mus musculus GN=Dnah12 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q6ZR08|DYH12_HUMAN Dynein heavy chain 12, axonemal OS=Homo sapiens GN=DNAH12 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q63164|DYH1_RAT Dynein heavy chain 1, axonemal OS=Rattus norvegicus GN=Dnah1 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9C0G6|DYH6_HUMAN Dynein heavy chain 6, axonemal OS=Homo sapiens GN=DNAH6 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|P0C6F1|DYH2_MOUSE Dynein heavy chain 2, axonemal OS=Mus musculus GN=Dnah2 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 2567 | ||||||
| 307192829 | 2289 | Dynein heavy chain 7, axonemal [Harpegna | 0.237 | 0.266 | 0.521 | 0.0 | |
| 242021167 | 3956 | ciliary dynein heavy chain, putative [Pe | 0.231 | 0.150 | 0.542 | 0.0 | |
| 270007962 | 3983 | hypothetical protein TcasGA2_TC014710 [T | 0.231 | 0.148 | 0.544 | 0.0 | |
| 403267243 | 4024 | PREDICTED: dynein heavy chain 7, axonema | 0.234 | 0.149 | 0.524 | 0.0 | |
| 334330021 | 3979 | PREDICTED: dynein heavy chain 7, axonema | 0.234 | 0.151 | 0.517 | 0.0 | |
| 291391949 | 4021 | PREDICTED: dynein, axonemal, heavy chain | 0.234 | 0.149 | 0.523 | 0.0 | |
| 348511659 | 3891 | PREDICTED: dynein heavy chain 7, axonema | 0.231 | 0.152 | 0.526 | 0.0 | |
| 443732906 | 2417 | hypothetical protein CAPTEDRAFT_228350 [ | 0.231 | 0.246 | 0.518 | 0.0 | |
| 405969117 | 4000 | Dynein heavy chain 7, axonemal [Crassost | 0.231 | 0.148 | 0.517 | 0.0 | |
| 395519974 | 3998 | PREDICTED: dynein heavy chain 7, axonema | 0.234 | 0.150 | 0.518 | 0.0 |
| >gi|307192829|gb|EFN75889.1| Dynein heavy chain 7, axonemal [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Score = 736 bits (1899), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 375/719 (52%), Positives = 465/719 (64%), Gaps = 110/719 (15%)
Query: 313 GITSDLFPGIELPETDYTILNKAVREVCEKANLQVTPFFLEKIQQIYEMMIVRWGFMIVG 372
GI SDLFPG+ LP DYT +N +E C NLQ T FFLEKIQQIYEMMIVR GFM+VG
Sbjct: 1497 GIASDLFPGVVLPTPDYTHINVCTQEACAATNLQCTDFFLEKIQQIYEMMIVRHGFMLVG 1556
Query: 373 LSFAGKTCAYRMLSEALQLIEEWGELGEHKVEIIVINPKSITMGQLYGQFDAVSHEWSDG 432
L F GKT AYR L+E L L+E + EH+VEI VINPK++TMGQLYGQFD SHEWSDG
Sbjct: 1557 LPFGGKTSAYRTLAECLSLLESRQLMSEHRVEISVINPKAVTMGQLYGQFDPASHEWSDG 1616
Query: 433 ILAVSYRQFAMSQNENRKWLIFDGPVDAIWIENMNSVLDDNKKLCLMSGEIIALAPTTSL 492
ILAVSYR FA S N NRKWL+FDGPVDAIWIENMN+VLDDNKKLCL SGEII LAPTTSL
Sbjct: 1617 ILAVSYRAFATSTNLNRKWLVFDGPVDAIWIENMNTVLDDNKKLCLTSGEIIQLAPTTSL 1676
Query: 493 IFEPQDLEVASPATVSRCGMIYMEPATLGWECLVDSWLNTLPPKVSRCGMIYMEPATLGW 552
IFEP DLEVASPATVSRCGMIYMEPA+LGW L+ SWLNTL PATL
Sbjct: 1677 IFEPMDLEVASPATVSRCGMIYMEPASLGWTPLLLSWLNTL-------------PATL-- 1721
Query: 553 ECLVDSWLNTLPPKVQEGHRDSLRQLIMRFCPTILYFLRRTPFARMVDDAMEAYKKKKRE 612
E + L+++ +RFCP +L+ +RR
Sbjct: 1722 ---------------DENIKGDLKEMYLRFCPPLLHLIRRCGAK---------------- 1750
Query: 613 EWEMFPTQDSNLIRSLLNLFDTFLDDFNDEKYYETHPSLDIRSQLEGIFFFSCIWSMGAC 672
E+ D+NL RS++ L+D FLDD++DEKY ++R+Q+EG FFFSCIW+MG
Sbjct: 1751 --EIITMPDANLTRSVMYLYDCFLDDYHDEKYVGALSDFNMRAQVEGCFFFSCIWAMGGT 1808
Query: 673 LTFETKPHFSNLLYGLMEKEFPASLRESLGLPVELCQPPAKPYLFTVPPQGTVYDYRFIK 732
L + F+ L L+ +FP ++R +P+E+ P +PY +P G+V+DY+FIK
Sbjct: 1809 LMANYREWFNVLFRALLADQFPKAVRARFDIPLEISD-PKRPYAVPLPLAGSVFDYKFIK 1867
Query: 733 EGKGRWKPWSDDLASAPAIPRDMPVNQIIVTTEETLRNIALMKLLVTHQKPVMFIGPTGT 792
EG+G+W PW DDL P IPRDMPVNQIIV+T ET+R L LVTH KPV+ +GPTGT
Sbjct: 1868 EGRGKWTPWLDDLKDVPPIPRDMPVNQIIVSTVETVRYFHLFHYLVTHHKPVLLVGPTGT 1927
Query: 793 GKSCYITVSILFIKNNSRLRSGFQHFLLKELSIEQWQPLIMNFSAQTSANQTQDIIMSKL 852
GKS YI +LL+ + E ++PL + FSAQT+ANQTQDIIMSKL
Sbjct: 1928 GKSVYI-----------------MEYLLQRTNPEIFKPLFVIFSAQTTANQTQDIIMSKL 1970
Query: 853 DKRRKEEISTIVDIGNEENNNSRLRSGFQHFLLKELSIEQWQPLIMNFSAQTSANQTQDI 912
D+RRKE +E+ H +L L S+ SA+
Sbjct: 1971 DRRRKE--------AHEKT----------HLVLTYL------------SSGVSAD----- 1995
Query: 913 IMSKLDKRRKGVYGPPLGKRCVVFVDDVNMPLKEEFGAQPPIEILRQWLDHWMWYDRKDV 972
G+YG P GK V+FVDD++MP KEE+GAQPPIE+LRQWLDH MWYDRK++
Sbjct: 1996 ---------AGLYGAPPGKHWVIFVDDLSMPQKEEYGAQPPIELLRQWLDHHMWYDRKEI 2046
Query: 973 VAVKLIEIQLMCAMGPPSTGNTVTPRFSRHFNQIVINKFDDDTMVTIFSKILLWHLDTR 1031
+ +KL+++QLMCAMGPP++G VTPRF RHF + I++F+DD ++TIF +I W+ TR
Sbjct: 2047 MPLKLVDMQLMCAMGPPASGLDVTPRFKRHFFTLGISEFEDDVLITIFGRIAAWYFVTR 2105
|
Source: Harpegnathos saltator Species: Harpegnathos saltator Genus: Harpegnathos Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242021167|ref|XP_002431017.1| ciliary dynein heavy chain, putative [Pediculus humanus corporis] gi|212516246|gb|EEB18279.1| ciliary dynein heavy chain, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|270007962|gb|EFA04410.1| hypothetical protein TcasGA2_TC014710 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|403267243|ref|XP_003925756.1| PREDICTED: dynein heavy chain 7, axonemal [Saimiri boliviensis boliviensis] | Back alignment and taxonomy information |
|---|
| >gi|334330021|ref|XP_001379252.2| PREDICTED: dynein heavy chain 7, axonemal [Monodelphis domestica] | Back alignment and taxonomy information |
|---|
| >gi|291391949|ref|XP_002712309.1| PREDICTED: dynein, axonemal, heavy chain 7-like [Oryctolagus cuniculus] | Back alignment and taxonomy information |
|---|
| >gi|348511659|ref|XP_003443361.1| PREDICTED: dynein heavy chain 7, axonemal [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
| >gi|443732906|gb|ELU17469.1| hypothetical protein CAPTEDRAFT_228350 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|405969117|gb|EKC34123.1| Dynein heavy chain 7, axonemal [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|395519974|ref|XP_003764114.1| PREDICTED: dynein heavy chain 7, axonemal [Sarcophilus harrisii] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 2567 | ||||||
| UNIPROTKB|F1PUS6 | 4026 | DNAH7 "Uncharacterized protein | 0.242 | 0.154 | 0.434 | 0.0 | |
| UNIPROTKB|J9P9Z9 | 4023 | DNAH7 "Uncharacterized protein | 0.242 | 0.154 | 0.434 | 0.0 | |
| UNIPROTKB|F1N5R7 | 4024 | DNAH7 "Uncharacterized protein | 0.242 | 0.154 | 0.429 | 0.0 | |
| UNIPROTKB|Q8WXX0 | 4024 | DNAH7 "Dynein heavy chain 7, a | 0.242 | 0.154 | 0.429 | 0.0 | |
| ZFIN|ZDB-GENE-070912-282 | 4001 | dnah7 "dynein, axonemal, heavy | 0.236 | 0.151 | 0.430 | 0.0 | |
| UNIPROTKB|F1NLA9 | 3256 | DNAH7 "Uncharacterized protein | 0.240 | 0.189 | 0.421 | 0.0 | |
| FB|FBgn0013810 | 4010 | Dhc36C "Dynein heavy chain at | 0.237 | 0.152 | 0.447 | 0.0 | |
| RGD|621798 | 4057 | Dnah7 "dynein, axonemal, heavy | 0.238 | 0.150 | 0.429 | 0.0 | |
| UNIPROTKB|Q63170 | 4057 | Dnah7 "Dynein heavy chain 7, a | 0.238 | 0.150 | 0.429 | 0.0 | |
| UNIPROTKB|F1LS28 | 4057 | Dnah7 "Dynein heavy chain 7, a | 0.238 | 0.150 | 0.429 | 0.0 |
| UNIPROTKB|F1PUS6 DNAH7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Score = 1253 (446.1 bits), Expect = 0., Sum P(5) = 0.
Identities = 281/647 (43%), Positives = 395/647 (61%)
Query: 1935 EPQDLEVASPATITDESMVEDLSNLLNSGEVPNIFASDEKAEICEKMGVIDRQKDKSMQT 1994
E Q + + + I ES +ED++NLLN+GEVPN+F DEK EIC+KM +DRQ+DK+ QT
Sbjct: 2393 EMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFPLDEKQEICDKMRQLDRQRDKTKQT 2452
Query: 1995 DGTMMALFKFFVDTPWPP-DALLAVAT-RFLNEVELSEAERQIS---IDMCQNF-HVSTQ 2048
DG+ +ALF F+D +LA++ V L + ++ ID Q++ + Q
Sbjct: 2453 DGSPIALFNMFIDRCRNHLHVVLAMSPIGDAFRVRLRKFPALVNCCTIDWFQSWPEDALQ 2512
Query: 2049 NLSDEFL--VKTSRHVYVT--------PTSYLELISTFKQLLKVKQEEVLNGKNRYTVGL 2098
++ FL ++ S + TS ++L ++F L+ + V +
Sbjct: 2513 AVASRFLEEIEMSEEIREDCISMCKSFHTSTIDLSTSFYVELQ-RYNYVTPTSYLELIST 2571
Query: 2099 EK--LDKAASQIAVMREEIEYLQPFLMVSAANIKELMVTVEKESAEAAIVAEGVKKDEEV 2156
K L+K S++ M++ E L +A+ + + +E + + ++ V DE +
Sbjct: 2572 FKILLEKKRSEVMKMKKRYEVGLDKLDSAASQVATMQAELEALHPQLKVASKEV--DEMM 2629
Query: 2157 ANEQALAAQAMKSVAEGVKKDEEVANEQALAAQAMKSECXXXXXXXXXXXXXXXXXXNTL 2216
A + + + K+ + VK DE +ANEQALAA+A+K EC +TL
Sbjct: 2630 AIIERESVEVAKT-EKVVKADETIANEQALAAKAIKDECDADLAEALPILESALSALDTL 2688
Query: 2217 TSNDITVVKTMKSPPDIVKLVMKAVCILKGVKSERVPD--AGGQLVEDYWGPSKKLLGDI 2274
T+ DITVVK+MKSPP VKLVM+A+CILKG+K++++PD G+ +ED+WGP+K+LLGDI
Sbjct: 2689 TAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDI 2748
Query: 2275 KFLEGLTNFNKDNVPAAVIKRLEDEFLSREDFDPEVVKKSSTAAEGLCKWVIAICKYDKV 2334
+FL+ L ++KDN+PAA + + ++ DF PE ++ +STAAEGLCKWVIA+ YDKV
Sbjct: 2749 RFLQSLHEYDKDNIPAAYMNIIRKNYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKV 2808
Query: 2335 AKIVGPKKEALRQAEEKLQLAMSALHEKQEQNRIVQEKLQKLQNTXXXXXXXXXXXXXXX 2394
AKIV PKK L AE +L++AM L +KQ R VQ+KL KLQ+T
Sbjct: 2809 AKIVAPKKIKLAAAEGELKIAMDGLRKKQGALREVQDKLAKLQDTLELNKQKKADLENQV 2868
Query: 2395 XXCVKKKQRAEDLIGKLGGEKERWSSTAKMLNEKYYQLTGDVLIAAGVVAYLGPFTVAFR 2454
C KK +RAE LIG LGGEK RWS TA L + Y LTGD+LI++G+VAYLG FT +R
Sbjct: 2869 DLCSKKLERAEQLIGGLGGEKTRWSLTALELGQLYINLTGDILISSGIVAYLGAFTSNYR 2928
Query: 2455 QQQVSTWVKEVAACNIVCTKDFQLGAVMGNPVEIRAWNIFGLPCDSFSIDNGIIIKNSRR 2514
Q Q+ W + +I C+ D+ L ++G V IRAWNI GLP DSFSIDNGIII N+RR
Sbjct: 2929 QNQIKEWTNLCKSKDIPCSDDYSLMGILGEAVTIRAWNIAGLPSDSFSIDNGIIIMNARR 2988
Query: 2515 WPLMIDPQEQANKWIKNMEKANGLNVIRLSNTDYMRILEGAIGFGFP 2561
WPLMIDPQ QANKW+KNMEKAN L V++L++ DY+R LE I FG P
Sbjct: 2989 WPLMIDPQGQANKWVKNMEKANSLQVVKLNDPDYVRTLENCIQFGTP 3035
|
|
| UNIPROTKB|J9P9Z9 DNAH7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N5R7 DNAH7 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8WXX0 DNAH7 "Dynein heavy chain 7, axonemal" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070912-282 dnah7 "dynein, axonemal, heavy chain 7" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NLA9 DNAH7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0013810 Dhc36C "Dynein heavy chain at 36C" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| RGD|621798 Dnah7 "dynein, axonemal, heavy chain 7" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q63170 Dnah7 "Dynein heavy chain 7, axonemal" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LS28 Dnah7 "Dynein heavy chain 7, axonemal" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 2567 | |||
| pfam12774 | 231 | pfam12774, AAA_6, Hydrolytic ATP binding site of d | 8e-56 | |
| pfam12775 | 272 | pfam12775, AAA_7, P-loop containing dynein motor r | 2e-51 | |
| pfam12777 | 344 | pfam12777, MT, Microtubule-binding stalk of dynein | 2e-42 | |
| pfam08393 | 408 | pfam08393, DHC_N2, Dynein heavy chain, N-terminal | 2e-21 | |
| COG5245 | 3164 | COG5245, DYN1, Dynein, heavy chain [Cytoskeleton] | 4e-21 | |
| pfam12775 | 272 | pfam12775, AAA_7, P-loop containing dynein motor r | 6e-20 | |
| pfam12781 | 228 | pfam12781, AAA_9, ATP-binding dynein motor region | 9e-14 | |
| pfam12780 | 268 | pfam12780, AAA_8, P-loop containing dynein motor r | 1e-13 | |
| pfam12774 | 231 | pfam12774, AAA_6, Hydrolytic ATP binding site of d | 3e-13 | |
| COG5245 | 3164 | COG5245, DYN1, Dynein, heavy chain [Cytoskeleton] | 9e-13 | |
| COG5245 | 3164 | COG5245, DYN1, Dynein, heavy chain [Cytoskeleton] | 7e-08 | |
| pfam12775 | 272 | pfam12775, AAA_7, P-loop containing dynein motor r | 5e-05 | |
| pfam07728 | 135 | pfam07728, AAA_5, AAA domain (dynein-related subfa | 7e-05 | |
| COG5245 | 3164 | COG5245, DYN1, Dynein, heavy chain [Cytoskeleton] | 1e-04 | |
| pfam12775 | 272 | pfam12775, AAA_7, P-loop containing dynein motor r | 2e-04 | |
| pfam08393 | 408 | pfam08393, DHC_N2, Dynein heavy chain, N-terminal | 2e-04 | |
| pfam07728 | 135 | pfam07728, AAA_5, AAA domain (dynein-related subfa | 2e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 8e-04 | |
| COG0714 | 329 | COG0714, COG0714, MoxR-like ATPases [General funct | 8e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 |
| >gnl|CDD|193250 pfam12774, AAA_6, Hydrolytic ATP binding site of dynein motor region D1 | Back alignment and domain information |
|---|
Score = 194 bits (494), Expect = 8e-56
Identities = 85/145 (58%), Positives = 105/145 (72%)
Query: 1 MGGAPEGPAGTGKTETTKDLAKAVAKLCIVFNCSDSMDYIGLGKFFKGLIATGAWACFDE 60
M GAP GPAGTGKTETTKDL +A+ + VFNCS+ MDY G +KGL TGAW CFDE
Sbjct: 33 MSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDE 92
Query: 61 FNRIDVEVLSVVAQQILTIQRGVTLGEEEILFEGTILKLDRTCSVFITMNPGYAGRSELP 120
FNRI VEVLSVVA Q+ +Q + ++ F G + L + +FITMNPGYAGR+ELP
Sbjct: 93 FNRISVEVLSVVAVQVKCVQDAIRDKKQWFNFLGEEISLIPSVGIFITMNPGYAGRTELP 152
Query: 121 DNLKSLFRTVAMMVPDYALISEIIV 145
+NLK+LFR AM+VPD+ LI EI++
Sbjct: 153 ENLKALFRPCAMVVPDFELICEIML 177
|
the 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases. The core of the 380 kDa motor unit contains a concatenated chain of six AAA modules, of which four correspond to the ATP binding sites with P-loop signatures described previously, and two are modules in which the P loop has been lost in evolution. This particular family is the D1 unit of the motor and contains the hydrolytic ATP binding site. Length = 231 |
| >gnl|CDD|193251 pfam12775, AAA_7, P-loop containing dynein motor region D3 | Back alignment and domain information |
|---|
| >gnl|CDD|193253 pfam12777, MT, Microtubule-binding stalk of dynein motor | Back alignment and domain information |
|---|
| >gnl|CDD|219818 pfam08393, DHC_N2, Dynein heavy chain, N-terminal region 2 | Back alignment and domain information |
|---|
| >gnl|CDD|227570 COG5245, DYN1, Dynein, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|193251 pfam12775, AAA_7, P-loop containing dynein motor region D3 | Back alignment and domain information |
|---|
| >gnl|CDD|193257 pfam12781, AAA_9, ATP-binding dynein motor region D5 | Back alignment and domain information |
|---|
| >gnl|CDD|193256 pfam12780, AAA_8, P-loop containing dynein motor region D4 | Back alignment and domain information |
|---|
| >gnl|CDD|193250 pfam12774, AAA_6, Hydrolytic ATP binding site of dynein motor region D1 | Back alignment and domain information |
|---|
| >gnl|CDD|227570 COG5245, DYN1, Dynein, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|227570 COG5245, DYN1, Dynein, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|193251 pfam12775, AAA_7, P-loop containing dynein motor region D3 | Back alignment and domain information |
|---|
| >gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) | Back alignment and domain information |
|---|
| >gnl|CDD|227570 COG5245, DYN1, Dynein, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|193251 pfam12775, AAA_7, P-loop containing dynein motor region D3 | Back alignment and domain information |
|---|
| >gnl|CDD|219818 pfam08393, DHC_N2, Dynein heavy chain, N-terminal region 2 | Back alignment and domain information |
|---|
| >gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 2567 | |||
| KOG3595|consensus | 1395 | 100.0 | ||
| COG5245 | 3164 | DYN1 Dynein, heavy chain [Cytoskeleton] | 100.0 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 100.0 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 100.0 | |
| PF12774 | 231 | AAA_6: Hydrolytic ATP binding site of dynein motor | 100.0 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 100.0 | |
| KOG3595|consensus | 1395 | 100.0 | ||
| PF12780 | 268 | AAA_8: P-loop containing dynein motor region D4; I | 100.0 | |
| COG5271 | 4600 | MDN1 AAA ATPase containing von Willebrand factor t | 100.0 | |
| COG5245 | 3164 | DYN1 Dynein, heavy chain [Cytoskeleton] | 99.93 | |
| COG5271 | 4600 | MDN1 AAA ATPase containing von Willebrand factor t | 99.88 | |
| PF12781 | 228 | AAA_9: ATP-binding dynein motor region D5; PDB: 3V | 99.8 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 99.41 | |
| PF12774 | 231 | AAA_6: Hydrolytic ATP binding site of dynein motor | 99.33 | |
| KOG1808|consensus | 1856 | 99.11 | ||
| KOG1808|consensus | 1856 | 99.1 | ||
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 99.1 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 99.06 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 99.04 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 99.01 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 99.0 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 99.0 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 98.98 | |
| KOG0733|consensus | 802 | 98.88 | ||
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 98.86 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 98.81 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 98.8 | |
| PHA02244 | 383 | ATPase-like protein | 98.76 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 98.56 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 98.53 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 98.48 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 98.45 | |
| KOG0996|consensus | 1293 | 98.44 | ||
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.39 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 98.34 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 98.34 | |
| PHA02244 | 383 | ATPase-like protein | 98.31 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 98.23 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 98.2 | |
| KOG0733|consensus | 802 | 98.11 | ||
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 98.06 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 98.01 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.95 | |
| KOG0994|consensus | 1758 | 97.94 | ||
