Psyllid ID: psy12688
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 222 | ||||||
| 270004815 | 588 | ftz transcription factor 1 [Tribolium ca | 0.540 | 0.204 | 0.725 | 5e-46 | |
| 189235773 | 540 | PREDICTED: similar to ecdysone response | 0.509 | 0.209 | 0.743 | 4e-44 | |
| 194326123 | 602 | nuclear receptor [Blattella germanica] | 0.5 | 0.184 | 0.725 | 4e-44 | |
| 328711947 | 666 | PREDICTED: nuclear hormone receptor FTZ- | 0.364 | 0.121 | 0.987 | 2e-43 | |
| 242019867 | 253 | steroidogenic factor, putative [Pediculu | 0.536 | 0.470 | 0.713 | 4e-43 | |
| 17979670 | 582 | nuclear hormone receptor betaFTZ-F1 [Man | 0.481 | 0.183 | 0.714 | 3e-42 | |
| 357614860 | 514 | nuclear hormone receptor betaFTZ-F1 [Dan | 0.486 | 0.210 | 0.7 | 1e-41 | |
| 341926128 | 541 | nuclear hormone receptor [Bombyx mori] | 0.504 | 0.207 | 0.68 | 1e-41 | |
| 5306097 | 545 | fushi tarazu-factor 1 [Metapenaeus ensis | 0.450 | 0.183 | 0.726 | 1e-41 | |
| 345494868 | 776 | PREDICTED: nuclear hormone receptor FTZ- | 0.378 | 0.108 | 0.886 | 3e-41 |
| >gi|270004815|gb|EFA01263.1| ftz transcription factor 1 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 189 bits (481), Expect = 5e-46, Method: Compositional matrix adjust.
Identities = 90/124 (72%), Positives = 99/124 (79%), Gaps = 4/124 (3%)
Query: 75 NFNNMVDNSYLFQSPGGGSTNMDLSSAGISYHPFHTSTIAATPEHPDTKEGIEELCPVCG 134
N NN+ D SY+F S + +D+ G SY +T + PDTK+GIEELCPVCG
Sbjct: 61 NMNNL-DASYIFSSGASAISGVDM---GASYQISGPATSLTAGDLPDTKDGIEELCPVCG 116
Query: 135 DKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPFCRFQKCLEVG 194
DKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCP+CRFQKCLEVG
Sbjct: 117 DKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPYCRFQKCLEVG 176
Query: 195 MKLE 198
MKLE
Sbjct: 177 MKLE 180
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|189235773|ref|XP_970369.2| PREDICTED: similar to ecdysone response nuclear receptor Ftz-F1 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|194326123|emb|CAQ57670.1| nuclear receptor [Blattella germanica] | Back alignment and taxonomy information |
|---|
| >gi|328711947|ref|XP_001945464.2| PREDICTED: nuclear hormone receptor FTZ-F1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|242019867|ref|XP_002430380.1| steroidogenic factor, putative [Pediculus humanus corporis] gi|212515504|gb|EEB17642.1| steroidogenic factor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|17979670|gb|AAL50351.1| nuclear hormone receptor betaFTZ-F1 [Manduca sexta] | Back alignment and taxonomy information |
|---|
| >gi|357614860|gb|EHJ69333.1| nuclear hormone receptor betaFTZ-F1 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|341926128|dbj|BAK53999.1| nuclear hormone receptor [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|5306097|gb|AAD41899.1| fushi tarazu-factor 1 [Metapenaeus ensis] | Back alignment and taxonomy information |
|---|
| >gi|345494868|ref|XP_001600363.2| PREDICTED: nuclear hormone receptor FTZ-F1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 222 | ||||||
| FB|FBgn0001078 | 1027 | ftz-f1 "ftz transcription fact | 0.5 | 0.108 | 0.724 | 1.3e-39 | |
| UNIPROTKB|F1NVB5 | 501 | NR5A2 "Nuclear receptor subfam | 0.337 | 0.149 | 0.84 | 7.4e-34 | |
| UNIPROTKB|O42101 | 501 | NR5A2 "Nuclear receptor subfam | 0.337 | 0.149 | 0.84 | 7.4e-34 | |
| UNIPROTKB|F1PXN4 | 519 | NR5A2 "Uncharacterized protein | 0.337 | 0.144 | 0.84 | 7.4e-34 | |
| UNIPROTKB|B4E2P3 | 469 | NR5A2 "cDNA FLJ52395, highly s | 0.337 | 0.159 | 0.84 | 7.4e-34 | |
| UNIPROTKB|F1MCM4 | 541 | NR5A2 "Uncharacterized protein | 0.337 | 0.138 | 0.84 | 9.4e-34 | |
| UNIPROTKB|O00482 | 541 | NR5A2 "Nuclear receptor subfam | 0.337 | 0.138 | 0.84 | 9.4e-34 | |
| ZFIN|ZDB-GENE-990415-79 | 517 | nr5a2 "nuclear receptor subfam | 0.337 | 0.145 | 0.826 | 1.5e-33 | |
| UNIPROTKB|H0Y328 | 377 | NR5A2 "Nuclear receptor subfam | 0.328 | 0.193 | 0.849 | 2e-33 | |
| UNIPROTKB|Q04752 | 461 | NR5A1 "Steroidogenic factor 1" | 0.337 | 0.162 | 0.84 | 2.5e-33 |
| FB|FBgn0001078 ftz-f1 "ftz transcription factor 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 422 (153.6 bits), Expect = 1.3e-39, Sum P(2) = 1.3e-39
Identities = 84/116 (72%), Positives = 88/116 (75%)
Query: 88 SPGGGSTNMDLSSAGISYHPFHT-STIAATPEHP----DTKEGIEELCPVCGDKVSGYHY 142
S G GS AG + P + +ATP H D K EELCPVCGDKVSGYHY
Sbjct: 461 SVGNGSGGAGNGGAGGNSGPGNPMGGTSATPGHGGEVIDFKHLFEELCPVCGDKVSGYHY 520
Query: 143 GLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPFCRFQKCLEVGMKLE 198
GLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCP+CRFQKCLEVGMKLE
Sbjct: 521 GLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPYCRFQKCLEVGMKLE 576
|
|
| UNIPROTKB|F1NVB5 NR5A2 "Nuclear receptor subfamily 5 group A member 2" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O42101 NR5A2 "Nuclear receptor subfamily 5 group A member 2" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PXN4 NR5A2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4E2P3 NR5A2 "cDNA FLJ52395, highly similar to Orphan nuclear receptor NR5A2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MCM4 NR5A2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O00482 NR5A2 "Nuclear receptor subfamily 5 group A member 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-990415-79 nr5a2 "nuclear receptor subfamily 5, group A, member 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0Y328 NR5A2 "Nuclear receptor subfamily 5 group A member 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q04752 NR5A1 "Steroidogenic factor 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 222 | |||
