Psyllid ID: psy12699

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------127
MIASSSKHLTQEQSEPLLINTSDDEEDTTNSDILHKNHTSHKDTPSSHTKEAVSLVNYDTTIAKISTALFYALCSLFITIVNKSVLTSYVFPSFKIVALGQLLTTVVVLYVGKKLRFIQFPNYHRNIFFELMPLPFIYLGNMVFGLGGTKELSLPMFTMLRRFSILMTMIAEYYVLHIVPNRSVKITVGMMIGGAVIAALNDLGYNFQGYVFVLLNNFLTAVNGVYTKKKLDPKKDMGKYGLMFYSSVFMLPVTVIFIYLSDDYAKVLEYEYLWDMWFQIQFILSCCMGFILNYSIMLCTQYNSALTTTIIGCLKNILLTYLGMFIGGDYVYSVNNFIGINISIIGSILYTIVTFKPAPVKKQTVTNEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAGAVDLVKAIMMTTNEDVEVYKYKRLTELQIEDSAVGSLDNIQPGDCIVCFSKNDVYTHQGVYTLGAEWSLGIGTSSKVLVRNKKSNTTNLFVPVHVKPNTDPTDANVGQELTVPVHVKPNTDPTDANVGQELTGGSIDKSETVKILNKFYQRQEIKIAAMDHGLDNTPSSHTKEAVSLVNYDTTIAKISTALFYALCSLFITIVNKSVLTSYVFPSFKIVALGQLLTTVVVLYVGKKLRFIQFPNYHRNIFFELMPLPFIYLGNMVFGLGGTKELSLPMFTMLRRFSILMTMIAEYYVLHIVPNRYLQHQAYISFRRYCLETQSLPVDLHVVLSDIIQGAGHVDDMFPYYLRHAKQMFPHLDCMDDLKKISDLRNPAEWYPNARSISRRIIFHAGPTNSGKTYHALERFLSAESGVYCGPLKIHAGPTNSGKTYHALERFLSAESGVYCGPLKMLATEVFKKSNDRGTPCDLITGEEKKFIQGEEKPANHVACTVEMTSVNIPYEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAGAVDLVKAIMMTTNEDVEVYKYKRLTELQIEDSAVGSLDNIQPGDCIVCFSKNDVYTVSRGIESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNFRGIESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNLSIRRVIFYSLIKPSLNEKGEREIDLISVSAALQIAGRAGRFNTHFEKLAGSHPALNEKGEREIDLISVSAALQIAGRAGRFNTHFEKGFVTTFKPDDLPILKNLLAQSPEPITKAGLHPTADQIELYAYHLPNSTLSNLMDIFVSLSTVDDSLYFMCNIEK
cccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccEEcccccHHHHHHHcHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEHHHHHHHHHHEEEccccccccHHHHHHHHHHHHHHHHHHHHHEEcccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHccccccccHHHHHHHHHHHHHHHHHHEEEEEEccccHHHHHHHHHHHHHHHHHEEEEEcccccEEEEEEcccEEEcccEEEEEEEccccccccccccccHHHHHHHHHcccccccHHHHHHHHcccccEEEEEccccHHHHHHHHHHHccccEEEEEEccccccEEcccccccccccccccEEEEEEHHHHHHHHHHHHccccEEEEEEcccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccEEcccccccccEEccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccEEcccccccHHHHHHHHHHccccccccccccHHHHHHcccccccccccHHHccccccccccccHHHHcccEEEEccccccccccHHHHHHHHHccccccccccEEEEccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccEEEccccccccccEEEEccccEEccccEEEEEEEcccccccccccHHHHHHHHcccccEEEEEccccHHHHHHHHHHHccccEEEEEEccccccEEcccccccccccccccEEEEEcHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHccccccccEEEEEccccccccccccccccccEEEEcccccccHHHHHccccccccccccEEEEEcccccccccEEEEEEEEccccccccccccccEEEccHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccEEEEcccccHHHHHHHHcccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHcccccccEEEccccc
ccccccccccccccccEEEEccccccccccccHEccccccccccccccccccccccccHHHHHHHHHHHHHHHccEEEEEEEHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccEcccccccccccccccccEEEEccHHHcccccHHcccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHcHHHHHHHHHHHHHccHEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccHcHHHHHHHHHHHHHHHHHccccEEEEccEEEccccEEEEEEEEccccccEEEEEHHHHcccccccHHHHHHHHcccHcHEEccccHHHHHHHHHHHHHcccEEEEEEEEcccccEEcccccccHHccccccEEEEEcHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHccccccEEEEEEcccccccccccccEEEcEEEccccccccccHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHccccccHHHHcHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccccHEEEHHHHHcccccHHHHHHHHHHHHHHHccccccHHHHHHHHcccccHHHHHHHHHHHcEEEEEcccccccccccccccEEEEEccccccEEEEEEccccccHHHHHHHHHHHcccccEccHHHHHHHHHHHHHHHccccccEccccEEEEEccccccccEEEEEEEEEEccccEEEEEEEHHHHcccccccHHHHHHHHcccHcHEEccccHHHHHHHHHHHHHcccEEEEEEEEcccccEEcccccccHHccccccEEEEEcHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHccccccccEEEEEccccccccccEEEEEEEEEEEEcccccccccHHHHHHHccccccccEEEEccccccccccccEHEEHHHcEccccccccccccccccHHHHHHHHHHccccccHHHcccccccccccHcccccccccccHHHHHHcccccccccccccEEEEccHHHHHHHHHHHccccHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHcccccccEEEEEccc
miassskhltqeqsepllintsddeedttnsdilhknhtshkdtpsshtkeaVSLVNYDTTIAKISTALFYALCSLFITIVNKSvltsyvfpsfkivALGQLLTTVVVLYVGKklrfiqfpnyhrniffelmplpfiylgnmvfglggtkelslpmFTMLRRFSILMTMIAEYYVLhivpnrsvkITVGMMIGGAVIAALNDLGYNFQGYVFVLLNNFLTAvngvytkkkldpkkdmgkygLMFYSSVFMLPVTVIFIYLSDDYAKVLEYEYLWDMWFQIQFILSCCMGFILNYSIMLCTQYNSALTTTIIGCLKNILLTYLGMFIGGDYVYSVNNFIGINISIIGSILYTivtfkpapvkkqtvtnEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAGAVDLVKAIMMTTNEDVEVYKYKRLTelqiedsavgsldniqpgdcivcfskndvythqgvytlgaewslgigtssKVLVRnkksnttnlfvpvhvkpntdptdanvgqeltvpvhvkpntdptdanvgqeltggsidkseTVKILNKFYQRQEIKIAAmdhgldntpsshtkeAVSLVNYDTTIAKISTALFYALCSLFITIVNKSvltsyvfpsfkivALGQLLTTVVVLYVGKklrfiqfpnyhrniffelmplpfiylgnmvfglggtkelslpmFTMLRRFSILMTMIAEYYVLHivpnrylqhQAYISFRRYCLETQSLPVDLHVVLSDIiqgaghvddmFPYYLRHAkqmfphldcmddlkkisdlrnpaewypnarsISRRIifhagptnsgktYHALERFLsaesgvycgplkihagptnsgktYHALERFLsaesgvycgplKMLATEVfkksndrgtpcdlitgeekkfiqgeekpanhvactvemtsvnipyevAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAGAVDLVKAIMMTTNEDVEVYKYKRLTelqiedsavgsldniqpgdcivcfskndvytvsrgiesrGTEVAVIygslppttklaqaskfndpdnpckvMVATDAigmglnfrgiesrgTEVAViygslppttklaqaskfndpdnpckvMVATDAIGMGLNLSIRRVIFYSLikpslnekgereiDLISVSAALQIAGragrfnthfeklagshpalnekgereiDLISVSAALQIAGragrfnthfekgfvttfkpddlpILKNllaqspepitkaglhptaDQIELYAyhlpnstlsNLMDIFVSLSTVDDSLYFMCNIEK
miassskhltqeqsepllintsddeeDTTNSDILhknhtshkdtpsshtkeAVSLVNYDTTIAKISTALFYALCSLFITIVNKSVLTSYVFPSFKIVALGQLLTTVVVLYVGKKLRFIQFPNYHRNIFFELMPLPFIYLGNMVFGLGGTKELSLPMFTMLRRFSILMTMIAEYYVLHIVPNRSVKITVGMMIGGAVIAALNDLGYNFQGYVFVLLNNFLTAVNgvytkkkldpkkdmGKYGLMFYSSVFMLPVTVIFIYLSDDYAKVLEYEYLWDMWFQIQFILSCCMGFILNYSIMLCTQYNSALTTTIIGCLKNILLTYLGMFIGGDYVYSVNNFIGINISIIGSILYTIVTFkpapvkkqtvtnevavideiqmmRDITRGWAWTRALLGLMAKEIHVCGEAGAVDLVKAIMMTTNEDVEVYKYKRLTELQIEDSAVGSLDNIQPGDCIVCFSKNDVYTHQGVYTLGAEWSLGIGTSSKVLVRNKKsnttnlfvpvhvkpntdptdaNVGQELTVpvhvkpntdptdanvgqeltggsidksetVKILNKFYQRQEIKIAAMDHGLDNTPSSHTKEAVSLVNYDTTIAKISTALFYALCSLFITIVNKSVLTSYVFPSFKIVALGQLLTTVVVLYVGKKLRFIQFPNYHRNIFFELMPLPFIYLGNMVFGLGGTKELSLPMFTMLRRFSILMTMIAEYYVLHIVPNRYLQHQAYISFRRYCLETQSLPVDLHVVLSDIIQGAGHVDDMFPYYLRHAKQMFPHLDCMDDLKKISDLRNPAEWYPNARSISRRIIFHAGPTNSGKTYHALERFLSAESGVYCGPLKIHAGPTNSGKTYHALERFLSAESGVYCGPLKMLATEVfkksndrgtpcDLITGEEKKFIQGEEKPANHVACTVEMTSVNIPYEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAGAVDLVKAIMMTTNEDVEVYKYKRLTELQIEDsavgsldniqpGDCIVCFSKNDVYTVSRGIESRGTEVAVIYGSLPPTTKLAQaskfndpdnpCKVMVATDAIGMGLNFRGIESRGTEVAVIYGSLPPTTKLAQaskfndpdnpCKVMVATDAIGMGLNLSIRRVIFYSLIKPSLNEKGEREIDLISVSAALQIAGRAGRFNTHFEKLAgshpalnekgeREIDLISVSAALQIAGRAGRFNTHFEKGFVTTFKPDDLPILKNLLAQSPEPITKAGLHPTADQIELYAYHLPNSTLSNLMDIFVSLSTVDDSLYFMCNIEK