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 97.89 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 97.89 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 97.87 | |
| KOG1051|consensus | 898 | 97.84 | ||
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 97.84 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 97.82 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 97.77 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 97.67 | |
| KOG0735|consensus | 952 | 97.65 | ||
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 97.62 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 97.59 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 97.55 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 97.53 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.5 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.48 | |
| KOG0979|consensus | 1072 | 97.43 | ||
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 97.42 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 97.4 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.4 | |
| KOG0994|consensus | 1758 | 97.38 | ||
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 97.36 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 97.36 | |
| KOG0736|consensus | 953 | 97.35 | ||
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 97.33 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 97.29 | |
| KOG0730|consensus | 693 | 97.25 | ||
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.23 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 97.21 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 97.18 | |
| KOG0736|consensus | 953 | 97.17 | ||
| PRK04195 | 482 | replication factor C large subunit; Provisional | 97.17 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 97.13 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 97.08 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 97.07 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 97.06 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 97.06 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.05 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 97.04 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 97.02 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 97.01 | |
| KOG0735|consensus | 952 | 97.01 | ||
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 97.0 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 97.0 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 96.98 | |
| smart00350 | 509 | MCM minichromosome maintenance proteins. | 96.96 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 96.88 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 96.86 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 96.82 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 96.81 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 96.79 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 96.79 | |
| KOG0727|consensus | 408 | 96.74 | ||
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 96.72 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 96.7 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 96.69 | |
| KOG0652|consensus | 424 | 96.69 | ||
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 96.68 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 96.64 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 96.64 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 96.63 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 96.6 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 96.6 | |
| TIGR02031 | 589 | BchD-ChlD magnesium chelatase ATPase subunit D. Th | 96.58 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 96.58 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 96.57 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 96.56 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 96.53 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 96.51 | |
| KOG0161|consensus | 1930 | 96.51 | ||
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 96.48 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 96.47 | |
| KOG0734|consensus | 752 | 96.47 | ||
| KOG0976|consensus | 1265 | 96.47 | ||
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 96.45 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 96.45 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 96.45 | |
| KOG0730|consensus | 693 | 96.43 | ||
| TIGR02442 | 633 | Cob-chelat-sub cobaltochelatase subunit. A number | 96.43 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 96.41 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 96.4 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 96.39 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 96.38 | |
| KOG2028|consensus | 554 | 96.36 | ||
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 96.36 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 96.36 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 96.35 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 96.34 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 96.34 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 96.34 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 96.31 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 96.31 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 96.31 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 96.28 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 96.27 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 96.26 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 96.25 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 96.23 | |
| PRK15424 | 538 | propionate catabolism operon regulatory protein Pr | 96.22 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.21 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 96.19 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 96.18 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 96.15 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 96.13 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 96.13 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 96.13 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 96.13 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 96.12 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 96.1 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 96.1 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 96.08 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 96.08 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 96.06 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 96.05 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 96.05 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 96.04 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 96.04 | |
| TIGR02329 | 526 | propionate_PrpR propionate catabolism operon regul | 96.04 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 96.0 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 96.0 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 96.0 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 95.98 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 95.98 | |
| KOG0726|consensus | 440 | 95.98 | ||
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 95.97 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 95.94 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 95.93 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 95.86 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 95.86 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 95.83 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 95.83 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 95.82 | |
| KOG0731|consensus | 774 | 95.82 | ||
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 95.79 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 95.78 | |
| KOG1029|consensus | 1118 | 95.78 | ||
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 95.78 | |
| KOG0161|consensus | 1930 | 95.78 | ||
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 95.77 | |
| PRK13808 | 333 | adenylate kinase; Provisional | 95.75 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 95.74 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 95.74 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 95.71 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 95.7 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 95.7 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 95.69 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 95.68 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 95.67 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 95.64 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 95.63 | |
| PTZ00111 | 915 | DNA replication licensing factor MCM4; Provisional | 95.58 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 95.58 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 95.57 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 95.56 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 95.55 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 95.51 | |
| PF05729 | 166 | NACHT: NACHT domain | 95.5 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 95.47 | |
| smart00350 | 509 | MCM minichromosome maintenance proteins. | 95.47 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 95.46 | |
| PRK06620 | 214 | hypothetical protein; Validated | 95.44 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 95.42 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 95.42 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 95.41 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 95.41 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 95.39 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 95.37 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 95.36 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 95.35 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 95.32 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 95.3 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 95.26 | |
| PRK08727 | 233 | hypothetical protein; Validated | 95.2 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 95.18 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 95.16 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 95.12 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 95.1 | |
| PRK11637 | 428 | AmiB activator; Provisional | 95.08 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 95.07 | |
| KOG0250|consensus | 1074 | 95.05 | ||
| PF13173 | 128 | AAA_14: AAA domain | 95.04 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 95.04 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 94.98 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 94.97 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 94.94 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 94.91 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 94.91 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 94.91 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 94.91 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 94.87 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 94.86 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 94.84 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 94.84 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 94.83 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 94.83 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 94.78 | |
| KOG0250|consensus | 1074 | 94.73 | ||
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 94.71 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 94.71 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 94.66 | |
| COG1239 | 423 | ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis | 94.65 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 94.62 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 94.59 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 94.58 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 94.57 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 94.53 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 94.52 | |
| PRK09087 | 226 | hypothetical protein; Validated | 94.46 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 94.43 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 94.42 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 94.41 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 94.4 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 94.4 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 94.4 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 94.37 | |
| COG3829 | 560 | RocR Transcriptional regulator containing PAS, AAA | 94.37 | |
| PRK06620 | 214 | hypothetical protein; Validated | 94.34 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 94.3 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 94.3 | |
| KOG0737|consensus | 386 | 94.29 | ||
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 94.28 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 94.27 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 94.25 | |
| KOG0933|consensus | 1174 | 94.25 | ||
| PTZ00111 | 915 | DNA replication licensing factor MCM4; Provisional | 94.23 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 94.22 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 94.2 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 94.19 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 94.18 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 94.14 | |
| COG1221 | 403 | PspF Transcriptional regulators containing an AAA- | 94.13 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 94.12 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 94.06 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 94.05 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 94.04 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 94.01 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 93.99 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 93.98 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 93.97 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 93.95 | |
| PRK06217 | 183 | hypothetical protein; Validated | 93.94 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 93.94 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 93.94 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 93.85 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 93.85 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 93.85 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 93.82 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 93.79 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 93.78 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 93.78 | |
| KOG4360|consensus | 596 | 93.76 | ||
| PF12780 | 268 | AAA_8: P-loop containing dynein motor region D4; I | 93.74 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 93.73 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 93.72 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 93.69 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 93.67 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 93.64 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 93.64 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 93.61 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 93.61 | |
| PLN02842 | 505 | nucleotide kinase | 93.59 | |
| PF13173 | 128 | AAA_14: AAA domain | 93.59 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 93.59 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 93.58 | |
| PRK08116 | 268 | hypothetical protein; Validated | 93.48 | |
| KOG0976|consensus | 1265 | 93.47 | ||
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 93.47 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 93.44 | |
| KOG0740|consensus | 428 | 93.42 | ||
| KOG0980|consensus | 980 | 93.42 | ||
| KOG4809|consensus | 654 | 93.41 | ||
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 93.4 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 93.39 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 93.36 | |
| PRK08181 | 269 | transposase; Validated | 93.35 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 93.3 | |
| KOG0964|consensus | 1200 | 93.27 | ||
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 93.17 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 93.17 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 93.13 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 93.11 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 93.1 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 93.06 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 93.05 | |
| PRK06526 | 254 | transposase; Provisional | 93.05 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 92.98 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 92.96 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 92.94 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 92.94 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 92.92 | |