| cd07167 | 93 | cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain | 2e-51 | |
| cd06916 | 72 | cd06916, NR_DBD_like, DNA-binding domain of nuclea | 3e-41 | |
| pfam00105 | 70 | pfam00105, zf-C4, Zinc finger, C4 type (two domain | 3e-40 | |
| cd07168 | 90 | cd07168, NR_DBD_DHR4_like, DNA-binding domain of e | 2e-35 | |
| cd06969 | 75 | cd06969, NR_DBD_NGFI-B, DNA-binding domain of the | 4e-35 | |
| smart00399 | 70 | smart00399, ZnF_C4, c4 zinc finger in nuclear horm | 6e-34 | |
| cd07169 | 90 | cd07169, NR_DBD_GCNF_like, DNA-binding domain of G | 8e-32 | |
| cd06961 | 85 | cd06961, NR_DBD_TR, DNA-binding domain of thyroid | 9e-32 | |
| cd06960 | 76 | cd06960, NR_DBD_HNF4A, DNA-binding domain of hepto | 2e-31 | |
| cd07156 | 72 | cd07156, NR_DBD_VDR_like, The DNA-binding domain o | 9e-31 | |
| cd06967 | 87 | cd06967, NR_DBD_TR2_like, DNA-binding domain of th | 2e-30 | |
| cd06956 | 77 | cd06956, NR_DBD_RXR, DNA-binding domain of retinoi | 1e-29 | |
| cd07165 | 81 | cd07165, NR_DBD_DmE78_like, DNA-binding domain of | 5e-29 | |
| cd07161 | 91 | cd07161, NR_DBD_EcR, DNA-binding domain of Ecdyson | 2e-28 | |
| cd07155 | 75 | cd07155, NR_DBD_ER_like, DNA-binding domain of est | 4e-27 | |
| cd06964 | 85 | cd06964, NR_DBD_RAR, DNA-binding domain of retinoi | 4e-27 | |
| cd07170 | 97 | cd07170, NR_DBD_ERR, DNA-binding domain of estroge | 6e-27 | |
| cd06968 | 95 | cd06968, NR_DBD_ROR, DNA-binding domain of Retinoi | 3e-26 | |
| cd06959 | 73 | cd06959, NR_DBD_EcR_like, The DNA-binding domain o | 6e-26 | |
| cd07166 | 89 | cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV | 1e-25 | |
| cd07172 | 78 | cd07172, NR_DBD_GR_PR, DNA-binding domain of gluco | 3e-25 | |
| cd07171 | 82 | cd07171, NR_DBD_ER, DNA-binding domain of estrogen | 3e-25 | |
| cd06965 | 84 | cd06965, NR_DBD_Ppar, DNA-binding domain of peroxi | 5e-25 | |
| cd07158 | 73 | cd07158, NR_DBD_Ppar_like, The DNA-binding domain | 1e-24 | |
| cd07164 | 78 | cd07164, NR_DBD_PNR_like_1, DNA-binding domain of | 3e-24 | |
| cd07179 | 74 | cd07179, 2DBD_NR_DBD2, The second DNA-binding doma | 3e-24 | |
| cd06958 | 73 | cd06958, NR_DBD_COUP_TF, DNA-binding domain of chi | 3e-24 | |
| cd06963 | 73 | cd06963, NR_DBD_GR_like, The DNA binding domain of | 4e-24 | |
| cd07154 | 73 | cd07154, NR_DBD_PNR_like, The DNA-binding domain o | 7e-24 | |
| cd06962 | 84 | cd06962, NR_DBD_FXR, DNA-binding domain of Farneso | 2e-23 | |
| cd06957 | 82 | cd06957, NR_DBD_PNR_like_2, DNA-binding domain of | 3e-23 | |
| cd07173 | 82 | cd07173, NR_DBD_AR, DNA-binding domain of androgen | 4e-23 | |
| cd06955 | 107 | cd06955, NR_DBD_VDR, DNA-binding domain of vitamin | 8e-23 | |
| cd07160 | 101 | cd07160, NR_DBD_LXR, DNA-binding domain of Liver X | 3e-22 | |
| cd07162 | 87 | cd07162, NR_DBD_PXR, DNA-binding domain of pregnan | 4e-22 | |
| cd07163 | 92 | cd07163, NR_DBD_TLX, DNA-binding domain of Tailles | 6e-22 | |
| cd06966 | 94 | cd06966, NR_DBD_CAR, DNA-binding domain of constit | 1e-21 | |
| cd06970 | 92 | cd06970, NR_DBD_PNR, DNA-binding domain of the pho | 2e-19 | |
| cd07157 | 86 | cd07157, 2DBD_NR_DBD1, The first DNA-binding domai | 2e-18 |
| >gnl|CDD|143541 cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
Score = 161 bits (408), Expect = 2e-51
Identities = 60/69 (86%), Positives = 64/69 (92%)
Query: 130 CPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPFCRFQK 189
CPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKK YTC+ ++C IDKTQRKRCP+CRFQK
Sbjct: 1 CPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKRYTCIENQNCQIDKTQRKRCPYCRFQK 60
Query: 190 CLEVGMKLE 198
CL VGMKLE
Sbjct: 61 CLSVGMKLE 69
|
The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This nuclear receptor family includes at least three subgroups of receptors that function in embryo development and differentiation, and other processes. FTZ-F1 interacts with the cis-acting DNA motif of ftz gene, which is required at several stages of development. Particularly, FTZ-F1 regulated genes are strongly linked to steroid biosynthesis and sex-determination; LRH-1 is a regulator of bile-acid homeostasis, steroidogenesis, reverse cholesterol transport and the initial stages of embryonic development; SF-1 is an essential regulator of endocrine development and function and is considered a master regulator of reproduction; SF-1 functions cooperatively with other transcription factors to modulate gene expression. Phospholipids have been identified as potential ligand for LRH-1 and steroidogenic factor-1 (SF-1). However, the ligand for FTZ-F1 has not yet been identified. Most nuclear receptors function as homodimer or heterodimers. However, LRH-1 and SF-1 bind to DNA as monomers. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, receptors in this family have a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD). Length = 93 |
| >gnl|CDD|143512 cd06916, NR_DBD_like, DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|201004 pfam00105, zf-C4, Zinc finger, C4 type (two domains) | Back alignment and domain information |
|---|