MIASSSKHLTQEQSEPLLintsddeedttnsdiLHKNHTSHKDTPSSHTKEAVSLVNYDTTIAKISTALFYALCSLFITIVNKSVLTSYVFPSFKIVALGQLLTTVVVLYVGKKLRFIQFPNYHRNIFFELMPLPFIYLGNMVFGLGGTKELSLPMFTMLRRFSILMTMIAEYYVLHIVPNRSVKITVGMMIGGAVIAALNDLGYNFQGYVFVLLNNFLTAVNGVYTkkkldpkkdmgkYGLMFYSSVFMLPVTVIFIYLSDDYAKVLEYEYLWDMWFQIQFILSCCMGFILNYSIMLCTQYNSALTTTIIGCLKNILLTYLGMFIGGDYVYSVnnfiginisiigsiLYTIVTFKPAPVKKQTVTNEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAGAVDLVKAIMMTTNEDVEVYKYKRLTELQIEDSAVGSLDNIQPGDCIVCFSKNDVYTHQGVYTLGAEWSLGIGTSSKVLVRNKKSNTTNLFVPVHVKPNTDPTDANVGQELTVPVHVKPNTDPTDANVGQELTGGSIDKSETVKILNKFYQRQEIKIAAMDHGLDNTPSSHTKEAVSLVNYDTTIAKISTALFYALCSLFITIVNKSVLTSYVFPSFKIVALGQLLTTVVVLYVGKKLRFIQFPNYHRNIFFELMPLPFIYLGNMVFGLGGTKELSLPMFTMLRRFSILMTMIAEYYVLHIVPNRYLQHQAYISFRRYCLETQSLPVDLHVVLSDIIQGAGHVDDMFPYYLRHAKQMFPHLDCMDDLKKISDLRNPAEWYPNARSISRRIIFHAGPTNSGKTYHALERFLSAESGVYCGPLKIHAGPTNSGKTYHALERFLSAESGVYCGPLKMLATEVFKKSNDRGTPCDLITGEEKKFIQGEEKPANHVACTVEMTSVNIPYEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAGAVDLVKAIMMTTNEDVEVYKYKRLTELQIEDSAVGSLDNIQPGDCIVCFSKNDVYTVSRGIESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNFRGIESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNLSIRRVIFYSLIKPSLNEKGEREIDLISVSAALQIAGRAGRFNTHFEKLAGSHPALNEKGEREIDLISVSAALQIAGRAGRFNTHFEKGFVTTFKPDDLPILKNLLAQSPEPITKAGLHPTADQIELYAYHLPNSTLSNLMDIFVSLSTVDDSLYFMCNIEK
****************************************************VSLVNYDTTIAKISTALFYALCSLFITIVNKSVLTSYVFPSFKIVALGQLLTTVVVLYVGKKLRFIQFPNYHRNIFFELMPLPFIYLGNMVFGLGGTKELSLPMFTMLRRFSILMTMIAEYYVLHIVPNRSVKITVGMMIGGAVIAALNDLGYNFQGYVFVLLNNFLTAVNGVYTKKKLDPKKDMGKYGLMFYSSVFMLPVTVIFIYLSDDYAKVLEYEYLWDMWFQIQFILSCCMGFILNYSIMLCTQYNSALTTTIIGCLKNILLTYLGMFIGGDYVYSVNNFIGINISIIGSILYTIVTFKPAPVKKQTVTNEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAGAVDLVKAIMMTTNEDVEVYKYKRLTELQIEDSAVGSLDNIQPGDCIVCFSKNDVYTHQGVYTLGAEWSLGIGTSSKVLVRNKKSNTTNLFVPVHV*********************************************TVKILNKFYQRQEIKIAAMDHG**********EAVSLVNYDTTIAKISTALFYALCSLFITIVNKSVLTSYVFPSFKIVALGQLLTTVVVLYVGKKLRFIQFPNYHRNIFFELMPLPFIYLGNMVFGLGGTKELSLPMFTMLRRFSILMTMIAEYYVLHIVPNRYLQHQAYISFRRYCLETQSLPVDLHVVLSDIIQGAGHVDDMFPYYLRHAKQMFPHLDCMDDLKKISDLRNPAEWYPNARSISRRIIFHAGPTNSGKTYHALERFLSAESGVYCGPLKIHAGPTNSGKTYHALERFLSAESGVYCGPLKMLATEVFKKSNDRGTPCDLITGEEKKFIQGEEKPANHVACTVEMTSVNIPYEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAGAVDLVKAIMMTTNEDVEVYKYKRLTELQIEDSAVGSLDNIQPGDCIVCFSKNDVYTVSRGIESRGTEVAVIYGSLPPTTKLA********DNPCKVMVATDAIGMGLNFRGIESRGTEVAVIYGSLPPTTKLA********DNPCKVMVATDAIGMGLNLSIRRVIFYSLIKPSLNEKGEREIDLISVSAALQIAGRAGRFNTHFEKLAG*********EREIDLISVSAALQIAGRAGRFNTHFEKGFVTTFKPDDLPILKNLLAQSPEPITKAGLHPTADQIELYAYHLPNSTLSNLMDIFVSLSTVDDSLYFMCNI**