| TIGR02031 | 589 | BchD-ChlD magnesium chelatase ATPase subunit D. Th | 92.92 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 92.91 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 92.9 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 92.8 | |
| KOG0933|consensus | 1174 | 92.78 | ||
| KOG4674|consensus | 1822 | 92.78 | ||
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 92.74 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 92.73 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 92.73 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 92.69 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 92.65 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 92.64 | |
| KOG0995|consensus | 581 | 92.62 | ||
| PRK05642 | 234 | DNA replication initiation factor; Validated | 92.59 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 92.59 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 92.56 | |
| PRK08727 | 233 | hypothetical protein; Validated | 92.56 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 92.53 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 92.52 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 92.43 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 92.4 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 92.39 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 92.38 | |
| PF05729 | 166 | NACHT: NACHT domain | 92.33 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 92.31 | |
| KOG0977|consensus | 546 | 92.3 | ||
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 92.29 | |
| KOG0612|consensus | 1317 | 92.29 | ||
| PRK12377 | 248 | putative replication protein; Provisional | 92.27 | |
| PLN02459 | 261 | probable adenylate kinase | 92.25 | |
| PRK09087 | 226 | hypothetical protein; Validated | 92.25 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 92.2 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 92.19 | |
| KOG0996|consensus | 1293 | 92.19 | ||
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 92.18 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 92.17 | |
| PRK11637 | 428 | AmiB activator; Provisional | 92.15 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 92.14 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 92.09 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 92.0 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 91.99 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 91.98 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 91.94 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 91.91 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 91.89 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 91.83 | |
| KOG2028|consensus | 554 | 91.83 | ||
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 91.79 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 91.75 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 91.71 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 91.69 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 91.64 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 91.64 | |
| KOG0995|consensus | 581 | 91.62 | ||
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 91.6 | |
| PF00493 | 331 | MCM: MCM2/3/5 family This family extends the MCM d | 91.6 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 91.55 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 91.54 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 91.53 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 91.48 | |
| KOG0018|consensus | 1141 | 91.45 | ||
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 91.36 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 91.3 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 91.3 | |
| KOG0738|consensus | 491 | 91.26 | ||
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 91.25 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 91.24 | |
| KOG0652|consensus | 424 | 91.24 | ||
| KOG0729|consensus | 435 | 91.23 | ||
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 91.23 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 91.1 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 91.06 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 91.05 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 91.03 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 91.01 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 90.97 | |
| KOG1051|consensus | 898 | 90.95 | ||
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 90.94 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 90.93 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 90.93 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 90.92 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 90.91 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 90.88 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 90.87 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 90.86 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 90.83 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 90.78 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 90.77 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 90.71 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 90.71 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 90.64 | |
| COG0283 | 222 | Cmk Cytidylate kinase [Nucleotide transport and me | 90.61 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 90.61 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 90.48 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 90.47 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 90.46 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 90.43 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 90.4 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 90.37 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 90.36 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 90.34 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 90.14 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 90.14 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 90.13 | |
| PRK13695 | 174 | putative NTPase; Provisional | 90.12 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 90.1 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 90.02 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 89.89 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 89.82 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 89.82 | |
| KOG1533|consensus | 290 | 89.82 | ||
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 89.75 | |
| KOG0971|consensus | 1243 | 89.73 | ||
| KOG0989|consensus | 346 | 89.72 | ||
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 89.68 | |
| KOG0991|consensus | 333 | 89.67 | ||
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 89.59 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 89.51 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 89.49 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 89.47 | |
| KOG2004|consensus | 906 | 89.46 | ||
| KOG0962|consensus | 1294 | 89.45 | ||
| PRK03839 | 180 | putative kinase; Provisional | 89.44 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 89.34 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 89.33 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 89.33 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 89.32 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 89.31 | |
| KOG1534|consensus | 273 | 89.24 | ||
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 89.22 | |
| KOG1547|consensus | 336 | 89.18 | ||
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 89.04 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 89.04 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 89.01 | |
| KOG2227|consensus | 529 | 88.94 | ||
| PRK14528 | 186 | adenylate kinase; Provisional | 88.91 | |
| PRK12377 | 248 | putative replication protein; Provisional | 88.87 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 88.85 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 88.85 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 88.82 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 88.8 | |
| PRK05917 | 290 | DNA polymerase III subunit delta'; Validated | 88.77 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 88.73 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 88.67 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 88.65 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 88.65 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 88.6 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 88.54 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 88.52 | |
| PHA02774 | 613 | E1; Provisional | 88.42 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 88.32 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 88.31 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 88.29 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 88.27 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 88.22 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 88.19 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 88.19 | |
| PRK00091 | 307 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 88.18 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 88.15 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 88.15 | |
| PRK13973 | 213 | thymidylate kinase; Provisional | 88.08 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 88.03 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 87.96 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 87.95 | |
| PLN02674 | 244 | adenylate kinase | 87.9 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 87.88 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 87.85 |
| >KOG3595|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.3e-138 Score=1474.19 Aligned_cols=1069 Identities=41% Similarity=0.653 Sum_probs=947.1
Q ss_pred HHHHHHHHHhcCCCccccccccceEEEEecchhhhhhhccCCCCCCchhhhhhhhceeecCCCccccccccCCCCCCCCC
Q psy12680 1227 QINKIVEIVRGKLPPQTRITLGALVVIDVHARDVVVHLVSVPVSDENDFQWLCQLRYYAEGKGRWKPWSDDLASAPAIPR 1306 (2567)
Q Consensus 1227 ~l~~l~~~~~~~l~~~~r~~~~~li~~~vh~rdi~~~l~~~~~~~~~~f~w~~qlryy~~~~~~w~~w~~~~~~~~~~~~ 1306 (2567)
.+..++|.+.+.+....|.++..++... .. .....|.....++|.+|.+.++ .. ..+
T Consensus 45 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~----------~~-----------~~~~~~~~~~~~~~~~~~~~~~-~~-~~~ 101 (1395)
T KOG3595|consen 45 FLFALIWALGGDLDADSREKFREFLRRL----------IN-----------IIDLYYIDEEIGDWEPWIDKVP-FE-LLE 101 (1395)
T ss_pred HHHHHHHHhhcccchhHHHHHHHHHHHH----------Hh-----------hhhheeeeeccccccchhhhCc-cc-ccc
Confidence 4456778888888888888776432110 00 1112344456679999999998 43 233
Q ss_pred CCCCcceeeeCchhhHHHHHHHHHHhcCCCcccccCCCCcccceeehhhhhhccccccccchhhhhhhhhccccccceee
Q psy12680 1307 DMPVNQIIVTTEETLRNIALMKLLVTHQKPVMFIGPTGTGKSCYITVSILFIKNNSRLRSGFQHFLLKELSIEQWQPLIM 1386 (2567)
Q Consensus 1307 ~~~~~~ilVpT~dT~R~~~ll~~ll~~~~pvll~GptGTGKT~~i~~~~~~~~~~~~l~~~~~~~ll~~l~~~~~~~~~l 1386 (2567)
+.. +++|||.||+|+.+++..++..++|+++|||+|||||+++... +.+..+.+.+. +
T Consensus 102 ~~~--~~~v~t~dt~r~~~~~~~~~~~~k~~~~~g~~g~gk~~~~~~~-----------------~~~~~~~~~~~---~ 159 (1395)
T KOG3595|consen 102 DHE--DILVPTIDTVRYDRLLKLLLAHGKPVLLVGPTGTGKTVLVLSE-----------------LRSLQDREVYL---L 159 (1395)
T ss_pred ccc--ceecCccceeeHHHHHHHHHHhCCeEEEEcCCCCCeeeehHHH-----------------HHhcccchheE---E
Confidence 333 9999999999999999999999999999999999999988532 22222222233 9
Q ss_pred ccccccCHHHHHHHHHhhhhcccCCccCCCCCcEEEEEEcCCCCccccccCCCChHHHHHHHhhcccccccCcceeeeee
Q psy12680 1387 NFSAQTSANQTQDIIMSKLDKRRKGVYGPPLGKRCVVFVDDVNMPLKEEFGAQPPIEILRQWLDHWMWYDRKDVVAVKLI 1466 (2567)
Q Consensus 1387 nfSa~Tts~~~q~~ies~lekr~~~~~gp~~gK~~vvFiDDiNmP~~d~yGtQ~~ielLRQlid~~g~ydr~~~~~~~i~ 1466 (2567)
|||++|+++.+|.+++++++|++++.||||.+|++++||||+|||..|.||+|+|+++|||++|++||||+.+..|+.|.
T Consensus 160 ~fs~~ts~~~~q~~~~~~~~k~~~~~~~~~~~~~~~~f~ddinmp~~~~yg~q~~~~~lrq~~e~~g~~~~~~~~~~~i~ 239 (1395)
T KOG3595|consen 160 NFSSVTSSELLQEIIESKLDKRRSGNYGPPLGKKLVLFVDDINMPALDKYGDQPPIELLRQMLEHGGFYDRKKSEWVEIE 239 (1395)
T ss_pred eeeeeccHHHHHHHHHHHHHHhcccCCCCCCCceeEEEEeccCCchhhhcCCccHHHHHHHHHHhceeecccccceeEEe
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999889999999
Q ss_pred eeeeeeecCCCCCC-CCCCcchhccccceeccCCCHHHHHHHHHHHHHhhhcccCCcccchhHHHHHHHHHHHHHHHHHh
Q psy12680 1467 EIQLMCAMGPPSTG-NTVTPRFSRHFNQIVINKFDDDTMVTIFSKILLWHLDTRGFSKEFDPCIEQLVQATLHIFKESLL 1545 (2567)
Q Consensus 1467 diq~v~am~Ppggg-~~is~Rf~r~f~vi~i~~p~~~sL~~If~~il~~~l~~~gf~~~v~~~~~~lv~ati~ly~~v~~ 1545 (2567)
|+++++||+||+|| +++++||+|||.++++++|+.+++.+||+.|+.+|+. |...+...+..++++++.+|..+..
T Consensus 240 ~i~~~~a~~~~~~gr~~i~~r~~r~f~~~~~~~~~~~sl~~if~~~~~~~~~---~~~~~~~~~~~i~~~~~~~~~~~~~ 316 (1395)
T KOG3595|consen 240 NVQLVGAMNPPGGGRNDITERFLRHFLIVSLNYPSQESLTQIFNTILTGHLR---FAPAFRTSIEPIVNASVDFYPKVQE 316 (1395)
T ss_pred eeEEEeecCCCCCccCcccHHHHHHeeeEeeCCCChhhHHHHHHHHHhcccC---ccHHHHHhHHHHHHHHHHHHHHHHH
Confidence 99999999998888 8999999999999999999999999999999999986 7777777799999999999999999
Q ss_pred hcCCCCCCcccccCchhHHHHHHHHhccchHHHhcHHHHHHHhhhhhhhhhcccccCchhHHHHHHHHHHHHHHHHHHHH
Q psy12680 1546 NLLPTPTKSHYLFNLRDFARVIQGVLLSVPEAIESLLSMKRLWVHEVLRVYYDRLVDSDDRLWLFNTLKYTVEKFLQEDM 1625 (2567)
Q Consensus 1546 ~~lPTp~k~HY~FnlRDlsrv~qGll~~~~~~i~~~~~l~rLw~HE~~RVF~DRLv~~~D~~~f~~~L~~~~~~~~~~~~ 1625 (2567)
+++|||.++||+|||||++||++|++.+.+....+...++|+|+||+.|||.|||++.+|+.|+.+.+...+.+.|...-
T Consensus 317 ~~~~t~~~~hyv~~lrd~~r~~~~i~~~~~~~~~~~~~l~~~~~~e~~rv~~drlv~~~~~~~~~~~~~~~~~~~~~~~~ 396 (1395)
T KOG3595|consen 317 NFLPTPSKSHYVFNLRDLSRVVQGILLAVSEALLTLEDLIRLWVHEAIRVFADRLVDDEDRQWFDKKLQEVLLKLFEADS 396 (1395)
T ss_pred hcCCCCCcceeeechhhhhhheeehcccCcHhhccHHHHHHHHHHHHHHhhhhhcccHHHHHHHHHHHHHHHHHHhhhhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999988887775432
Q ss_pred HHHHHhhhhcCCCCCcccccccccccccCCCCCcCccCccccCCHHHHHHHHHHHHHHHhccCCCCcccccccccccCCc
Q psy12680 1626 NQLFANLKEANSTEPVGEYELRNLIYCDFANPKADQRNYMEVTNLEDLRTIVERYLTEFNNMSKKPMNLVLFRGFSKEFD 1705 (2567)
Q Consensus 1626 ~~~~~~~~~~~~~~~~~~~~~~~llf~~f~~~~~~~~~Y~~v~d~~~l~~~l~~~l~~yN~~~~~~m~LVlF~~~~~~~~ 1705 (2567)
...+++|+++..... +.|+++.+++.+...+..++..||......|++|+|.
T Consensus 397 -------------------~~~~~~~~~~~~~~~--~~y~~~~~~~~l~~~~~~~l~~~~~~~~~~~~lvlf~------- 448 (1395)
T KOG3595|consen 397 -------------------LQMPLLYGDFRSESH--KIYEEVLSVELLRGVLEAYLKQFNIEEIRPMHLVLFR------- 448 (1395)
T ss_pred -------------------hcCCceeeecccccc--cccCchHhHHHHHHHHHHHHHHHhhhccCCCceeeeH-------
Confidence 235789999988766 8999999999999999999999995566789999996
Q ss_pred hhHHHHHHhHhHHHHhhhhccCCCCCcccccccchhhHHHHhhhhccccCCCCCCCCCCCccchHHHHHHHHHHHHHhCC
Q psy12680 1706 PCIEQLVQATLHIFKESLLNLLPTPTKSHYLFNLRDFARVIQYLTVTGRVGPGPPENSFSKTDYTILNKAVREVCEKANL 1785 (2567)
Q Consensus 1706 ~~~~~l~~~~~~i~~~~~~~~~~~~~~~h~~f~lr~~~~vl~~~~~~~rv~~~~~~~~~~~~d~~~l~~al~~~~~~~~l 1785 (2567)
.+..|+.++.|+..+|
T Consensus 449 --------------------------------------~~~~h~~ri~ril~~~-------------------------- 464 (1395)
T KOG3595|consen 449 --------------------------------------DAIEHVLRIDRILRQP-------------------------- 464 (1395)
T ss_pred --------------------------------------HHhhhhhhhHHHhcCC--------------------------
Confidence 2234444555555555
Q ss_pred ccchHHHHHHHHHHHhhhccccEEEEcCCCCChHHHHHHHHHHHHHHHhhhccCCceEEEEEeccccccccccccccccc
Q psy12680 1786 QVTPFFLEKIQQIYEMMIVRWGFMIVGLSFAGKTCAYRMLSEALQLIEEWGELGEHKVEIIVINPKSITMGQLYGQFDAV 1865 (2567)
Q Consensus 1786 ~~~p~~~~ki~ql~~~~~~r~~~lLVG~~GSGK~sl~rlla~~l~~~~~~~~~~~~~v~~~~inpk~is~~~~Yg~~~~~ 1865 (2567)
+||++|||++||||+|++|+++++.++ ..+++...+.|+
T Consensus 465 -------------------~g~~llvgv~g~gkqsl~r~~~~~~~~-----------------~~fq~~~~~~y~----- 503 (1395)
T KOG3595|consen 465 -------------------RGHALLVGVGGSGKQSLTRLAAFINGL-----------------SVFQIEITRSYN----- 503 (1395)
T ss_pred -------------------CccEEEeecCCCCcccHHHHHHhhccc-----------------cceeeeccccCc-----
Confidence 667899999999999999999976542 445666666663
Q ss_pred ccccccchhHHHHHHHhhhcccCCeEEeecCCcchHHHhhhhhhHHHHHHHHhhhccccccCCceEEEeccccccccCCc
Q psy12680 1866 SHEWSDGILAVSYRQFAMSQNENRKWLIFDGPVDAIWIENMNSVLDDNKKLCLMSGEIIALAPTTSLIFEPQDLEVASPA 1945 (2567)
Q Consensus 1866 ~~eW~dGil~~~~r~~~~~~~~~~~~iv~Dg~~d~~wie~ln~~ldD~k~l~l~~Ge~i~~~~~~~life~q~L~~aS~a 1945 (2567)
.+.+.+|++.++...| ......+|++-+ +
T Consensus 504 ----------------------------------------~~~~~~dl~~~~r~~g--~~~~~~~f~~~~---------~ 532 (1395)
T KOG3595|consen 504 ----------------------------------------IEDFREDLKAILRKAG--LKNKETVFILTD---------S 532 (1395)
T ss_pred ----------------------------------------HHHHHHHHHHHHHHhc--cCCCceEEeech---------H
Confidence 5667788889999888 566777776644 5
Q ss_pred cccchhhHhhhhhccCCCccCCCCChhHHHHHHHhhchhhhhhhccCCCcccHHHHhHhhhC------------------
Q psy12680 1946 TITDESMVEDLSNLLNSGEVPNIFASDEKAEICEKMGVIDRQKDKSMQTDGTMMALFKFFVD------------------ 2007 (2567)
Q Consensus 1946 ~I~~e~fLE~iN~lL~sGevP~Lf~~dE~~~i~~~~~~~~~~~~~~~~~~~~~~~l~~~fv~------------------ 2007 (2567)
+|.+|+|||+||+||++|||||||++||++.+...+....+.. ......+.+++|.||+.