| >gnl|CDD|143542 cd07168, NR_DBD_DHR4_like, DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143527 cd06969, NR_DBD_NGFI-B, DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B | Back alignment and domain information |
|---|
| >gnl|CDD|197701 smart00399, ZnF_C4, c4 zinc finger in nuclear hormone receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143543 cd07169, NR_DBD_GCNF_like, DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143519 cd06961, NR_DBD_TR, DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143518 cd06960, NR_DBD_HNF4A, DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143531 cd07156, NR_DBD_VDR_like, The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143525 cd06967, NR_DBD_TR2_like, DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143514 cd06956, NR_DBD_RXR, DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143539 cd07165, NR_DBD_DmE78_like, DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143535 cd07161, NR_DBD_EcR, DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143530 cd07155, NR_DBD_ER_like, DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143522 cd06964, NR_DBD_RAR, DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143544 cd07170, NR_DBD_ERR, DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143526 cd06968, NR_DBD_ROR, DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143517 cd06959, NR_DBD_EcR_like, The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143540 cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143546 cd07172, NR_DBD_GR_PR, DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143545 cd07171, NR_DBD_ER, DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143523 cd06965, NR_DBD_Ppar, DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143533 cd07158, NR_DBD_Ppar_like, The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family | Back alignment and domain information |
|---|
| >gnl|CDD|143538 cd07164, NR_DBD_PNR_like_1, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143548 cd07179, 2DBD_NR_DBD2, The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143516 cd06958, NR_DBD_COUP_TF, DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143521 cd06963, NR_DBD_GR_like, The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143529 cd07154, NR_DBD_PNR_like, The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family | Back alignment and domain information |
|---|
| >gnl|CDD|143520 cd06962, NR_DBD_FXR, DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143515 cd06957, NR_DBD_PNR_like_2, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143547 cd07173, NR_DBD_AR, DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143513 cd06955, NR_DBD_VDR, DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143534 cd07160, NR_DBD_LXR, DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143536 cd07162, NR_DBD_PXR, DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143537 cd07163, NR_DBD_TLX, DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143524 cd06966, NR_DBD_CAR, DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143528 cd06970, NR_DBD_PNR, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|143532 cd07157, 2DBD_NR_DBD1, The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| KOG4215|consensus | 432 | 99.96 | ||
| cd06956 | 77 | NR_DBD_RXR DNA-binding domain of retinoid X recept | 99.94 | |
| cd07171 | 82 | NR_DBD_ER DNA-binding domain of estrogen receptors | 99.94 | |
| cd07160 | 101 | NR_DBD_LXR DNA-binding domain of Liver X receptors | 99.94 | |
| cd07155 | 75 | NR_DBD_ER_like DNA-binding domain of estrogen rece | 99.94 | |
| cd06961 | 85 | NR_DBD_TR DNA-binding domain of thyroid hormone re | 99.93 | |
| cd07170 | 97 | NR_DBD_ERR DNA-binding domain of estrogen related | 99.93 | |
| cd06964 | 85 | NR_DBD_RAR DNA-binding domain of retinoic acid rec | 99.93 | |
| KOG4846|consensus | 538 | 99.93 | ||
| cd06967 | 87 | NR_DBD_TR2_like DNA-binding domain of the TR2 and | 99.93 | |
| cd07164 | 78 | NR_DBD_PNR_like_1 DNA-binding domain of the photor | 99.93 | |
| cd07161 | 91 | NR_DBD_EcR DNA-binding domain of Ecdysone receptor | 99.93 | |
| cd07168 | 90 | NR_DBD_DHR4_like DNA-binding domain of ecdysone-in | 99.93 | |
| cd06970 | 92 | NR_DBD_PNR DNA-binding domain of the photoreceptor | 99.93 | |
| cd06960 | 76 | NR_DBD_HNF4A DNA-binding domain of heptocyte nucle | 99.93 | |
| cd07179 | 74 | 2DBD_NR_DBD2 The second DNA-binding domain (DBD) o | 99.93 | |
| cd07173 | 82 | NR_DBD_AR DNA-binding domain of androgen receptor | 99.93 | |
| cd06959 | 73 | NR_DBD_EcR_like The DNA-binding domain of Ecdysone | 99.93 | |
| cd07163 | 92 | NR_DBD_TLX DNA-binding domain of Tailless (TLX) is | 99.93 | |
| cd06962 | 84 | NR_DBD_FXR DNA-binding domain of Farnesoid X recep | 99.93 | |
| KOG4217|consensus | 605 | 99.93 | ||
| cd07156 | 72 | NR_DBD_VDR_like The DNA-binding domain of vitamin | 99.93 | |
| cd07172 | 78 | NR_DBD_GR_PR DNA-binding domain of glucocorticoid | 99.93 | |
| cd06963 | 73 | NR_DBD_GR_like The DNA binding domain of GR_like n | 99.92 | |
| cd06969 | 75 | NR_DBD_NGFI-B DNA-binding domain of the orphan nuc | 99.92 | |
| cd07169 | 90 | NR_DBD_GCNF_like DNA-binding domain of Germ cell n | 99.92 | |
| cd06958 | 73 | NR_DBD_COUP_TF DNA-binding domain of chicken ovalb | 99.92 | |
| cd07158 | 73 | NR_DBD_Ppar_like The DNA-binding domain of peroxis | 99.92 | |
| cd07165 | 81 | NR_DBD_DmE78_like DNA-binding domain of Drosophila | 99.92 | |
| cd07162 | 87 | NR_DBD_PXR DNA-binding domain of pregnane X recept | 99.92 | |
| cd06957 | 82 | NR_DBD_PNR_like_2 DNA-binding domain of the photor | 99.92 | |
| cd07167 | 93 | NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 | 99.92 | |
| cd07166 | 89 | NR_DBD_REV_ERB DNA-binding domain of REV-ERB recep | 99.92 | |
| cd06966 | 94 | NR_DBD_CAR DNA-binding domain of constitutive andr | 99.92 | |
| cd07154 | 73 | NR_DBD_PNR_like The DNA-binding domain of the phot | 99.92 | |
| cd07157 | 86 | 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of | 99.92 | |
| cd06916 | 72 | NR_DBD_like DNA-binding domain of nuclear receptor | 99.92 | |
| cd06968 | 95 | NR_DBD_ROR DNA-binding domain of Retinoid-related | 99.92 | |
| cd06955 | 107 | NR_DBD_VDR DNA-binding domain of vitamin D recepto | 99.92 | |
| cd06965 | 84 | NR_DBD_Ppar DNA-binding domain of peroxisome proli | 99.91 | |
| smart00399 | 70 | ZnF_C4 c4 zinc finger in nuclear hormone receptors | 99.9 | |
| PF00105 | 70 | zf-C4: Zinc finger, C4 type (two domains); InterPr | 99.9 | |
| KOG4216|consensus | 479 | 99.9 | ||
| KOG4218|consensus | 475 | 99.9 |
| >KOG4215|consensus | Back alignment and domain information |
|---|
Probab=99.96 E-value=7.3e-30 Score=235.12 Aligned_cols=87 Identities=43% Similarity=1.018 Sum_probs=83.0
Q ss_pred CCCccccccCCCCcceeeccccchhhhHHHHhHhhcCceeccccCcccccCCCCCCCCcchHhHHHHHhcCCccccccCC
Q psy12688 125 GIEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPFCRFQKCLEVGMKLEVSSQST 204 (222)
Q Consensus 125 ~~~~~C~VCGd~asg~HYGV~sCeaCk~FFRRtv~~~~~~~C~~~~~C~i~~~~R~~Cr~CRl~KCLevGM~~eaVr~~r 204 (222)
...+.|.||||+++|.|||+.+|.|||+||||+|.++..|.|+++.+|.|+|++|+.||||||+||+.+||++||||++|
T Consensus 17 ~~~~~CaICGDkaTGKHYGA~SCdGCKGFFRRSVrk~~~YtCRF~k~C~VDKdkRNaCRyCRfqKC~~aGMK~eAiQnER 96 (432)
T KOG4215|consen 17 GVAEFCAICGDKATGKHYGAISCDGCKGFFRRSVRKNHQYTCRFNKQCVVDKDKRNACRYCRFQKCVRAGMKREAIQNER 96 (432)
T ss_pred cccchhheeCCcccccccceeecCcchHHHHHHHHhcceeeeeccccccccchhhhhhhHhhHHHHHHhcccHHhhhccc
Confidence 44678999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCcceec
Q psy12688 205 HGVVVIW 211 (222)
Q Consensus 205 ~g~~~~~ 211 (222)
|.+..-.
T Consensus 97 DrIg~Rr 103 (432)
T KOG4215|consen 97 DRIGSRR 103 (432)
T ss_pred ccccccC
Confidence 9998733
|
|
| >cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06961 NR_DBD_TR DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06964 NR_DBD_RAR DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >KOG4846|consensus | Back alignment and domain information |
|---|
| >cd06967 NR_DBD_TR2_like DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07164 NR_DBD_PNR_like_1 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07161 NR_DBD_EcR DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06970 NR_DBD_PNR DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06960 NR_DBD_HNF4A DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07179 2DBD_NR_DBD2 The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06959 NR_DBD_EcR_like The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07163 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06962 NR_DBD_FXR DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >KOG4217|consensus | Back alignment and domain information |
|---|
| >cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06963 NR_DBD_GR_like The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06969 NR_DBD_NGFI-B DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B | Back alignment and domain information |
|---|
| >cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06958 NR_DBD_COUP_TF DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family | Back alignment and domain information |
|---|
| >cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06957 NR_DBD_PNR_like_2 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07167 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07154 NR_DBD_PNR_like The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family | Back alignment and domain information |
|---|
| >cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06916 NR_DBD_like DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors | Back alignment and domain information |
|---|
| >PF00105 zf-C4: Zinc finger, C4 type (two domains); InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis | Back alignment and domain information |
|---|
| >KOG4216|consensus | Back alignment and domain information |
|---|
| >KOG4218|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 222 | ||||
| 2a66_A | 113 | Human Liver Receptor Homologue Dna-Binding Domain ( | 2e-34 | ||
| 2ff0_A | 102 | Solution Structure Of Steroidogenic Factor 1 Dna Bi | 5e-33 | ||
| 3dzu_A | 467 | Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp | 3e-23 | ||
| 2han_A | 93 | Structural Basis Of Heterodimeric Ecdysteroid Recep | 2e-22 | ||
| 1r0o_A | 86 | Crystal Structure Of The Heterodimeric Ecdysone Rec | 2e-21 | ||
| 1ynw_B | 99 | Crystal Structure Of Vitamin D Receptor And 9-Cis R | 2e-21 | ||
| 1r0n_A | 81 | Crystal Structure Of Heterodimeric Ecdsyone Recepto | 6e-21 | ||
| 1dsz_B | 85 | Structure Of The RxrRAR DNA-Binding Domain Heterodi | 9e-21 | ||
| 1by4_A | 82 | Structure And Mechanism Of The Homodimeric Assembly | 1e-20 | ||