T Consensus 533 ~i~~e~fle~ln~ll~~gevp~lf~~de~~~~~~~~~~~~~~~--~~~~~~s~e~~~~~f~~~~~~~l~~vl~~~~~g~~ 610 (1395)
T KOG3595|consen 533 QIKDESFLEDLNNLLASGEVPNLFTGDELDEIKMELAGEMGEE--AKLILDSRENLYLFFIFRVRRNLHVVLSVSPVGDA 610 (1395)
T ss_pred HHHHHHHHHHHHHHHhCCCCCCccchHHHHHHHHHHHHHhhhh--ccccCccHHHHHHHHHHHHHHhcceeEEeCchhhH
Confidence 6999999999999999999999999999999665554332222 23355677888888873
Q ss_pred --------------------CCCcHHHHHHHHHHhcccCCCC--HHHHHHHHhhhhhhhhhhhhhhHHHHHHcCCccccC
Q psy12680 2008 --------------------TPWPPDALLAVATRFLNEVELS--EAERQISIDMCQNFHVSTQNLSDEFLVKTSRHVYVT 2065 (2567)
Q Consensus 2008 --------------------~~Wp~eAL~~VA~~~L~~~~~~--~~~~~~~~~~~~~~H~sv~~~s~~~~~~~~r~~yvT 2065 (2567)
++||.+||.+|+++|+.+..+. ...+..+...+..+|.++.+.+..|+...+|++|+|
T Consensus 611 ~~~r~~~~pal~~~~~i~w~~~w~~~al~~v~~~~l~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~r~~~~t 690 (1395)
T KOG3595|consen 611 FRLRARKFPALVNRCTIDWFDSWPTEALLSVAEEFLASQDILSPSEKRGAISLTMILFHETVLESFASYFDRLSRHNYVT 690 (1395)
T ss_pred HHHHHHhChhhhccchhhhcccCCHHHHHHHHHHHHhhhcCCCcccccchhhhhhhhhhhhHHHHhHHHHHhcCceeecC
Confidence 4899999999999999977654 334566677888899999999999999999999999
Q ss_pred chhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHhhchHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12680 2066 PTSYLELISTFKQLLKVKQEEVLNGKNRYTVGLEKLDKAASQIAVMREEIEYLQPFLMVSAANIKELMVTVEKESAEAAI 2145 (2567)
Q Consensus 2066 P~syL~~l~~f~~ll~~k~~el~~~~~rl~~GL~KL~ea~~~V~~l~~~L~~~qp~L~~~~~~~~~~~~~le~~~~~a~~ 2145 (2567)
|++|++|+.+|..|+++|+.++.....|+.+||+||.+|.++|+.|+.+|..++|+|..+.+++...+.++..++.+++.
T Consensus 691 p~~~l~~i~~f~~ll~~k~~~~~~~~~r~~~gl~kl~~a~~~v~~l~~~l~~~~~el~~~~~~a~~~l~~i~~~~~~~e~ 770 (1395)
T KOG3595|consen 691 PTSYLEFIGTFKKLLKEKRSEVRLRKLRLELGLDKLKEAGEQVAGLQKELAALQPELQVKSKEANDVLAKILKETQAAEA 770 (1395)
T ss_pred chhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHhhHHHHHHHHHHHHHHHhhHHHHHHhHHHHHHHHHHHhhHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999988876642
Q ss_pred HHhhhhhHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHhhccCCCchHHHh
Q psy12680 2146 VAEGVKKDEEVANEQALAAQAMKSVAEGVKKDEEVANEQALAAQAMKSECEEILSEAIPILEAAEAALNTLTSNDITVVK 2225 (2567)
Q Consensus 2146 ~~~~v~~~~~~~~e~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~k~e~e~~L~~a~P~L~~A~~Al~~L~k~dl~Eir 2225 (2567)
.. +.+.+.+..+++++..++++|++|+++|++|+|+|++|.+|+++|+|.|++|+|
T Consensus 771 ~k------------------------~~v~~~e~~~~~~~~~~~~~k~~v~~~l~~a~P~leeA~aal~ti~k~~l~~lk 826 (1395)
T KOG3595|consen 771 QK------------------------EAVLEDEKKAQEKAGLIQAQKAEVEEDLEEAEPALEEASAALSTIKKADLSELK 826 (1395)
T ss_pred HH------------------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHhcCChhhHHHHH
Confidence 22 223344555566667778889999999999999999999999999999999999
Q ss_pred hcCCChHHHHHHHHHHHHHhcCCCCCcCCCCCCcccCCcHHHHhhhcch-hhHhhhhccCCCCCCHHHHHHHHhhhcCCC
Q psy12680 2226 TMKSPPDIVKLVMKAVCILKGVKSERVPDAGGQLVEDYWGPSKKLLGDI-KFLEGLTNFNKDNVPAAVIKRLEDEFLSRE 2304 (2567)
Q Consensus 2226 s~~~PP~~V~~VmeaVciLlg~~~~~~~~~~~~~~~~~W~~ak~~L~~~-~Fl~~L~~fDkd~I~~~~~~~l~~~~~~~~ 2304 (2567)
||.+||.+|+.+|||||+|+|.+ ...+|..+.++|.+. .|+..+.+||+++|++.+.+++.+.|+++|
T Consensus 827 s~~~PP~~Vk~~meavciLlg~~-----------~~~~w~~~~~~~~~~~~fl~~l~~~~~~~i~~~~~k~i~~~~~~~p 895 (1395)
T KOG3595|consen 827 SMKNPPHAVKLVMEAVCILLGRL-----------SSTDWKNISKLLLSDDFFLIILREFDKDEIPEEIMKLIKKFYFQNP 895 (1395)
T ss_pred hcCCCcHHHHHHHHHHHHHhccc-----------cCCChHHHHHHhhcccHHHHHhhcCccccChHHHHHHHHHhhcCCc
Confidence 99999999999999999999951 123476666665555 599999999999999999999988899999
Q ss_pred CCCHHHHHHHhHhhhHHHHHHHHHHHHHHHHHHhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy12680 2305 DFDPEVVKKSSTAAEGLCKWVIAICKYDKVAKIVGPKKEALRQAEEKLQLAMSALHEKQEQNRIVQEKLQKLQNTLDAKK 2384 (2567)
Q Consensus 2305 ~F~~e~v~~aS~Aa~~Lc~WV~A~~~Y~~V~~~V~Pk~~~l~~ae~~l~~a~~~L~~~~~~l~~l~~~l~~L~~~~~~~~ 2384 (2567)
+|+|+.++++|.||++||.||.|+..|++|++.|+|++++++.++.++.++++.++++++++++++++++.++++|++..
T Consensus 896 ~f~~~~v~~~s~a~~~l~~wv~a~~~~~kv~~~v~p~~~~~~~~e~~~~~~~~~l~~~~~~l~~~e~~~~~~~~~~~~~~ 975 (1395)
T KOG3595|consen 896 DFVPEKVNRASLACEGLCLWVIAIDKYSKVLKVVEPKRQELARLEAELKAAMKELEEKSAELQDLEEKLQRLKDEYEQLI 975 (1395)
T ss_pred cCCHHHHHhhhhhhhhHHHHHHHHHHHHHHHHhcCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhccHHHHHHHHHHHhhcchhHHHHHHHHHHhhCCCCHHHHHHHHHHHHHH
Q psy12680 2385 KELKDLQDELDLCVKKKQRAEDLIGKLGGEKERWSSTAKMLNEKYYQLTGDVLIAAGVVAYLGPFTVAFRQQQVSTWVKE 2464 (2567)
Q Consensus 2385 ~ek~~L~~~~~~~~~rl~rA~~Li~~L~~Ek~RW~~~~~~l~~~~~~l~GD~llaaa~isY~G~f~~~~R~~ll~~W~~~ 2464 (2567)
.+++.++.++..|+.|+.||.+|+.+|++|+.||.++++.+..+...++||+|++|++++|+|+|+..+|..++..|...
T Consensus 976 ~~~~~~~~~~~~~~~k~~~a~~Li~~Ls~e~~rW~~~~~~~~~~~~~l~gd~ll~~~~~~y~g~~~~~~r~~~~~~~~~~ 1055 (1395)
T KOG3595|consen 976 AEKQELEEDMDACELKLLRAEELIQGLSGEKERWSETSEQFSKQYSRLVGDVLLSSAFVAYLGAFDQLYRQSLLRLWESL 1055 (1395)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHhcccchHHHHHHHHHHHHHHhhhhHHHHhhhhhhhhccccCHHHHHHHHHHhHHh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhcCCcccCCCccccccCCHHHHHHHHhCCCCCCchhhhhHHHhhcCCCcceeecCchhHHHHHHhhhccCCCeEEECC
Q psy12680 2465 VAACNIVCTKDFQLGAVMGNPVEIRAWNIFGLPCDSFSIDNGIIIKNSRRWPLMIDPQEQANKWIKNMEKANGLNVIRLS 2544 (2567)
Q Consensus 2465 l~~~~I~~~~~f~l~~~L~~~~~i~~W~~~GLP~D~~SiENaiIi~~s~r~PLlIDPq~Qa~~Wik~~~~~~~l~v~~~~ 2544 (2567)
+....+ +.+++++..+++++.++..|+..|||.|++|+|||+|+.++.|||++||||+|++.||+|+++.+++.+++++
T Consensus 1056 ~~~~~~-~~~~~~~~~~l~~~~~~~~w~~~~lp~~~~s~en~~i~~~~~~~~l~id~q~q~~~~i~~~~~~~~~~~i~~~ 1134 (1395)
T KOG3595|consen 1056 CTQLKI-VLSNFSLISMLVDPTEILNWNIRGLPADDLSIENGIIITNSNRWPLIIDPQGQANEWIKNKESENKLQVISFN 1134 (1395)
T ss_pred cCcccc-cccccchHhhcCchHhhcchhhccCcccccchhHHHHHhccCCCceeecchhhhhHhHhhhhhhcccceeecc
Confidence 999999 9999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ChhhHHHHHHHHhcCCceecc
Q psy12680 2545 NTDYMRILEGAIGFGFPAKKL 2565 (2567)
Q Consensus 2545 ~~~f~~~LE~ai~~G~p~~~~ 2565 (2567)
+.+|++.+|+|++||.|+-..