| 1cit_A | 89 | Dna-Binding Mechanism Of The Monomeric Orphan Nucle | 2e-20 | ||
| 1rxr_A | 83 | High Resolution Solution Structure Of The Retinoid | 8e-20 | ||
| 2nll_A | 66 | Retinoid X Receptor-Thyroid Hormone Receptor Dna-Bi | 8e-20 | ||
| 2han_B | 119 | Structural Basis Of Heterodimeric Ecdysteroid Recep | 1e-19 | ||
| 1r0n_B | 109 | Crystal Structure Of Heterodimeric Ecdsyone Recepto | 2e-19 | ||
| 2ebl_A | 89 | Solution Structure Of The Zinc Finger, C4-type Doma | 3e-19 | ||
| 4hn5_A | 117 | Gr Dna Binding Domain - Tslp Ngre Complex Length = | 4e-19 | ||
| 4hn6_A | 114 | Gr Dna Binding Domain R460d/d462r - Tslp Ngre Compl | 5e-19 | ||
| 1dsz_A | 86 | Structure Of The RxrRAR DNA-Binding Domain Heterodi | 6e-19 | ||
| 2gda_A | 72 | Refined Solution Structure Of The Glucocorticoid Re | 7e-19 | ||
| 1gdc_A | 72 | Refined Solution Structure Of The Glucocorticoid Re | 1e-18 | ||
| 1hra_A | 80 | The Solution Structure Of The Human Retinoic Acid R | 1e-18 | ||
| 1rgd_A | 71 | Structure Refinement Of The Glucocorticoid Receptor | 3e-18 | ||
| 3g9p_B | 90 | Gr Dna Binding Domain:sgk 16bp Complex-7 Length = 9 | 3e-18 | ||
| 3dzu_D | 419 | Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp | 4e-18 | ||
| 1lat_A | 82 | Glucocorticoid Receptor MutantDNA COMPLEX Length = | 5e-18 | ||
| 2env_A | 88 | Solution Sturcture Of The C4-Type Zinc Finger Domai | 7e-18 | ||
| 1r4i_A | 105 | Crystal Structure Of Androgen Receptor Dna-Binding | 7e-18 | ||
| 1r4o_A | 92 | Crystallographic Analysis Of The Interaction Of The | 8e-18 | ||
| 3m9e_A | 105 | Thyroid Hormone Beta Dna Binding Domain Homodimer W | 9e-18 | ||
| 1r4r_B | 92 | Crystallographic Analysis Of The Interaction Of The | 9e-18 | ||
| 1glu_A | 81 | Crystallographic Analysis Of The Interaction Of The | 1e-17 | ||
| 1lo1_A | 98 | Estrogen Related Receptor 2 Dna Binding Domain In C | 2e-17 | ||
| 3g6t_A | 91 | Gr Gamma Dna-Binding Domain:fkbp5 16bp Complex-34 L | 3e-17 | ||
| 2nll_B | 103 | Retinoid X Receptor-Thyroid Hormone Receptor Dna-Bi | 3e-17 | ||
| 3cbb_A | 78 | Crystal Structure Of Hepatocyte Nuclear Factor 4alp | 4e-17 | ||
| 1ynw_A | 110 | Crystal Structure Of Vitamin D Receptor And 9-Cis R | 8e-17 | ||
| 1hlz_A | 94 | Crystal Structure Of The Orphan Nuclear Receptor Re | 8e-17 | ||
| 1hcp_A | 76 | Dna Recognition By The Oestrogen Receptor: From Sol | 1e-16 | ||
| 1hcq_A | 84 | The Crystal Structure Of The Estrogen Receptor Dna- | 1e-16 | ||
| 4aa6_E | 71 | The Oestrogen Receptor Recognizes An Imperfectly Pa | 1e-16 | ||
| 4aa6_A | 71 | The Oestrogen Receptor Recognizes An Imperfectly Pa | 1e-16 | ||
| 2c7a_A | 78 | Structure Of The Progesterone Receptor-Dna Complex | 3e-16 | ||
| 1kb2_A | 110 | Crystal Structure Of Vdr Dna-Binding Domain Bound T | 2e-15 |
| >pdb|2A66|A Chain A, Human Liver Receptor Homologue Dna-Binding Domain (Hlrh-1 Dbd) In Complex With Dsdna From The Hcyp7a1 Promoter Length = 113 | Back alignment and structure |
|
| >pdb|2FF0|A Chain A, Solution Structure Of Steroidogenic Factor 1 Dna Binding Domain Bound To Its Target Sequence In The Inhibin Alpha- Subunit Promoter Length = 102 | Back alignment and structure |
| >pdb|3DZU|A Chain A, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 467 | Back alignment and structure |
| >pdb|2HAN|A Chain A, Structural Basis Of Heterodimeric Ecdysteroid Receptor Interaction With Natural Response Element Hsp27 Gene Promoter Length = 93 | Back alignment and structure |
| >pdb|1R0O|A Chain A, Crystal Structure Of The Heterodimeric Ecdysone Receptor Dna-Binding Complex Length = 86 | Back alignment and structure |
| >pdb|1YNW|B Chain B, Crystal Structure Of Vitamin D Receptor And 9-Cis Retinoic Acid Receptor Dna-Binding Domains Bound To A Dr3 Response Element Length = 99 | Back alignment and structure |
| >pdb|1R0N|A Chain A, Crystal Structure Of Heterodimeric Ecdsyone Receptor Dna Binding Complex Length = 81 | Back alignment and structure |
| >pdb|1DSZ|B Chain B, Structure Of The RxrRAR DNA-Binding Domain Heterodimer In Complex With The Retinoic Acid Response Element Dr1 Length = 85 | Back alignment and structure |
| >pdb|1BY4|A Chain A, Structure And Mechanism Of The Homodimeric Assembly Of The Rxr On Dna Length = 82 | Back alignment and structure |
| >pdb|1CIT|A Chain A, Dna-Binding Mechanism Of The Monomeric Orphan Nuclear Receptor Ngfi-B Length = 89 | Back alignment and structure |
| >pdb|1RXR|A Chain A, High Resolution Solution Structure Of The Retinoid X Receptor Dna Binding Domain, Nmr, 20 Structure Length = 83 | Back alignment and structure |
| >pdb|2NLL|A Chain A, Retinoid X Receptor-Thyroid Hormone Receptor Dna-Binding Domain Heterodimer Bound To Thyroid Response Element Dna Length = 66 | Back alignment and structure |
| >pdb|2HAN|B Chain B, Structural Basis Of Heterodimeric Ecdysteroid Receptor Interaction With Natural Response Element Hsp27 Gene Promoter Length = 119 | Back alignment and structure |
| >pdb|1R0N|B Chain B, Crystal Structure Of Heterodimeric Ecdsyone Receptor Dna Binding Complex Length = 109 | Back alignment and structure |
| >pdb|2EBL|A Chain A, Solution Structure Of The Zinc Finger, C4-type Domain Of Human Coup Transcription Factor 1 Length = 89 | Back alignment and structure |
| >pdb|4HN5|A Chain A, Gr Dna Binding Domain - Tslp Ngre Complex Length = 117 | Back alignment and structure |
| >pdb|4HN6|A Chain A, Gr Dna Binding Domain R460d/d462r - Tslp Ngre Complex Length = 114 | Back alignment and structure |
| >pdb|1DSZ|A Chain A, Structure Of The RxrRAR DNA-Binding Domain Heterodimer In Complex With The Retinoic Acid Response Element Dr1 Length = 86 | Back alignment and structure |
| >pdb|2GDA|A Chain A, Refined Solution Structure Of The Glucocorticoid Receptor Dna-Binding Domain Length = 72 | Back alignment and structure |
| >pdb|1GDC|A Chain A, Refined Solution Structure Of The Glucocorticoid Receptor Dna-Binding Domain Length = 72 | Back alignment and structure |
| >pdb|1HRA|A Chain A, The Solution Structure Of The Human Retinoic Acid Receptor- Beta Dna-Binding Domain Length = 80 | Back alignment and structure |
| >pdb|1RGD|A Chain A, Structure Refinement Of The Glucocorticoid Receptor-Dna Binding Domain From Nmr Data By Relaxation Matrix Calculations Length = 71 | Back alignment and structure |
| >pdb|3G9P|B Chain B, Gr Dna Binding Domain:sgk 16bp Complex-7 Length = 90 | Back alignment and structure |
| >pdb|3DZU|D Chain D, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 419 | Back alignment and structure |
| >pdb|1LAT|A Chain A, Glucocorticoid Receptor MutantDNA COMPLEX Length = 82 | Back alignment and structure |
| >pdb|2ENV|A Chain A, Solution Sturcture Of The C4-Type Zinc Finger Domain From Human Peroxisome Proliferator-Activated Receptor Delta Length = 88 | Back alignment and structure |
| >pdb|1R4I|A Chain A, Crystal Structure Of Androgen Receptor Dna-Binding Domain Bound To A Direct Repeat Response Element Length = 105 | Back alignment and structure |
| >pdb|1R4O|A Chain A, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 92 | Back alignment and structure |
| >pdb|3M9E|A Chain A, Thyroid Hormone Beta Dna Binding Domain Homodimer With Inverted Palindrome Tre Length = 105 | Back alignment and structure |
| >pdb|1R4R|B Chain B, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 92 | Back alignment and structure |
| >pdb|1GLU|A Chain A, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 81 | Back alignment and structure |
| >pdb|1LO1|A Chain A, Estrogen Related Receptor 2 Dna Binding Domain In Complex With Dna Length = 98 | Back alignment and structure |
| >pdb|3G6T|A Chain A, Gr Gamma Dna-Binding Domain:fkbp5 16bp Complex-34 Length = 91 | Back alignment and structure |
| >pdb|2NLL|B Chain B, Retinoid X Receptor-Thyroid Hormone Receptor Dna-Binding Domain Heterodimer Bound To Thyroid Response Element Dna Length = 103 | Back alignment and structure |
| >pdb|3CBB|A Chain A, Crystal Structure Of Hepatocyte Nuclear Factor 4alpha In Complex With Dna: Diabetes Gene Product Length = 78 | Back alignment and structure |
| >pdb|1YNW|A Chain A, Crystal Structure Of Vitamin D Receptor And 9-Cis Retinoic Acid Receptor Dna-Binding Domains Bound To A Dr3 Response Element Length = 110 | Back alignment and structure |
| >pdb|1HLZ|A Chain A, Crystal Structure Of The Orphan Nuclear Receptor Rev- Erb(Alpha) Dna-Binding Domain Bound To Its Cognate Response Element Length = 94 | Back alignment and structure |
| >pdb|1HCP|A Chain A, Dna Recognition By The Oestrogen Receptor: From Solution To The Crystal Length = 76 | Back alignment and structure |
| >pdb|1HCQ|A Chain A, The Crystal Structure Of The Estrogen Receptor Dna-Binding Domain Bound To Dna: How Receptors Discriminate Between Their Response Elements Length = 84 | Back alignment and structure |
| >pdb|4AA6|E Chain E, The Oestrogen Receptor Recognizes An Imperfectly Palindromic Response Element Through An Alternative Side- Chain Conformation Length = 71 | Back alignment and structure |
| >pdb|4AA6|A Chain A, The Oestrogen Receptor Recognizes An Imperfectly Palindromic Response Element Through An Alternative Side- Chain Conformation Length = 71 | Back alignment and structure |
| >pdb|2C7A|A Chain A, Structure Of The Progesterone Receptor-Dna Complex Length = 78 | Back alignment and structure |
| >pdb|1KB2|A Chain A, Crystal Structure Of Vdr Dna-Binding Domain Bound To Mouse Osteopontin (Spp) Response Element Length = 110 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 222 | |||
| 2a66_A | 113 | Orphan nuclear receptor NR5A2; protein-DNA complex | 6e-49 | |
| 1lo1_A | 98 | Steroid hormone receptor ERR2; estrogen related re | 8e-45 | |
| 1dsz_B | 85 | RXR-alpha, retinoic acid receptor RXR-alpha; RAR, | 3e-44 | |
| 1cit_A | 89 | NGFI-B, protein (orphan nuclear receptor NGFI-B); | 3e-44 | |
| 1hcq_A | 84 | Protein (estrogen receptor); protein-DNA complex, | 3e-44 | |
| 1dsz_A | 86 | RAR-alpha, retinoic acid receptor alpha; RAR, nucl | 4e-44 | |
| 3g9m_A | 90 | Glucocorticoid receptor; glucocorticoid, DNA-bindi | 5e-44 | |
| 2han_A | 93 | Protein ultraspiracle; transcription regulation, t | 6e-44 | |
| 1r4i_A | 105 | Androgen receptor; AR, steroid receptor, protein-D | 1e-43 | |
| 1kb2_A | 110 | Vitamin D3 receptor; VDR, nuclear receptor, protei | 2e-43 | |
| 1ynw_B | 99 | Retinoic acid receptor RXR-alpha, retinoid X recep | 8e-43 | |
| 2han_B | 119 | Ecdysone receptor; transcription regulation, trans | 2e-42 | |
| 2ebl_A | 89 | COUP transcription factor 1; DNA-binding, metal-bi | 2e-42 | |
| 2nll_B | 103 | Protein (thyroid hormone receptor); complex (trans | 4e-42 | |
| 1a6y_A | 94 | Orphan nuclear receptor NR1D1; orphan receptor, DN | 8e-42 | |