T Consensus 1135 ~~~~l~~le~a~~~g~~il~~ 1155 (1395)
T KOG3595|consen 1135 EKEFLRQLENALRFGEPVLIE 1155 (1395)
T ss_pred chhHHHHHHhHhccCCceecc
Confidence 999999999999999998654
|
|
| >COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >KOG3595|consensus | Back alignment and domain information |
|---|
| >PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF12781 AAA_9: ATP-binding dynein motor region D5; PDB: 3VKG_A 3VKH_C 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A | Back alignment and domain information |
|---|
| >KOG1808|consensus | Back alignment and domain information |
|---|
| >KOG1808|consensus | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >KOG0733|consensus | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0733|consensus | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG1051|consensus | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0735|consensus | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >KOG0979|consensus | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0736|consensus | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >KOG0730|consensus | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >KOG0736|consensus | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0735|consensus | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >smart00350 MCM minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG0727|consensus | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0652|consensus | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >KOG0734|consensus | Back alignment and domain information |
|---|
| >KOG0976|consensus | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >KOG0730|consensus | Back alignment and domain information |
|---|
| >TIGR02442 Cob-chelat-sub cobaltochelatase subunit | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >KOG2028|consensus | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >KOG0726|consensus | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0731|consensus | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK13808 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PTZ00111 DNA replication licensing factor MCM4; Provisional | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >smart00350 MCM minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0737|consensus | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >PTZ00111 DNA replication licensing factor MCM4; Provisional | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG4360|consensus | Back alignment and domain information |
|---|
| >PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >PLN02842 nucleotide kinase | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0976|consensus | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0740|consensus | Back alignment and domain information |
|---|
| >KOG0980|consensus | Back alignment and domain information |
|---|
| >KOG4809|consensus | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0964|consensus | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0995|consensus | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0977|consensus | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PLN02459 probable adenylate kinase | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG2028|consensus | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >KOG0995|consensus | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >KOG0018|consensus | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >KOG0738|consensus | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG0652|consensus | Back alignment and domain information |
|---|
| >KOG0729|consensus | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1051|consensus | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1533|consensus | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >KOG0989|consensus | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0991|consensus | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >KOG2004|consensus | Back alignment and domain information |
|---|
| >KOG0962|consensus | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG1534|consensus | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >KOG1547|consensus | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >KOG2227|consensus | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PRK05917 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >PHA02774 E1; Provisional | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK13973 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 2567 | ||||
| 3vkg_A | 3245 | X-Ray Structure Of An Mtbd Truncation Mutant Of Dyn | 2e-37 | ||
| 3vkg_A | 3245 | X-Ray Structure Of An Mtbd Truncation Mutant Of Dyn | 2e-37 | ||
| 3vkg_A | 3245 | X-Ray Structure Of An Mtbd Truncation Mutant Of Dyn | 1e-29 | ||
| 3vkg_A | 3245 | X-Ray Structure Of An Mtbd Truncation Mutant Of Dyn | 1e-18 | ||
| 3vkh_A | 3367 | X-Ray Structure Of A Functional Full-Length Dynein | 2e-37 | ||
| 3vkh_A | 3367 | X-Ray Structure Of A Functional Full-Length Dynein | 2e-37 | ||
| 3vkh_A | 3367 | X-Ray Structure Of A Functional Full-Length Dynein | 6e-36 | ||
| 3qmz_A | 2486 | Crystal Structure Of The Cytoplasmic Dynein Heavy C | 6e-34 | ||
| 3qmz_A | 2486 | Crystal Structure Of The Cytoplasmic Dynein Heavy C | 7e-23 | ||
| 3qmz_A | 2486 | Crystal Structure Of The Cytoplasmic Dynein Heavy C | 5e-20 | ||
| 4ai6_A | 2695 | Dynein Motor Domain - Adp Complex Length = 2695 | 6e-34 | ||
| 4ai6_A | 2695 | Dynein Motor Domain - Adp Complex Length = 2695 | 7e-23 | ||
| 4ai6_A | 2695 | Dynein Motor Domain - Adp Complex Length = 2695 | 4e-20 | ||
| 2rr7_A | 155 | Microtubule Binding Domain Of Dynein-C Length = 155 | 2e-30 | ||
| 3err_A | 536 | Microtubule Binding Domain From Mouse Cytoplasmic D | 1e-07 | ||
| 3j1t_A | 164 | High Affinity Dynein Microtubule Binding Domain - T | 2e-07 |
| >pdb|3VKG|A Chain A, X-Ray Structure Of An Mtbd Truncation Mutant Of Dynein Motor Domain Length = 3245 | Back alignment and structure |
|
| >pdb|3VKG|A Chain A, X-Ray Structure Of An Mtbd Truncation Mutant Of Dynein Motor Domain Length = 3245 | Back alignment and structure |
| >pdb|3VKG|A Chain A, X-Ray Structure Of An Mtbd Truncation Mutant Of Dynein Motor Domain Length = 3245 | Back alignment and structure |
| >pdb|3VKG|A Chain A, X-Ray Structure Of An Mtbd Truncation Mutant Of Dynein Motor Domain Length = 3245 | Back alignment and structure |
| >pdb|3VKH|A Chain A, X-Ray Structure Of A Functional Full-Length Dynein Motor Domain Length = 3367 | Back alignment and structure |
| >pdb|3VKH|A Chain A, X-Ray Structure Of A Functional Full-Length Dynein Motor Domain Length = 3367 | Back alignment and structure |
| >pdb|3VKH|A Chain A, X-Ray Structure Of A Functional Full-Length Dynein Motor Domain Length = 3367 | Back alignment and structure |
| >pdb|3QMZ|A Chain A, Crystal Structure Of The Cytoplasmic Dynein Heavy Chain Motor Domain Length = 2486 | Back alignment and structure |
| >pdb|3QMZ|A Chain A, Crystal Structure Of The Cytoplasmic Dynein Heavy Chain Motor Domain Length = 2486 | Back alignment and structure |
| >pdb|3QMZ|A Chain A, Crystal Structure Of The Cytoplasmic Dynein Heavy Chain Motor Domain Length = 2486 | Back alignment and structure |
| >pdb|4AI6|A Chain A, Dynein Motor Domain - Adp Complex Length = 2695 | Back alignment and structure |
| >pdb|4AI6|A Chain A, Dynein Motor Domain - Adp Complex Length = 2695 | Back alignment and structure |
| >pdb|4AI6|A Chain A, Dynein Motor Domain - Adp Complex Length = 2695 | Back alignment and structure |
| >pdb|2RR7|A Chain A, Microtubule Binding Domain Of Dynein-C Length = 155 | Back alignment and structure |
| >pdb|3ERR|A Chain A, Microtubule Binding Domain From Mouse Cytoplasmic Dynein As A Fusion With Seryl-Trna Synthetase Length = 536 | Back alignment and structure |
| >pdb|3J1T|A Chain A, High Affinity Dynein Microtubule Binding Domain - Tubulin Complex Length = 164 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
Score = 525 bits (1355), Expect = e-151
Identities = 88/550 (16%), Positives = 196/550 (35%), Gaps = 101/550 (18%)
Query: 312 MGITSDLFPGIELPETDYTILNKAVREVCEKANLQVTPFFLEKIQQIYEMMIVRWGFMIV 371
S +F P + + + +++ +++ ++ FL+K Q Y M + ++V
Sbjct: 871 KDELSKIFDSAGTPL-NSKAIVQCLKDAGQRSGFSMSEEFLKKCMQFYYMQKTQQALILV 929
Query: 372 GLSFAGKTCAYRMLSEALQLIEEWGELGEHKVEIIVINPKSITMGQLYGQFDAVSHEWSD 431
G + GKT ++ + +A+ + + H + VI+ K +T LYG + EW D
Sbjct: 930 GKAGCGKTATWKTVIDAMAIFDG------HANVVYVIDTKVLTKESLYGSMLKATLEWRD 983
Query: 432 GILAVSYRQFAMS----QNENRKWLIFDGPVDAIWIENMNSVLDDNKKLCLMSGEIIALA 487
G+ R+ +R W++FD +D ++E MNSVLDDNK L L +GE + +
Sbjct: 984 GLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEYVEAMNSVLDDNKILTLPNGERLPIP 1043
Query: 488 PTTSLIFEPQDLEVASPATVSRCGMIYMEPATLGWECLVDSWLNTLPPKVSRCGMIYMEP 547
P ++FE +L+ +PAT++RCG+++ +D LN +
Sbjct: 1044 PNFRILFETDNLDHTTPATITRCGLLWFSTDVCSISSKIDHLLNKSYEALD--------- 1094
Query: 548 ATLGWECLVDSWLNTLPPKVQEGHRDSLRQLIMRFCPTILYFLRRTPFARMVDDAMEAYK 607
N L + +D + T ++
Sbjct: 1095 -------------NKLSMFELDKLKDLISDSFDMASLTNIFTCSNDL------------- 1128
Query: 608 KKKREEWEMFPTQDSNLIRSLLNLFDTFLDDFNDEKYYETHPSLDIRSQLEGIFFFSCIW 667
+ + N + + + L + + +++ ++ + + S ++
Sbjct: 1129 ------VHILGVRTFNKLETAVQLAVHLISSYRQ--WFQNLDDKSLKDVITLLIKRSLLY 1180
Query: 668 SMGACLTFETKPHFSNLLYGLMEKEFPASLRESLGLPVELCQPPAKPYLFTVPPQGTVYD 727
++ T E++ F + + + + Y
Sbjct: 1181 ALAGDSTGESQRAFIQTINTYFGHD---------------------------SQELSDYS 1213
Query: 728 YRFIKEGKGRWKPWSDDLASAPAIPRDMPVNQIIVTTEETLRNIALMKLLVTHQKPVMFI 787
I K + + ++ S ++ I++ T +T+++ + L+ ++ ++
Sbjct: 1214 TIVIANDKLSFSSFCSEIPSVSLEAHEVMRPDIVIPTIDTIKHEKIFYDLLNSKRGIILC 1273
Query: 788 GPTGTGKSCYITVSILFIKNNSRLRSGFQHFLLKELSIEQWQPLIMNFSAQTSANQTQDI 847
GP G+GK+ + + L + + +NFS T+
Sbjct: 1274 GPPGSGKTMIM-----------------NNALRNS---SLYDVVGINFSKDTTTEHILSA 1313
Query: 848 IMSKLDKRRK 857
+ +
Sbjct: 1314 LHRHTNYVTT 1323
|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >2rr7_A Dynein heavy chain 9; microtubule-binding, stalk head, MTBD, antiparallel coil, motor protein, DSH; NMR {Chlamydomonas reinhardtii} Length = 155 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Length = 101 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129 | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Length = 101 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 2567 | |||
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 100.0 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 100.0 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 100.0 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 100.0 | |
| 2rr7_A | 155 | Dynein heavy chain 9; microtubule-binding, stalk h | 100.0 | |
| 3err_A | 536 | Fusion protein of microtubule binding domain from | 100.0 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 99.36 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 99.16 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 99.1 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 98.75 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 98.7 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 98.69 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 98.56 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 98.36 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 97.95 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 97.94 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 97.92 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 97.87 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 97.81 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 97.8 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 97.77 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 97.76 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 97.72 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 97.7 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 97.68 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 97.67 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 97.64 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 97.64 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 97.59 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 97.59 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 97.58 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 97.57 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 97.57 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 97.56 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 97.53 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 97.5 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 97.49 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 97.49 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 97.49 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 97.49 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 97.47 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 97.47 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 97.47 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 97.47 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 97.47 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 97.45 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 97.45 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 97.45 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 97.44 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 97.44 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 97.43 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 97.42 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 97.39 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 97.39 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 97.38 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 97.33 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 97.3 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 97.29 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 97.28 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 97.27 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 97.27 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 97.26 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 97.25 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 97.23 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 97.22 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 97.15 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 97.13 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 97.13 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 97.12 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 97.11 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 97.1 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 97.1 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 97.1 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 97.09 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 97.09 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 97.08 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 97.07 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 97.07 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 97.02 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 97.01 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 96.99 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 96.98 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 96.97 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 96.96 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 96.95 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 96.95 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 96.95 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 96.94 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 96.93 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 96.91 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 96.91 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 96.88 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 96.88 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 96.87 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 96.86 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 96.86 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 96.86 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 96.83 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 96.82 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 96.81 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 96.77 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 96.75 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 96.73 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 96.73 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 96.72 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 96.72 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 96.68 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 96.67 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 96.67 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 96.66 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 96.63 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 96.61 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 96.47 | |
| 3f8t_A | 506 | Predicted ATPase involved in replication control, | 96.46 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 96.44 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 96.44 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.41 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 96.41 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 96.36 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 96.28 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 96.28 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 96.23 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 96.21 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 96.18 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 96.16 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 96.15 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 96.14 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 96.06 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 96.05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 96.04 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 96.0 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 95.96 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 95.95 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 95.92 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 95.91 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 95.8 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 95.77 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 95.75 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 95.56 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 95.46 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 95.41 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 95.4 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 95.32 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 95.23 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 95.15 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 95.15 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 95.06 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 94.98 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 94.98 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 94.96 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 94.96 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 94.93 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 94.89 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 94.88 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 94.73 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 94.68 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 94.62 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 94.5 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 94.46 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 94.46 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 94.44 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 94.37 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 94.26 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 94.13 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 94.12 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 94.05 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 93.86 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 93.85 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 93.7 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 93.65 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 93.36 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 93.24 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 93.17 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 93.09 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 92.9 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 92.76 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 92.75 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 92.68 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 91.92 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 91.89 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 91.88 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 91.88 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 91.79 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 91.7 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 91.69 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 91.52 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 91.31 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 91.25 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 91.19 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 91.19 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 91.17 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 91.14 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 91.05 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 90.99 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 90.84 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 90.63 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 90.59 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 90.53 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 90.42 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 90.41 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 90.26 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 90.21 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 90.16 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 90.14 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 90.14 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 90.09 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 89.92 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 89.89 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 89.82 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 89.82 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 89.8 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 89.79 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 89.72 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 89.71 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 89.64 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 89.6 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 89.6 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 89.42 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 89.41 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 89.41 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 89.34 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 89.26 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 89.25 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 89.23 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 89.19 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 89.13 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 88.89 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 88.88 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 88.86 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 88.82 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 88.79 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 88.78 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 88.76 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 88.58 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 88.48 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 88.47 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 88.44 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 88.43 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 88.43 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 88.42 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 88.39 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 88.35 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 88.25 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 88.2 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 87.96 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 87.96 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 87.88 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 87.83 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 87.6 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 87.52 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 87.52 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 87.49 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 87.43 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 87.42 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 87.3 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 87.29 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 87.28 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 87.16 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 87.03 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 86.95 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 86.88 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 86.86 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 86.86 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 86.81 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 86.75 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 86.75 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 86.73 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 86.58 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 86.53 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 86.5 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 86.46 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 86.42 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 86.39 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 86.37 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 86.36 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 86.34 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 86.28 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 86.16 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 86.05 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 86.04 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 86.04 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 85.98 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 85.98 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 85.95 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 85.92 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 85.89 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 85.87 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 85.67 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 85.65 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 85.59 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 85.43 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 85.4 | |
| 3f8t_A | 506 | Predicted ATPase involved in replication control, | 85.39 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 85.38 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 85.26 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 85.16 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 85.1 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 85.07 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 84.88 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 84.8 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 84.76 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 84.72 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 84.69 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 84.47 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 84.46 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 84.45 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 84.43 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 84.42 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 84.38 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 84.33 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 84.26 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 84.25 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 84.24 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 84.23 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 84.22 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 84.21 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 84.19 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 84.15 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 84.14 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 84.13 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 84.06 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 83.94 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 83.93 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 83.86 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 83.85 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 83.54 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 83.46 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 83.43 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 83.33 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 83.33 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 83.28 | |
| 3jsv_C | 94 | NF-kappa-B essential modulator; ubiquitin, coiled- | 83.28 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 83.15 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 83.07 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 83.03 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 82.94 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 82.93 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 82.89 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 82.85 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 82.81 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 82.8 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 82.77 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 82.75 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 82.69 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 82.64 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 82.48 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 82.48 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 82.48 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 82.37 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 82.36 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 82.33 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 82.33 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 82.23 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 82.17 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 82.13 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 82.09 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 82.08 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 82.03 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 81.98 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 81.94 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 81.93 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 81.93 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 81.82 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 81.8 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 81.62 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 81.54 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 81.46 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 81.43 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 81.4 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 81.4 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 81.36 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 81.27 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 81.21 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 81.2 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 81.11 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 81.06 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 81.05 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 81.01 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 80.84 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 80.83 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 80.75 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 80.73 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 80.64 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 80.61 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 80.53 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 80.51 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 80.51 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 80.45 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 80.38 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 80.27 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 80.24 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 80.19 |
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=5.8e-292 Score=3157.42 Aligned_cols=1496 Identities=26% Similarity=0.461 Sum_probs=0.0
Q ss_pred CCCCCCCCCCCCchhHHHHHHHHhcCeEEEEeCCCCccHHHHHHhhhhhhhcCccccccccccCCchhHHHHHHHHHhhh
Q psy12680 1 MGGAPEGPAGTGKTETTKDLAKAVAKLCIVFNCSDSMDYIGLGKFFKGLIATGAWACFDEFNRIDVEVLSVVAQQILTIQ 80 (2567)
Q Consensus 1 lGGap~GPaGTGKTEtvK~Lak~lG~~~~vfNCs~~~d~~~m~rif~Gl~q~GaW~CFDEfNri~~~vLSvvaqqi~~Iq 80 (2567)
+||+|+||||||||||||+||++|||+|+||||++++||++|||||+|+||+||||||||||||+++|||||+|||++||
T Consensus 605 ~gg~~~GPaGtGKTet~k~La~~lgr~~~vfnC~~~~d~~~~g~i~~G~~~~GaW~cfDEfNrl~~~vLSvv~~qi~~I~ 684 (3245)
T 3vkg_A 605 MGGNPFGPAGTGKTETVKALGSQLGRFVLVFCCDEGFDLQAMSRIFVGLCQCGAWGCFDEFNRLEERILSAVSQQIQTIQ 684 (3245)
T ss_dssp CEEEEECSTTSSHHHHHHHHHHHTTCCEEEEECSSCCCHHHHHHHHHHHHHHTCEEEEETTTSSCHHHHHHHHHHHHHHH
T ss_pred CCCCCCCCCCCCHHHHHHHHHHHhCCeEEEEeCCCCCCHHHHHHHHhhHhhcCcEEEehhhhcCCHHHHHHHHHHHHHHH
Q ss_pred hhhhcCCceEEEc-CeEEEeeCceeEEEEeCCCCCCCCCchhhHhhccccccccCCCHHHHHHHHHHhhhchHHHHHHHH
Q psy12680 81 RGVTLGEEEILFE-GTILKLDRTCSVFITMNPGYAGRSELPDNLKSLFRTVAMMVPDYALISEIIVKKLAPYKQLYDNCI 159 (2567)
Q Consensus 81 ~a~~~~~~~~~f~-g~~i~l~~~~~iFiTmNPgYaGRseLPdnLk~lFRpvam~~PD~~lIaEi~L~~~~~~~~Ly~~~~ 159 (2567)
.|++++..+|.|+ |++|+++|+|||||||||||+||+|||||||++||||+|++||+++|+||||++.