| 3cbb_A | 78 | HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN | 1e-41 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 1e-37 | |
| 3dzy_D | 419 | Peroxisome proliferator-activated receptor gamma; | 1e-31 | |
| 3k1f_M | 197 | Transcription initiation factor IIB; RNA polymeras | 8e-04 |
| >2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A Length = 113 | Back alignment and structure |
|---|
Score = 154 bits (392), Expect = 6e-49
Identities = 63/78 (80%), Positives = 68/78 (87%)
Query: 121 DTKEGIEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRK 180
E +EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN K YTC+ ++C IDKTQRK
Sbjct: 3 FGDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRK 62
Query: 181 RCPFCRFQKCLEVGMKLE 198
RCP+CRFQKCL VGMKLE
Sbjct: 63 RCPYCRFQKCLSVGMKLE 80
|
| >1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 Length = 98 | Back alignment and structure |
|---|
| >1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* Length = 85 | Back alignment and structure |
|---|
| >1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 Length = 89 | Back alignment and structure |
|---|
| >1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A Length = 84 | Back alignment and structure |
|---|
| >1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A Length = 86 | Back alignment and structure |
|---|
| >3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... Length = 90 | Back alignment and structure |
|---|
| >2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 Length = 93 | Back alignment and structure |
|---|
| >1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 Length = 105 | Back alignment and structure |
|---|
| >1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A Length = 110 | Back alignment and structure |
|---|
| >1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 Length = 99 | Back alignment and structure |
|---|
| >2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B Length = 119 | Back alignment and structure |
|---|
| >2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* Length = 103 | Back alignment and structure |
|---|
| >1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A Length = 94 | Back alignment and structure |
|---|
| >3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Length = 419 | Back alignment and structure |
|---|
| >3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| 3cbb_A | 78 | HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN | 99.96 | |
| 2ebl_A | 89 | COUP transcription factor 1; DNA-binding, metal-bi | 99.96 | |
| 1hcq_A | 84 | Protein (estrogen receptor); protein-DNA complex, | 99.96 | |
| 2han_A | 93 | Protein ultraspiracle; transcription regulation, t | 99.96 | |
| 1dsz_B | 85 | RXR-alpha, retinoic acid receptor RXR-alpha; RAR, | 99.96 | |
| 1dsz_A | 86 | RAR-alpha, retinoic acid receptor alpha; RAR, nucl | 99.96 | |
| 1cit_A | 89 | NGFI-B, protein (orphan nuclear receptor NGFI-B); | 99.96 | |
| 1ynw_B | 99 | Retinoic acid receptor RXR-alpha, retinoid X recep | 99.95 | |
| 4hn5_A | 117 | Glucocorticoid receptor; glucocorticoid receptor, | 99.95 | |
| 3g9m_A | 90 | Glucocorticoid receptor; glucocorticoid, DNA-bindi | 99.95 | |
| 1a6y_A | 94 | Orphan nuclear receptor NR1D1; orphan receptor, DN | 99.95 | |
| 2a66_A | 113 | Orphan nuclear receptor NR5A2; protein-DNA complex | 99.95 | |
| 1lo1_A | 98 | Steroid hormone receptor ERR2; estrogen related re | 99.95 | |
| 2han_B | 119 | Ecdysone receptor; transcription regulation, trans | 99.95 | |
| 1kb2_A | 110 | Vitamin D3 receptor; VDR, nuclear receptor, protei | 99.95 | |
| 2nll_B | 103 | Protein (thyroid hormone receptor); complex (trans | 99.94 | |
| 1r4i_A | 105 | Androgen receptor; AR, steroid receptor, protein-D | 99.94 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 99.92 | |
| 3dzy_D | 419 | Peroxisome proliferator-activated receptor gamma; | 99.91 | |
| 2lze_A | 87 | A primordial catalytic fold generated by in vitro | 99.67 |
| >3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.96 E-value=2.2e-30 Score=192.33 Aligned_cols=77 Identities=43% Similarity=1.106 Sum_probs=73.3
Q ss_pred cccccCCCCcceeeccccchhhhHHHHhHhhcCceeccccCcccccCCCCCCCCcchHhHHHHHhcCCccccccCCC
Q psy12688 129 LCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPFCRFQKCLEVGMKLEVSSQSTH 205 (222)
Q Consensus 129 ~C~VCGd~asg~HYGV~sCeaCk~FFRRtv~~~~~~~C~~~~~C~i~~~~R~~Cr~CRl~KCLevGM~~eaVr~~r~ 205 (222)
+|.||||+++|+||||.+|+||++||||++..+..|.|+.+++|.|++..|+.|++|||+|||++||++++||.+||
T Consensus 2 ~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~y~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~vq~~Rd 78 (78)
T 3cbb_A 2 LCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERD 78 (78)
T ss_dssp BCTTTSSBCCSEETTEECCHHHHHHHHHHHHTTCCCCCSSCSCCCCSTTTTTTCHHHHHHHHHHHTCCGGGCCCC--
T ss_pred CCeEeCCCCCceEeCCcchhhhceeeeEEEecccCcccccccccCcCccccccChhhhhHHHhHcCCCHHHccccCC
Confidence 59999999999999999999999999999999999999999999999999999999999999999999999999986
|
| >2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A | Back alignment and structure |
|---|
| >2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* | Back alignment and structure |
|---|
| >1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A | Back alignment and structure |
|---|