T Consensus 685 ~a~~~~~~~~~~~~G~~i~l~~~~~vfiTmNpgY~gr~eLP~nLk~lFr~v~m~~Pd~~~i~ei~L~s~----------- 753 (3245)
T 3vkg_A 685 VALKENSKEVELLGGKNISLHQDMGIFVTMNPGYAGRSNLPDNLKKLFRSMAMIKPDREMIAQVMLYSQ----------- 753 (3245)
T ss_dssp HHHHHTCSEECCC---CEECCTTCEEEECBCCCGGGCCCSCHHHHTTEEEEECCSCCHHHHHHHHHHTT-----------
T ss_pred HHHHcCCCeEEecCCCEEeecCCeEEEEEeCCCccCcccChHHHHhhcEEEEEeCCCHHHHHHHHHHHc-----------
Q ss_pred HHHHHhhhhhhhhhcccChhhhHHHHHHHHHHHHHHhhhccCCCCcchhhhhhhhHHHHhhhcc--------hhhhhccC
Q psy12680 160 EYQEKHKMWAESIVGTFDPEQIEEETNEFYKNIYKLKLQFSHLPGPYGIASKVLDQVQEFKEHM--------PIIQTLGN 231 (2567)
Q Consensus 160 ~~~~~~~~~~~~i~~~~~~~~l~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~vl~~~~~~k~~~--------~~~~~~~~ 231 (2567)
||.+++.|+.++..+|+.+.++.++|.|||+|+|++++||..|+.+||.. +
T Consensus 754 --------------Gf~~a~~La~k~~~~~~l~~e~LS~Q~HYDfGLRalKsVL~~AG~lkr~~~~~~~~~~~------- 812 (3245)
T 3vkg_A 754 --------------GFKTAEVLAGKIVPLFKLCQEQLSAQSHYDFGLRALKSVLVSAGGIKRKCQPPQLPPIT------- 812 (3245)
T ss_dssp --------------TCSCHHHHHHHHHHHHHHHHHSSCCCTTCCCSHHHHHHHHHHHHHHHHSCCCC-------------
T ss_pred --------------ccchHHHHHHHHHHHHHHHHHHhCCCCCCCCChHHHHHHHHHHHHHHHhhhhhcccccc-------
Q ss_pred CCcccchhhhhhhccCCCCCc------------hhhhhHHHHHHhhccccccchhhhHHHHhhhhccCcccccccccchh
Q psy12680 232 PGLQLRHWEKISEVVGFPLSP------------EMEDFTLQRIFNYGLEEYVPKFEIWKDIMKTVAADPRVMSVVEIPKL 299 (2567)
Q Consensus 232 ~~~~~r~~~~~~~~~~~~~~~------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l 299 (2567)
. ..|+..+.|.+. +.++|||
T Consensus 813 --------------------~~~~~~~~~~~~~~~E~~illralr---d~nlpKl------------------------- 844 (3245)
T 3vkg_A 813 --------------------DAESKTKADQIYCQYEIGVLLNSIN---DTMIPKL------------------------- 844 (3245)
T ss_dssp --------------------CHHHHHHHHHHHHHHHHHHHHHHHH---HTTTTTS-------------------------
T ss_pred --------------------cccccccccccccccHHHHHHHHHH---HhccCCC-------------------------
Q ss_pred hhhhhhhccccccccccCCCCCCcCCCCChHHHHHHHHHHHHHcCCccChHHHHHHHHHHHHHHhceEEEEEccCCCChh
Q psy12680 300 KENLQKCNGLLDMGITSDLFPGIELPETDYTILNKAVREVCEKANLQVTPFFLEKIQQIYEMMIVRWGFMIVGLSFAGKT 379 (2567)
Q Consensus 300 ~~~l~~~~~~~~~~ii~DlFP~~~~~~~~~~~l~~ai~~~~~~~~l~~~~~~i~Kv~QLye~~~~rhGvmlvGp~gsGKS 379 (2567)
...|..+|+||++|+|||++.|..+|+.|.++|+++|+++||++++.|+.||+||||++.+|||||||||||||||
T Consensus 845 ----~~~D~plF~~li~DlFPgv~~~~~~~~~l~~ai~~~~~~~~L~~~~~~v~KviQLye~~~vRhGvmlVGp~gsGKT 920 (3245)
T 3vkg_A 845 ----VADDIPLIQSLLLDVFPGSQLQPIQMDQLRKKIQEIAKQRHLVTKQEWVEKILQLHQILNINHGVMMVGPSGGGKT 920 (3245)
T ss_dssp ----CGGGHHHHHHHHHHHSTTCCCCCCCCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHTTCSEEEEECSSSSSHH
T ss_pred ----chhhHHHHHHHHHHhCCCCCCCCCchHHHHHHHHHHHHHcCCccCHHHHHHHHHHHHHHHheeeEEEECCCCCCHH
Q ss_pred HHHHHHHHHHHHHHHhcccCCccEEEEEeccCCCCcCcccccccCCCCCCCcchHHHHHHHHH---hcCCCCceEEEeCC
Q psy12680 380 CAYRMLSEALQLIEEWGELGEHKVEIIVINPKSITMGQLYGQFDAVSHEWSDGILAVSYRQFA---MSQNENRKWLIFDG 456 (2567)
Q Consensus 380 t~~~~L~~Al~~l~~~~~~~~~~v~~~~inPKait~~eLyG~~d~~T~EW~DGvls~i~R~~~---~~~~~~~~WivfDG 456 (2567)
|||++|++|++ ...+.+++.++|||||||++||||++||+|+||+|||||+++|+++ ..+..+++||||||
T Consensus 921 t~~~~L~~al~------~l~~~~~~~~~iNPKait~~eLyG~~d~~T~EW~DGvls~i~R~~~~~~~~~~~~~~WIvfDG 994 (3245)
T 3vkg_A 921 TSWEVYLEAIE------QVDNIKSEAHVMDPKAITKDQLFGSLDLTTREWTDGLFTATLRRIIDNVRGESTKRHWIIFDG 994 (3245)
T ss_dssp HHHHHHHHHHT------TTTTCEEEEEEECTTTSCHHHHHEEECTTTCCEEECHHHHHHHHHHTTSSSGGGEEEEEEEES
T ss_pred HHHHHHHHHHH------HhhCCCceEEEECCCCCchhhhceeecCCCCeeeccHHHHHHHHHHhcccCCCCCceEEEECC
Q ss_pred CCCHHHHHHHHhhhcCCceeEecccceeecCCCCeEEEecCCcCcCCcceeeeceeEEecCCCCchhhhHHhhhhcCCCC
Q psy12680 457 PVDAIWIENMNSVLDDNKKLCLMSGEIIALAPTTSLIFEPQDLEVASPATVSRCGMIYMEPATLGWECLVDSWLNTLPPK 536 (2567)
Q Consensus 457 pVDa~WIEnLNSVLDDNK~LtL~nGErI~l~~~~~llFEv~dL~~ASPATVSRcGmVy~~~~~lgw~~~v~sWl~~~~~~ 536 (2567)
||||+|||||||||||||+|||+|||||+|||+|+|||||+||++||||||||||||||+|+++||+|++.+|+++++..
T Consensus 995 pVDa~WIEnlNsVLDDNK~LtL~nGErI~l~~~~~liFEv~dL~~ASPATVSRcGmVy~~~~~l~~~~~~~swl~~~~~~ 1074 (3245)
T 3vkg_A 995 DVDPEWVENLNSLLDDNKLLTLPNGERLALPNNVRVMFEVQDLKYATLATISRCGMVWFSEEILTTQMIFQNYLDTLSNE 1074 (3245)
T ss_dssp CCCHHHHTTTHHHHSSSCEECCTTSCCEECCTTEEEEEEESCCTTCCHHHHHTSEEEECCTTSSCHHHHHHHHHHHHTTS
T ss_pred CCCHHHHHHHHHHhcCCCeeecCCCCeeecCCCCEEEEEeccccccChhhheeeeEEEEcccccCchHHHHHHHHhCccc
Q ss_pred -----------------cccccccccccccccccccccccccCCCcc--------------------cccchhHHHHHHH
Q psy12680 537 -----------------VSRCGMIYMEPATLGWECLVDSWLNTLPPK--------------------VQEGHRDSLRQLI 579 (2567)
Q Consensus 537 -----------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------------------~~~~~~~~l~~l~ 579 (2567)
.... |+....++.....+. ......+.+..+|
T Consensus 1075 ~~~~~~~~~~~~~~~~~l~~~-----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~ 1143 (3245)
T 3vkg_A 1075 PFDPQEKEQQKRNENAQLQQQ-----------QQTTITSPILTSPPTTSSSSRSTTSTTSMIPAGLKVQKECAAIISQYF 1143 (3245)
T ss_dssp CSCHHHHHHHHHHHTC---------------------------------------------CCHHHHHHHHHHHHHHHHH
T ss_pred cccchhhhhhcccccchhhhc-----------ccccccccccccccccccccccccccccccchhHHHHHHHHHHHHHHh
Q ss_pred --HHhhhhHHHHhhccchhhhhhHHHHHHHhhhccccccccccchhHHHHHHHHHHhhcc---ccCCcccccCCCChhhH
Q psy12680 580 --MRFCPTILYFLRRTPFARMVDDAMEAYKKKKREEWEMFPTQDSNLIRSLLNLFDTFLD---DFNDEKYYETHPSLDIR 654 (2567)
Q Consensus 580 --~~~~~~~l~f~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~v~sl~~l~~~~l~---~~~~~~~~~~~~~~~~~ 654 (2567)
+.|++++++|++ ++..++|.++.+++.++|+++++++. ..+........+.....
T Consensus 1144 ~~~~~v~~~l~~~~--------------------~~~~i~~~~~~~~v~~l~~ll~~~~~~~~~~~~~~~~~~~~~~~~~ 1203 (3245)
T 3vkg_A 1144 EPGGLVHKVLEDAG--------------------QRPHIMDFTRLRVLNSFFSLMNRSIVNVIEYNQLHSDFPMSPENQS 1203 (3245)
T ss_dssp STTCHHHHHHHHHH--------------------TSCCSSCCCHHHHHHHHHHHHHHHHHHHHHHHHHTTTSCCCHHHHH
T ss_pred cccccHHHHHHHHH--------------------hcCcccCccHHHHHHHHHHHHHHHhhhhcccccccccCCCCHHHHH
Q ss_pred HHHHhHHHHHhhhccccccCCCChhhHHHHHHHHhhhcccchhhcccCCCcccCCCCCCCcccccCCCCceeeEEEeeCC
Q psy12680 655 SQLEGIFFFSCIWSMGACLTFETKPHFSNLLYGLMEKEFPASLRESLGLPVELCQPPAKPYLFTVPPQGTVYDYRFIKEG 734 (2567)
Q Consensus 655 ~~~e~~F~fs~iWs~Gg~l~~~~r~~F~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~g~v~dy~~~~~~ 734 (2567)
.+++++|+||+||||||+++.++|.+||.|+|+.+...+| |+.|+||||+++. +
T Consensus 1204 ~~~~~~f~faliWs~Gg~l~~~~R~~F~~~~~~~~~~~~p-------------------------~~~~~v~Dy~~~~-~ 1257 (3245)
T 3vkg_A 1204 NYITNRLLYSLMWGLGGSMGLVERENFSKFIQTIAITPVP-------------------------ANTIPLLDYSVSI-D 1257 (3245)
T ss_dssp HHHHHHHHHHHHHHHHTTSCHHHHHHHHHHHHTTCSSCCC-------------------------CTTSCGGGEEECT-T
T ss_pred HHHHHHHHHHHHHHhcccCCHHHHHHHHHHHHHhcCCCCC-------------------------CCCCceEEEEEEC-C
Q ss_pred CCccccCccccCCCCCCCCCCCccceeeccchhhhHHHHHHHHHhcCCCeEEecCCCCCccceeehhhhhhccccccccc
Q psy12680 735 KGRWKPWSDDLASAPAIPRDMPVNQIIVTTEETLRNIALMKLLVTHQKPVMFIGPTGTGKSCYITVSILFIKNNSRLRSG 814 (2567)
Q Consensus 735 ~~~w~~W~~~~~~~~~~~~~~~~~~~~VpT~dt~r~~~ll~ll~~~~~pvll~G~~GtGKT~~i~~~~~~~~~~~~~~~~ 814 (2567)
.|+|.+|.+.+|++...|...++++++|||+||+|+.++++.++.+++||||+||||||||++++..+.
T Consensus 1258 ~~~w~~W~~~v~~~~~~~~~~~~~~ilVPT~DTvR~~~ll~~ll~~~~pvLL~GptGtGKT~li~~~L~----------- 1326 (3245)
T 3vkg_A 1258 DANWSLWKNKVPSVEVETHKVASPDVVIPTVDTTRHVDVLHAWLSEHRPLILCGPPGSGKTMTLTSTLR----------- 1326 (3245)
T ss_dssp TCSEEETTCCC---CCCSTTTTCTTCCCCCHHHHHHHHHHHHHHHTTCCCEEESSTTSSHHHHHHHHGG-----------
T ss_pred CCeeeehhhcCCccccCCccCCcccceecchHHHHHHHHHHHHHHCCCcEEEECCCCCCHHHHHHHHHH-----------
Q ss_pred hhhhhhhhhhhccccchhccccccccchhhHHHHHhhhhhhccccchhhhccccccccccccccccchhhhhhhhccccc
Q psy12680 815 FQHFLLKELSIEQWQPLIMNFSAQTSANQTQDIIMSKLDKRRKEEISTIVDIGNEENNNSRLRSGFQHFLLKELSIEQWQ 894 (2567)
Q Consensus 815 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 894 (2567)
T Consensus 1327 -------------------------------------------------------------------------------- 1326 (3245)
T 3vkg_A 1327 -------------------------------------------------------------------------------- 1326 (3245)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Q ss_pred ccccccccccchhhHHHHHHHhhhcccCcccCCCCCceeEEEeccCCCCcccccCCCChHHHHHHhhhccccccccchhh
Q psy12680 895 PLIMNFSAQTSANQTQDIIMSKLDKRRKGVYGPPLGKRCVVFVDDVNMPLKEEFGAQPPIEILRQWLDHWMWYDRKDVVA 974 (2567)
Q Consensus 895 ~~~~~fs~~ts~~~~q~~i~~~lekr~~~~~gp~~~k~~~~fiDD~nmp~~~~~g~q~~~ellrQ~~~~~~~yd~~~~~~ 974 (2567)
T Consensus 1327 -------------------------------------------------------------------------------- 1326 (3245)
T 3vkg_A 1327 -------------------------------------------------------------------------------- 1326 (3245)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Q ss_pred hhhhhhhhhhccCCCCCCCCcCcccccccceeeeccCCchhhHHHHHHHHhhhcccccccccccccCCCCcccCCchhHH
Q psy12680 975 VKLIEIQLMCAMGPPSTGNTVTPRFSRHFNQIVINKFDDDTMVTIFSKILLWHLDTRHESCKGITSDLFPGIELPETDYT 1054 (2567)
Q Consensus 975 ~~~~~~~~~~a~~p~~~~~~i~~r~~r~f~~~~~~~~~~~~l~~i~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1054 (2567)
T Consensus 1327 -------------------------------------------------------------------------------- 1326 (3245)
T 3vkg_A 1327 -------------------------------------------------------------------------------- 1326 (3245)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Q ss_pred HHHHHHHHHHhhhccCCcHHHHHHHHHHHHHHHhhhhhhhhcccccccchhhhhhhHHHHHHHhhhcCCCCCCCCCCCCC
Q psy12680 1055 ILNKAVREVCEKANLQVTPFFLEKIQQIYEMMIVRWGFMIVGLSFAGKTCAYRMLSEALQLIEEWSNQGGAPEGPAGTGK 1134 (2567)
Q Consensus 1055 ~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~ 1134 (2567)
T Consensus 1327 -------------------------------------------------------------------------------- 1326 (3245)
T 3vkg_A 1327 -------------------------------------------------------------------------------- 1326 (3245)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Q ss_pred cccchhHHHHHHHHHhhhccCCccccccccchhhhhHHHHHHHHhhhhhhhhhcCCCceeeeeccceehhhHHHHHhcCC
Q psy12680 1135 TETTKDLAKAVAKLCIVFNCSDSMDYIGLGKFFKMVDDAMEAYKKKKREEWVMDWPGQTVLCVGSAYWTADVHKAIANHP 1214 (2567)
Q Consensus 1135 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~q~vl~~~~i~wt~~v~~~~~~~~ 1214 (2567)
T Consensus 1327 -------------------------------------------------------------------------------- 1326 (3245)
T 3vkg_A 1327 -------------------------------------------------------------------------------- 1326 (3245)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Q ss_pred CccchhHHhhHHHHHHHHHHHhcCCCccccccccceEEEEecchhhhhhhccCCCCCCchhhhhhhhceeecCCCccccc
Q psy12680 1215 KGLSHYRDVCNAQINKIVEIVRGKLPPQTRITLGALVVIDVHARDVVVHLVSVPVSDENDFQWLCQLRYYAEGKGRWKPW 1294 (2567)
Q Consensus 1215 ~~l~~~~~~~~~~l~~l~~~~~~~l~~~~r~~~~~li~~~vh~rdi~~~l~~~~~~~~~~f~w~~qlryy~~~~~~w~~w 1294 (2567)
T Consensus 1327 -------------------------------------------------------------------------------- 1326 (3245)
T 3vkg_A 1327 -------------------------------------------------------------------------------- 1326 (3245)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Q ss_pred cccCCCCCCCCCCCCCcceeeeCchhhHHHHHHHHHHhcCCCcccccCCCCcccceeehhhhhhccccccccchhhhhhh
Q psy12680 1295 SDDLASAPAIPRDMPVNQIIVTTEETLRNIALMKLLVTHQKPVMFIGPTGTGKSCYITVSILFIKNNSRLRSGFQHFLLK 1374 (2567)
Q Consensus 1295 ~~~~~~~~~~~~~~~~~~ilVpT~dT~R~~~ll~~ll~~~~pvll~GptGTGKT~~i~~~~~~~~~~~~l~~~~~~~ll~ 1374 (2567)
T Consensus 1327 -------------------------------------------------------------------------------- 1326 (3245)
T 3vkg_A 1327 -------------------------------------------------------------------------------- 1326 (3245)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Q ss_pred hhccccccceeeccccccCHHHHHHHHHhhhhccc----CCccCCCC-CcEEEEEEcCCCCccccccCCCChHHHHHHHh
Q psy12680 1375 ELSIEQWQPLIMNFSAQTSANQTQDIIMSKLDKRR----KGVYGPPL-GKRCVVFVDDVNMPLKEEFGAQPPIEILRQWL 1449 (2567)
Q Consensus 1375 ~l~~~~~~~~~lnfSa~Tts~~~q~~ies~lekr~----~~~~gp~~-gK~~vvFiDDiNmP~~d~yGtQ~~ielLRQli 1449 (2567)
....+..+.+|||++|+|..+|..+++++++|+ |.+|||+. ||++|+|+||+|||.+|+||||||+|+|||++
T Consensus 1327 --~l~~~~~~~infS~~Tta~~l~~~~e~~~e~~~~~~~G~~~~p~~~Gk~~VlFiDDiNmp~~D~yGtQ~~ielLrqll 1404 (3245)
T 3vkg_A 1327 --AFPDFEVVSLNFSSATTPELLLKTFDHHCEYKRTPSGETVLRPTQLGKWLVVFCDEINLPSTDKYGTQRVITFIRQMV 1404 (3245)
T ss_dssp --GCTTEEEEEECCCTTCCHHHHHHHHHHHEEEEECTTSCEEEEESSTTCEEEEEETTTTCCCCCTTSCCHHHHHHHHHH
T ss_pred --hCCCCceEEEEeeCCCCHHHHHHHHhhcceEEeccCCCcccCCCcCCceEEEEecccCCCCccccccccHHHHHHHHH
Q ss_pred hcccccccCcceeeeeeeeeeeeecCCCC-CC-CCCCcchhccccceeccCCCHHHHHHHHHHHHHhhhcccCCcccchh
Q psy12680 1450 DHWMWYDRKDVVAVKLIEIQLMCAMGPPS-TG-NTVTPRFSRHFNQIVINKFDDDTMVTIFSKILLWHLDTRGFSKEFDP 1527 (2567)
Q Consensus 1450 d~~g~ydr~~~~~~~i~diq~v~am~Ppg-gg-~~is~Rf~r~f~vi~i~~p~~~sL~~If~~il~~~l~~~gf~~~v~~ 1527 (2567)
|+|||||+++..|+.+.|++|+||||||| || ++++|||+|||+++++++|++++|.+||++|+.+++. +.+.+..
T Consensus 1405 d~~g~yd~~~~~~~~i~d~~~vaamnPp~~gGr~~l~~Rf~r~F~vi~i~~ps~esL~~If~til~~~l~---~~p~l~~ 1481 (3245)
T 3vkg_A 1405 EKGGFWRTSDHTWIKLDKIQFVGACNPPTDAGRVQLTHRFLRHAPILLVDFPSTSSLTQIYGTFNRALMK---LLPNLRS 1481 (3245)
T ss_dssp HHSEEEETTTTEEEEESSEEEEEEECCTTSTTCCCCCHHHHTTCCEEECCCCCHHHHHHHHHHHHHHHTT---SCGGGTT
T ss_pred HcCCeEECCCCeEEEecCeEEEEEcCCCCCCCCccCCHHHHhhceEEEeCCCCHHHHHHHHHHHHHHHHh---hChHHHH
Q ss_pred HHHHHHHHHHHHHHHHHhhcCCCCCCcccccCchhHHHHHHHHhcc-chHHHhcHHHHHHHhhhhhhhhhcccccCchhH
Q psy12680 1528 CIEQLVQATLHIFKESLLNLLPTPTKSHYLFNLRDFARVIQGVLLS-VPEAIESLLSMKRLWVHEVLRVYYDRLVDSDDR 1606 (2567)
Q Consensus 1528 ~~~~lv~ati~ly~~v~~~~lPTp~k~HY~FnlRDlsrv~qGll~~-~~~~i~~~~~l~rLw~HE~~RVF~DRLv~~~D~ 1606 (2567)
+++.++++++++|..++..|+|+ +|+||+||||||+||+|||+++ .+....+...++|||+|||+|||+||||+++||
T Consensus 1482 ~~~~lv~ati~ly~~v~~~~lp~-~k~HY~FnLRDLsrv~qGll~~~~~~~~~~~~~lvrLW~HE~~RVF~DRLv~~~Dr 1560 (3245)
T 3vkg_A 1482 FADNLTDAMVEFYSESQKRFTPD-IQAHYIYSPRELSRWDRALLEAIQTMDGCTLEGLVRLWAHEALRLFQDRLVETEEK 1560 (3245)
T ss_dssp SHHHHHHHHHHHHHHHHHHSCTT-TSTTCCCCHHHHHHHHHHHHHHHHTSSCCCTTHHHHHHHHHHHHHHTTTCSSHHHH
T ss_pred HHHHHHHHHHHHHHHHHHhcCCC-cCCCccccHHHHHHHHHHHHHhcCccccCCHHHHHHHHHHHHHHHHHHHcCCHHHH
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHhhhhcCCCCCcccccccccccccCCCCCcCccCccccCCHHHHHHHHHHHHHHHhc
Q psy12680 1607 LWLFNTLKYTVEKFLQEDMNQLFANLKEANSTEPVGEYELRNLIYCDFANPKADQRNYMEVTNLEDLRTIVERYLTEFNN 1686 (2567)
Q Consensus 1607 ~~f~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~llf~~f~~~~~~~~~Y~~v~d~~~l~~~l~~~l~~yN~ 1686 (2567)
.||.+++...+.++| .... .....++++||||++ +.|++| +.+.++.+++++|++||+
T Consensus 1561 ~~f~~~l~~~~~~~F---------------~~~~-~~~~~~pllf~~f~~-----~~Y~~v-~~~~l~~~l~~~L~~yn~ 1618 (3245)
T 3vkg_A 1561 EWTDKKIDEVALKHF---------------PSVN-LDALKRPILYSNWLT-----KDYQPV-NRSDLREYVKARLKVFYE 1618 (3245)
T ss_dssp HHHHHHHHHHHHHHC---------------TTSC-GGGGCSSCCCCSSCC---------CC-CHHHHHHHHHHHHHTTC-
T ss_pred HHHHHHHHHHHHHhc---------------Ccch-hhhcccCcchhhhcc-----ccCccC-CHHHHHHHHHHHHHHHHh
Q ss_pred cCCCCcccccccccccCCchhHHHHHHhHhHHHHhhhhccCCCCCcccccccchhhHHHHhhhhccccCCCCCCCCCCCc
Q psy12680 1687 MSKKPMNLVLFRGFSKEFDPCIEQLVQATLHIFKESLLNLLPTPTKSHYLFNLRDFARVIQYLTVTGRVGPGPPENSFSK 1766 (2567)
Q Consensus 1687 ~~~~~m~LVlF~~~~~~~~~~~~~l~~~~~~i~~~~~~~~~~~~~~~h~~f~lr~~~~vl~~~~~~~rv~~~~~~~~~~~ 1766 (2567)
. ..+|+||||+ +++.|++||.||+++|
T Consensus 1619 ~-~~~m~LVlF~---------------------------------------------daleHv~RI~RIL~qp------- 1645 (3245)
T 3vkg_A 1619 E-ELDVPLVLFN---------------------------------------------EVLDHILRIDRVFRQP------- 1645 (3245)
T ss_dssp ------CCCCCH---------------------------------------------HHHHHHHHHHHHHTST-------
T ss_pred c-ccCceEEeHH---------------------------------------------HHHHHHHHHHHHHccC-------
Q ss_pred cchHHHHHHHHHHHHHhCCccchHHHHHHHHHHHhhhccccEEEEcCCCCChHHHHHHHHHHHHHHHhhhccCCceEEEE
Q psy12680 1767 TDYTILNKAVREVCEKANLQVTPFFLEKIQQIYEMMIVRWGFMIVGLSFAGKTCAYRMLSEALQLIEEWGELGEHKVEII 1846 (2567)
Q Consensus 1767 ~d~~~l~~al~~~~~~~~l~~~p~~~~ki~ql~~~~~~r~~~lLVG~~GSGK~sl~rlla~~l~~~~~~~~~~~~~v~~~ 1846 (2567)
|||+||||+||||||||+||+|++.++
T Consensus 1646 --------------------------------------~GhaLLVGvgGSGkqSLtrLAa~i~~~--------------- 1672 (3245)
T 3vkg_A 1646 --------------------------------------QGHALLIGVSGGGKSVLSRFVAWMNGL--------------- 1672 (3245)
T ss_dssp --------------------------------------TCCEEEEESTTSSHHHHHHHHHHHTTC---------------
T ss_pred --------------------------------------CCCeEEecCCCCcHHHHHHHHHHHhCC---------------
Q ss_pred EecccccccccccccccccccccccchhHHHHHHHhhhcccCCeEEeecCCcchHHHhhhhhhHHHHHHHHhhhcccccc
Q psy12680 1847 VINPKSITMGQLYGQFDAVSHEWSDGILAVSYRQFAMSQNENRKWLIFDGPVDAIWIENMNSVLDDNKKLCLMSGEIIAL 1926 (2567)
Q Consensus 1847 ~inpk~is~~~~Yg~~~~~~~eW~dGil~~~~r~~~~~~~~~~~~iv~Dg~~d~~wie~ln~~ldD~k~l~l~~Ge~i~~ 1926 (2567)
..++|++++.|| +++|++|+|.++..+| +..
T Consensus 1673 --~vfqi~i~k~Y~---------------------------------------------~~~f~eDLk~l~~~aG--~~~ 1703 (3245)
T 3vkg_A 1673 --SIYTIKVNNNYK---------------------------------------------SSDFDDDLRMLLKRAG--CKE 1703 (3245)
T ss_dssp --EEECCC----CC---------------------------------------------HHHHHHHHHHHHHHHH--TSC
T ss_pred --eeEEEeeeCCCC---------------------------------------------HHHHHHHHHHHHHHHh--cCC
Q ss_pred CCceEEEeccccccccCCccccchhhHhhhhhccCCCccCCCCChhHHHHHHHhhchhhhhhhccCCCcccHHHHhHhhh
Q psy12680 1927 APTTSLIFEPQDLEVASPATITDESMVEDLSNLLNSGEVPNIFASDEKAEICEKMGVIDRQKDKSMQTDGTMMALFKFFV 2006 (2567)
Q Consensus 1927 ~~~~~life~q~L~~aS~a~I~~e~fLE~iN~lL~sGevP~Lf~~dE~~~i~~~~~~~~~~~~~~~~~~~~~~~l~~~fv 2006 (2567)
.+++|++ +|++|.+++||||||||||||||||||+.||+++|++.++..++..+.... +..++|+||+
T Consensus 1704 ~~~vFL~---------tD~qi~~e~FLE~IN~lL~sGEVP~LF~~dE~~~i~~~~r~~a~~~g~~~d---t~~~l~~~Fi 1771 (3245)
T 3vkg_A 1704 EKICFIF---------DESNVLESSFLERMNTLLAGGEVPGLFEGEEFTALMHACKETAQRNGLILD---SEEELYKYFT 1771 (3245)
T ss_dssp CCEEEEE---------EGGGCSSTHHHHHHHHHHHHSCCTTSSCTTTHHHHHHHHHHHHHHTTCCCC---CHHHHHHHHH
T ss_pred CCEEEEE---------eccccccHHHHHHHHHHhccCCccccCCHHHHHHHHHHHHHHHHhcCCCCC---CHHHHHHHHH
Q ss_pred C--------------------------------------CCCcHHHHHHHHHHhcccCCCCH------------------
Q psy12680 2007 D--------------------------------------TPWPPDALLAVATRFLNEVELSE------------------ 2030 (2567)
Q Consensus 2007 ~--------------------------------------~~Wp~eAL~~VA~~~L~~~~~~~------------------ 2030 (2567)
. ++||+|||.+||++||++++++.