| >1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >4hn5_A Glucocorticoid receptor; glucocorticoid receptor, steroid receptors, NGRE, repre transcription; HET: DNA; 1.90A {Homo sapiens} PDB: 4hn6_A* | Back alignment and structure |
|---|
| >3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} SCOP: g.39.1.2 PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... | Back alignment and structure |
|---|
| >1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A | Back alignment and structure |
|---|
| >2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A | Back alignment and structure |
|---|
| >1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B | Back alignment and structure |
|---|
| >1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A | Back alignment and structure |
|---|
| >2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* | Back alignment and structure |
|---|
| >1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* | Back alignment and structure |
|---|
| >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A | Back alignment and structure |
|---|
| >2lze_A A primordial catalytic fold generated by in vitro evolution; ligase, de novo protein; NMR {Synthetic construct} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 222 | ||||
| d1dszb_ | 84 | g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA- | 3e-30 | |
| d1kb2a_ | 89 | g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-bindin | 6e-29 | |
| d2hanb1 | 83 | g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding do | 6e-29 | |
| d1lo1a_ | 90 | g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-bi | 1e-27 | |
| d1r4ia_ | 74 | g.39.1.2 (A:) Androgen receptor {Rat (Rattus norve | 2e-27 | |
| d1lata_ | 71 | g.39.1.2 (A:) Glucocorticoid receptor DNA-binding | 3e-27 | |
| d1a6ya_ | 78 | g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-b | 1e-26 | |
| d1dsza_ | 75 | g.39.1.2 (A:) Retinoic acid receptor DNA-binding d | 3e-26 | |
| d1cita_ | 89 | g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-b | 1e-25 | |
| d1hcqa_ | 74 | g.39.1.2 (A:) Estrogen receptor DNA-binding domain | 2e-25 | |
| d2nllb_ | 103 | g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) D | 3e-23 |
| >d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: Nuclear receptor domain: Retinoid X receptor (RXR-alpha) DNA-binding domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 105 bits (262), Expect = 3e-30
Identities = 41/72 (56%), Positives = 52/72 (72%)
Query: 127 EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPFCR 186
+ +C +CGD+ SG HYG+ +CE CKGFFKRTV+ YTC + C IDK QR RC +CR
Sbjct: 5 KHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCR 64
Query: 187 FQKCLEVGMKLE 198
+QKCL +GMK E
Sbjct: 65 YQKCLAMGMKRE 76
|
| >d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 83 | Back information, alignment and structure |
|---|
| >d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 74 | Back information, alignment and structure |
|---|
| >d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 | Back information, alignment and structure |
|---|
| >d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 89 | Back information, alignment and structure |
|---|
| >d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| d1dszb_ | 84 | Retinoid X receptor (RXR-alpha) DNA-binding domain | 99.95 | |
| d2hanb1 | 83 | Ecdysone receptor DNA-binding domain {Fruit fly (D | 99.95 | |
| d1dsza_ | 75 | Retinoic acid receptor DNA-binding domain {Human ( | 99.95 | |
| d1kb2a_ | 89 | Vitamin D3 receptor, VDR, DNA-binding domain {Huma | 99.95 | |
| d1r4ia_ | 74 | Androgen receptor {Rat (Rattus norvegicus) [TaxId: | 99.95 | |
| d1lo1a_ | 90 | Steroid hormone receptor Err2 DNA-binding domain { | 99.94 | |
| d1a6ya_ | 78 | Orphan nuclear receptor reverb DNA-binding domain | 99.94 | |
| d1cita_ | 89 | Orphan nuclear receptor NGFI-B DNA-binding domain | 99.94 | |
| d2nllb_ | 103 | Thyroid hormone receptor (TR-beta) DNA-binding dom | 99.94 | |
| d1lata_ | 71 | Glucocorticoid receptor DNA-binding domain {Rat (R | 99.94 | |
| d1hcqa_ | 74 | Estrogen receptor DNA-binding domain {Human and ch | 99.93 |
| >d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: Nuclear receptor domain: Retinoid X receptor (RXR-alpha) DNA-binding domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95 E-value=1.5e-29 Score=188.75 Aligned_cols=79 Identities=52% Similarity=1.162 Sum_probs=76.1
Q ss_pred CccccccCCCCcceeeccccchhhhHHHHhHhhcCceeccccCcccccCCCCCCCCcchHhHHHHHhcCCccccccCCC
Q psy12688 127 EELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNKKVYTCVAERSCHIDKTQRKRCPFCRFQKCLEVGMKLEVSSQSTH 205 (222)
Q Consensus 127 ~~~C~VCGd~asg~HYGV~sCeaCk~FFRRtv~~~~~~~C~~~~~C~i~~~~R~~Cr~CRl~KCLevGM~~eaVr~~r~ 205 (222)
.++|.|||+.++|+||||.+|+||++||||++.....|.|...++|.+++..|..|++|||+|||++||++++|+.+|+
T Consensus 5 ~~~C~VC~~~a~g~hyGv~sC~aCk~FFRR~v~~~~~~~c~~~~~C~~~~~~r~~Cr~CR~~KCl~vGM~~~~vq~~Rd 83 (84)
T d1dszb_ 5 KHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQ 83 (84)
T ss_dssp CEECTTTCCEESSEETTEECCHHHHHHHHHHHHHTCCCCCSSCSCCCCCTTTTTTCHHHHHHHHHHTTCCGGGSCCCCC
T ss_pred CCcCccCCCcCCccCCCHHHHHHhHHHHHHHHhcCCCeeccCCCCcccCCCCCccCCCCccHHHHHcCCChHHcccccC
Confidence 4679999999999999999999999999999999999999999999999999999999999999999999999999987
|
| >d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} | Back information, alignment and structure |
|---|