T Consensus 1772 ~rvr~NLHvVL~mSPvg~~fR~R~r~fPaLvncctIDWf~~Wp~eAL~~Va~~fl~~~~l~~~~~~~~~~~~~~~~~~~~ 1851 (3245)
T 3vkg_A 1772 SQVRRNLHVVFTMNPASPDFHNRSATSPALFNRCVLDWFGEWSPEALFQVGSEFTRNLDLENPQYIAPPVFIQEAEIMGN 1851 (3245)
T ss_dssp HHHTTTCCEEEEECTTSTTTTC----CTHHHHHSEEEEEESCCHHHHHHHHHHHTTTSCCCCTTCCCCHHHHHHHHC---
T ss_pred HHHHHcCEEEEEECCCCHHHHHHHHHChHHhhCceeeecCCCCHHHHHHHHHHHHhhcccccccccccccccchhccccc
Q ss_pred -------HHHHHHHhhhhhhhhhhhhhhHHHHHHcCCccccCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHH
Q psy12680 2031 -------AERQISIDMCQNFHVSTQNLSDEFLVKTSRHVYVTPTSYLELISTFKQLLKVKQEEVLNGKNRYTVGLEKLDK 2103 (2567)
Q Consensus 2031 -------~~~~~~~~~~~~~H~sv~~~s~~~~~~~~r~~yvTP~syL~~l~~f~~ll~~k~~el~~~~~rl~~GL~KL~e 2103 (2567)
..++.++++|+.+|.+|.++|++|+.+.|||+|+||++||+||++|++||.+|++++.++++||++||+||.+
T Consensus 1852 ~~~~~~~~~~~~~~~~~~~iH~sv~~~s~~~~~~~~R~~yvTP~syLeli~~y~~ll~~K~~el~~~~~rl~~GL~KL~e 1931 (3245)
T 3vkg_A 1852 NLMAIPPSHRDAVVSSLVYIHQTIGEANIRLLKRQGRQNYVTPRHYLDFINQVVLLINEKRDQLEEEQLHLNIGLKKLRD 1931 (3245)
T ss_dssp -CCCSSCCHHHHHHHHHHHHHHHHHHHHHHHHHSSSCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred cccccchhHHHHHHHHHHHHHHHHHHHHHHHHHHhCCcccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_pred HHHHHHHHHHHHHhhchHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHH
Q psy12680 2104 AASQIAVMREEIEYLQPFLMVSAANIKELMVTVEKESAEAAIVAEGVKKDEEVANEQALAAQAMKSVAEGVKKDEEVANE 2183 (2567)
Q Consensus 2104 a~~~V~~l~~~L~~~qp~L~~~~~~~~~~~~~le~~~~~a~~~~~~v~~~~~~~~e~~~~~~~~~~~~~~~~~~e~~~~~ 2183 (2567)
|+++|++||++|+++||+|++|+++++++|+++++++++| ++.++.++++++++++
T Consensus 1932 t~~~V~~l~~~L~~~~~~L~~k~~ea~~~l~~i~~~~~~a------------------------e~~k~~v~~~~~~~~~ 1987 (3245)
T 3vkg_A 1932 TEAQVKDLQVSLAQKNRELDVKNEQANQKLKQMVQDQQAA------------------------EIKQKDARELQVQLDV 1987 (3245)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------------------HHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------------------------HHHHHHHHHHHHHHHH
Q ss_pred HHHHHHHHHHHHHHHhhhhhHHHHHHHHHhhccCCCchHHHhhcCCChHHHHHHHHHHHHHhcCCCCCcCCCCCCcccCC
Q psy12680 2184 QALAAQAMKSECEEILSEAIPILEAAEAALNTLTSNDITVVKTMKSPPDIVKLVMKAVCILKGVKSERVPDAGGQLVEDY 2263 (2567)
Q Consensus 2184 ~~~~~~~~k~e~e~~L~~a~P~L~~A~~Al~~L~k~dl~Eirs~~~PP~~V~~VmeaVciLlg~~~~~~~~~~~~~~~~~ 2263 (2567)
++++++++|++||+||++|+|+
T Consensus 1988 ~~~ei~~~k~~~e~dL~~A~Pa---------------------------------------------------------- 2009 (3245)
T 3vkg_A 1988 RNKEIAVQKVKAYADLEKAEPT---------------------------------------------------------- 2009 (3245)
T ss_dssp HHHHHHHHHHHHHHCC----------------------------------------------------------------
T ss_pred HHHHHHHHHHHHHHHHhhcCCC----------------------------------------------------------
Q ss_pred cHHHHhhhcchhhHhhhhccCCCCCCHHHHHHHHhhhcCCCCCCHHHHHHHhHhhhHHHHHHHHHHHHHHHHHHhcchHH
Q psy12680 2264 WGPSKKLLGDIKFLEGLTNFNKDNVPAAVIKRLEDEFLSREDFDPEVVKKSSTAAEGLCKWVIAICKYDKVAKIVGPKKE 2343 (2567)
Q Consensus 2264 W~~ak~~L~~~~Fl~~L~~fDkd~I~~~~~~~l~~~~~~~~~F~~e~v~~aS~Aa~~Lc~WV~A~~~Y~~V~~~V~Pk~~ 2343 (2567)
+|||+
T Consensus 2010 ---------------------------------------------------------------------------~Pkr~ 2014 (3245)
T 3vkg_A 2010 ---------------------------------------------------------------------------GPLRE 2014 (3245)
T ss_dssp ----------------------------------------------------------------------------CHHH
T ss_pred ---------------------------------------------------------------------------ChHHH
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhccHHHHHH
Q psy12680 2344 ALRQAEEKLQLAMSALHEKQEQNRIVQEKLQKLQNTLDAKKKELKDLQDELDLCVKKKQRAEDLIGKLGGEKERWSSTAK 2423 (2567)
Q Consensus 2344 ~l~~ae~~l~~a~~~L~~~~~~l~~l~~~l~~L~~~~~~~~~ek~~L~~~~~~~~~rl~rA~~Li~~L~~Ek~RW~~~~~ 2423 (2567)
+|++||+++++++++|++++++|++++++|++|+++|+++++||++|+.+++.|+.||+||++||+||++|+.||+++++
T Consensus 2015 ~l~~ae~~l~~~~~~L~~~~~~L~~le~~l~~L~~~~~~~~~ek~~L~~e~~~~~~kl~rA~~Li~gL~~Ek~RW~~~~~ 2094 (3245)
T 3vkg_A 2015 EVEQLENAANELKLKQDEIVATITALEKSIATYKEEYATLIRETEQIKTESSKVKNKVDRSIALLDNLNSERGRWEQQSE 2094 (3245)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhccccHHHHHH
Q ss_pred HHHHHhhcchhHHHHHHHHHHhhCCCCHHHHHHHHHHHHHHhhhcCCcccCCCccccccCCHHHHHHHHhCCCCCCchhh
Q psy12680 2424 MLNEKYYQLTGDVLIAAGVVAYLGPFTVAFRQQQVSTWVKEVAACNIVCTKDFQLGAVMGNPVEIRAWNIFGLPCDSFSI 2503 (2567)
Q Consensus 2424 ~l~~~~~~l~GD~llaaa~isY~G~f~~~~R~~ll~~W~~~l~~~~I~~~~~f~l~~~L~~~~~i~~W~~~GLP~D~~Si 2503 (2567)
.|+.++.+|+||||||||||||+|||+++||+++++.|.+.|++.+||++++|++.++|+||+++++|+.+|||+|++|+
T Consensus 2095 ~l~~~~~~L~GD~LLaaafisY~G~f~~~~R~~l~~~W~~~l~~~~Ip~s~~~~l~~~L~~~~~i~~W~~~GLP~D~lSi 2174 (3245)
T 3vkg_A 2095 NFNTQMSTVVGDVVLASAFLAYIGFFDQNFRTDLMRKWMIRLDSVGIKFKSDLSVPSFLSKPEERLNWHANSLPSDELCI 2174 (3245)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHTGGGSCHHHHHHHHHHHHHHHHHHTCCCCTTCCHHHHTSCHHHHHHHHHTTCCSSHHHH
T ss_pred HHHHHHHhccHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHhcCCCCCCCCCHHHHcCCHHHHHHHHhCCCCCCchhh
Q ss_pred hhHHHhhcCCCcceeecCchhHHHHHHhhhccCCCeEEECCChhhHHHHHHHHhcCCceeccC
Q psy12680 2504 DNGIIIKNSRRWPLMIDPQEQANKWIKNMEKANGLNVIRLSNTDYMRILEGAIGFGFPAKKLN 2566 (2567)
Q Consensus 2504 ENaiIi~~s~r~PLlIDPq~Qa~~Wik~~~~~~~l~v~~~~~~~f~~~LE~ai~~G~p~~~~~ 2566 (2567)
|||||+++++|||||||||+||++||||++++++|+|++++|++|+++||+|||||+||-.-|
T Consensus 2175 ENaiiv~~~~R~PLlIDPq~Qa~~WIk~~~~~~~l~v~~~~d~~f~~~LE~ai~fG~pvLien 2237 (3245)
T 3vkg_A 2175 ENAIMLKRFNRYPLVIDPSGQAMEFLMNQYADKKITKTSFLDSSFMKNLESALRFGCPLLVQD 2237 (3245)
T ss_dssp HHHHHTTSCSSCEEEECTTSHHHHHHHHHTGGGCCCCCCC-----HHHHHHHHHHTCCEECCC
T ss_pred hHHHHHhcCCCceEEEChHHHHHHHHHHHhccCCceEeecCchhHHHHHHHHHHcCCeEEEcc
|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >2rr7_A Dynein heavy chain 9; microtubule-binding, stalk head, MTBD, antiparallel coil, motor protein, DSH; NMR {Chlamydomonas reinhardtii} | Back alignment and structure |
|---|
| >3err_A Fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA...; coiled coil, ligase; HET: AMP; 2.27A {Mus musculus} PDB: 3j1t_A 3j1u_A | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 2567 | |||
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 98.49 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.68 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 97.67 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 97.66 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.65 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 97.58 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.55 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 97.51 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 97.37 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 97.37 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 97.36 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 97.33 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 97.26 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 97.26 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 97.25 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 97.14 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 97.08 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 97.06 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 97.02 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 97.0 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 96.95 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 96.94 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.94 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 96.89 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.88 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 96.87 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 96.84 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 96.8 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 96.7 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 96.68 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 96.63 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 96.53 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 96.49 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 96.39 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 96.34 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.33 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 96.33 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 96.29 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 96.17 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 96.15 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 96.01 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 95.97 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 95.97 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 95.91 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 95.73 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 95.68 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 95.65 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 95.44 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 95.37 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 95.17 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 95.06 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 94.71 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 94.65 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 94.35 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 94.22 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 94.04 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 94.0 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 93.93 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 93.92 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 93.86 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 93.69 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 93.63 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 93.43 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 93.37 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 93.35 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 93.16 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 93.06 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 93.05 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 93.02 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 92.81 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 92.48 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 92.46 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 92.23 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 92.18 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 92.12 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 91.93 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 91.82 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 91.75 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 91.73 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 91.71 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 91.71 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 91.66 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 91.48 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 91.45 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 91.26 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 91.15 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 91.03 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 91.01 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 90.84 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 90.75 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 90.16 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 90.06 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 90.0 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 89.91 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 89.67 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 89.63 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 89.5 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 89.23 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 89.21 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 89.08 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 88.84 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 88.7 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 88.44 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 88.23 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 88.15 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 88.04 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 87.68 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 87.59 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 87.5 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 87.41 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 86.96 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 86.95 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 86.78 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 86.72 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 86.7 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 86.44 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 86.39 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 86.21 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 86.13 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 86.06 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 86.02 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 85.97 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 85.93 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 85.83 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 85.76 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 85.7 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 85.6 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 85.4 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 85.19 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 85.16 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 85.04 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 85.03 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 85.02 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 84.94 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 84.84 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 84.8 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 84.76 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 84.69 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 84.23 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 84.23 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 84.05 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 84.02 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 83.88 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 83.58 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 83.44 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 83.43 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 83.42 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 83.18 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 82.99 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 82.87 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 82.26 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 82.15 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 80.94 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 80.93 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 80.84 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 80.59 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 80.33 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 80.28 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 80.25 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 80.19 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 80.14 |
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: delta prime subunit of DNA polymerase III, N-domain species: Escherichia coli [TaxId: 562]
Probab=98.49 E-value=2.4e-08 Score=113.96 Aligned_cols=155 Identities=17% Similarity=0.130 Sum_probs=108.5
Q ss_pred hHHHHHHHHHHHHHHhceEEEEEccCCCChhHHHHHHHHHHHHHHHhcccCCccEEEEEeccCCCCcCcccccccCCCCC
Q psy12680 349 PFFLEKIQQIYEMMIVRWGFMIVGLSFAGKTCAYRMLSEALQLIEEWGELGEHKVEIIVINPKSITMGQLYGQFDAVSHE 428 (2567)
Q Consensus 349 ~~~i~Kv~QLye~~~~rhGvmlvGp~gsGKSt~~~~L~~Al~~l~~~~~~~~~~v~~~~inPKait~~eLyG~~d~~T~E 428 (2567)
....++..+.++.-+..|++++.||+|+||||+.+.+++++.--.. . + ...-....+.+.+..+.-.+.+.....+
T Consensus 8 ~~~~~~l~~~~~~~~l~h~lLl~Gp~G~GKtt~a~~~a~~l~~~~~--~-~-~~~~~~~~~~~~i~~~~~~~~~~~~~~~ 83 (207)
T d1a5ta2 8 RPDFEKLVASYQAGRGHHALLIQALPGMGDDALIYALSRYLLCQQP--Q-G-HKSCGHCRGCQLMQAGTHPDYYTLAPEK 83 (207)
T ss_dssp HHHHHHHHHHHHTTCCCSEEEEECCTTSCHHHHHHHHHHHHTCSSC--B-T-TBCCSCSHHHHHHHHTCCTTEEEECCCT
T ss_pred HHHHHHHHHHHHcCCcCeEEEEECCCCCcHHHHHHHHHHhcccccc--c-c-cccccccchhhhhhhccccccchhhhhh
Confidence 3456777888888888999999999999999999999998731100 0 0 0000011122333333444444445556
Q ss_pred CCcchHHHHHHHHHhc-----CCCCceEEEeCCCCCHHHHHHHHhhhcCCceeEecccceeecCCCCeEEEecCCcCcCC
Q psy12680 429 WSDGILAVSYRQFAMS-----QNENRKWLIFDGPVDAIWIENMNSVLDDNKKLCLMSGEIIALAPTTSLIFEPQDLEVAS 503 (2567)
Q Consensus 429 W~DGvls~i~R~~~~~-----~~~~~~WivfDGpVDa~WIEnLNSVLDDNK~LtL~nGErI~l~~~~~llFEv~dL~~AS 503 (2567)
+...+--..+|+.... ....+++||+| ++|..+.+..|++| |+|-= -|+++.|||-+.+++..-
T Consensus 84 ~~~~i~~~~ir~l~~~~~~~~~~~~~kviIid-e~d~l~~~a~n~Ll---k~lEe-------p~~~~~fIl~t~~~~~ll 152 (207)
T d1a5ta2 84 GKNTLGVDAVREVTEKLNEHARLGGAKVVWVT-DAALLTDAAANALL---KTLEE-------PPAETWFFLATREPERLL 152 (207)
T ss_dssp TCSSBCHHHHHHHHHHTTSCCTTSSCEEEEES-CGGGBCHHHHHHHH---HHHTS-------CCTTEEEEEEESCGGGSC
T ss_pred cccccccchhhHHhhhhhhccccCccceEEec-hhhhhhhhhhHHHH---HHHHh-------hcccceeeeeecChhhhh
Confidence 7777766666665432 23467899999 89999999999998 22221 267899999999999999
Q ss_pred cceeeeceeEEecCC
Q psy12680 504 PATVSRCGMIYMEPA 518 (2567)
Q Consensus 504 PATVSRcGmVy~~~~ 518 (2567)
|+-.|||-+|.|.+-
T Consensus 153 ~tI~SRc~~i~~~~~ 167 (207)
T d1a5ta2 153 ATLRSRCRLHYLAPP 167 (207)
T ss_dssp HHHHTTSEEEECCCC
T ss_pred hhhcceeEEEecCCC
Confidence 999999999999853
|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|