***************************************************************KISTALFYALCSLFITIVNKSVLTSYVFPSFKIVALGQLLTTVVVLYVGKKLRFIQFPNYHRNIFFELMPLPFIYLGNMVFGLGGTKELSLPMFTMLRRFSILMTMIAEYYVLHIVPNRSVKITVGMMIGGAVIAALNDLGYNFQGYVFVLLNNFLTAVNGVYTKKKLDPKKDMGKYGLMFYSSVFMLPVTVIFIYLSDDYAKVLEYEYLWDMWFQIQFILSCCMGFILNYSIMLCTQYNSALTTTIIGCLKNILLTYLGMFIGGDYVYSVNNFIGINISIIGSILYTIVTFKPAPVKKQ*********************WAWTRALLGLMAKEIHVCGEAGAVDLVKAIMMTTNEDVEVYKYKRLTELQIEDSAVG*LDNIQPGDCIVCFSKNDVYTHQGVYTLGAEWSLGIGTSSKVL****************VKPNTDPTDANVGQELTVPVHVKPNTDPTDANVG****************************************************DTTIAKISTALFYALCSLFITIVNKSVLTSYVFPSFKIVALGQLLTTVVVLYVGKKLRFIQFPNYHRNIFFELMPLPFIYLGNMVFGLGGTKELSLPMFTMLRRFSILMTMIAEYYVLHIVPNRYLQHQAYISFRRYCLETQSLPVDLHVVLSDIIQGAGHVDDMFPYYLRHAKQMFPHLDCMDDLKKISDLRNPAEWYPNARSISRRIIFHAGPTNSGKTYHALERFLSAESGVYCGPLKIHAGPTNSGKTYHALERFLSAESGVYCGPLKMLATEVFKKSNDRGTPCDLITGEEKKFIQGEEKPANHVACTVEMTSVNIPYEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAGAVDLVKAIMMTTNEDVEVYKYKRLTELQIEDSA*****NIQPGDCIVCFSKNDVYTVSRGIESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNFRGIESRGTEVAVIYGSLPPTTKLAQAS**NDPDNPCKVMVATDAIGMGLNLSIRRVIFYSLIKPSLNEKGEREIDLISVSAALQIAGRAGRFNTHFEKLAGSHPALNEKGEREIDLISVSAALQIAGRAGRFNTHFEKGFVTTFKPDDLPILKNLLAQSPEPITKAGLHPTADQIELYAYHLPNSTLSNLMDIFVSLSTVDDSLYFMCNI**
*************SEPLLINTSDDEEDTTNSDILHKN*************EAVSLVNYDTTIAKISTALFYALCSLFITIVNKSVLTSYVFPSFKIVALGQLLTTVVVLYVGKKLRFIQFPNYHRNIFFELMPLPFIYLGNMVFGLGGTKELSLPMFTMLRRFSILMTMIAEYYVLHIVPNRSVKITVGMMIGGAVIAALNDLGYNFQGYVFVLLNNFLTAVNGVYTKKKLDPKKDMGKYGLMFYSSVFMLPVTVIFIYLSDDYAKVLEYEYLWDMWFQIQFILSCCMGFILNYSIMLCTQYNSALTTTIIGCLKNILLTYLGMFIGGDYVYSVNNFIGINISIIGSILYTIVTFKPAPVKKQTVTNEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAGAVDLVKAIMMTTNEDVEVYKYKRLTELQIEDSAVGSLDNIQPGDCIVCFSKNDVYTHQGVYTLGAEWSLGIGTSSKVLVRNKKSNTTNLFVPVHVKPNTDPTDANVGQELTVPVHVKPNTDPTDANVGQELTGGSIDKSETVKILNKFYQRQEIKIAAMDHGLDNTPSSHTKEAVSLVNYDTTIAKISTALFYALCSLFITIVNKSVLTSYVFPSFKIVALGQLLTTVVVLYVGKKLRFIQFPNYHRNIFFELMPLPFIYLGNMVFGLGGTKELSLPMFTMLRRFSILMTMIAEYYVLHIVPNRYLQHQAYISFRRYCLETQSLPVDLHVVLSDIIQGAGHVDDMFPYYLRHAKQMFPHLDCMDDLKKISDLRNPAEWYPNARSISRRIIFHAGPTNSGKTYHALERFLSAESGVYCGPLKIHAGPTNSGKTYHALERFLSAESGVYCGPLKMLATEVFKKSNDRGTPCDLITGEEKKFIQGEEKPANHVACTVEMTSVNIPYEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAGAVDLVKAIMMTTNEDVEVYKYKRLTELQIEDSAVGSLDNIQPGDCIVCFSKNDVYTVSRGIESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNFRGIESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNLSIRRVIFYSLIKPSLNEKGEREIDLISVSAALQIAGRAGRFNTHFEKLAGSHPALNEKGEREIDLISVSAALQIAGRAGRFNTHFEKGFVTTFKPDDLPILKNLLAQSPEPITKAGLHPTADQIELYAYHLPNSTLSNLMDIFVSLSTVDDSLYFMCNIEK
************QSEPL***************************************NYDTTIAKISTALFYALCSLFITIVNKSVLTSYVFPSFKIVALGQLLTTVVVLYVGKKLRFIQFPNYHRNIFFELMPLPFIYLGNMVFGLGGTKELSLPMFTMLRRFSILMTMIAEYYVLHIVPNRSVKITVGMMIGGAVIAALNDLGYNFQGYVFVLLNNFLTAVNGVYTKKKLDPKKDMGKYGLMFYSSVFMLPVTVIFIYLSDDYAKVLEYEYLWDMWFQIQFILSCCMGFILNYSIMLCTQYNSALTTTIIGCLKNILLTYLGMFIGGDYVYSVNNFIGINISIIGSILYTIVTFKPAPVKKQTVTNEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAGAVDLVKAIMMTTNEDVEVYKYKRLTELQIEDSAVGSLDNIQPGDCIVCFSKNDVYTHQGVYTLGAEWSLGIGTSSKVLVRNKKSNTTNLFVPVHVKPNTDPTDANVGQELTVPVHVKPNTDPTDANVGQELTGGSIDKSETVKILNKFYQRQEIKIAAMDHGLDNTPSSHTKEAVSLVNYDTTIAKISTALFYALCSLFITIVNKSVLTSYVFPSFKIVALGQLLTTVVVLYVGKKLRFIQFPNYHRNIFFELMPLPFIYLGNMVFGLGGTKELSLPMFTMLRRFSILMTMIAEYYVLHIVPNRYLQHQAYISFRRYCLETQSLPVDLHVVLSDIIQGAGHVDDMFPYYLRHAKQMFPHLDCMDDLKKISDLRNPAEWYPNARSISRRIIFHAGPTNSGKTYHALERFLSAESGVYCGPLKIHAGPTNSGKTYHALERFLSAESGVYCGPLKMLATEVFKKSNDRGTPCDLITGEEKKFIQGEEKPANHVACTVEMTSVNIPYEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAGAVDLVKAIMMTTNEDVEVYKYKRLTELQIEDSAVGSLDNIQPGDCIVCFSKNDVYTVSRGIESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNFRGIESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNLSIRRVIFYSLIKPSLNEKGEREIDLISVSAALQIAGRAGRFNTHFEKLAGSHPALNEKGEREIDLISVSAALQIAGRAGRFNTHFEKGFVTTFKPDDLPILKNLLAQSPEPITKAGLHPTADQIELYAYHLPNSTLSNLMDIFVSLSTVDDSLYFMCNIE*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIASSSKHLTQEQSEPLLINTSDDEEDTTNSDILHKNHTSHKDTPSSHTKEAVSLVNYDTTIAKISTALFYALCSLFITIVNKSVLTSYVFPSFKIVALGQLLTTVVVLYVGKKLRFIQFPNYHRNIFFELMPLPFIYLGNMVFGLGGTKELSLPMFTMLRRFSILMTMIAEYYVLHIVPNRSVKITVGMMIGGAVIAALNDLGYNFQGYVFVLLNNFLTAVNGVYTKKKLDPKKDMGKYGLMFYSSVFMLPVTVIFIYLSDDYAKVLEYEYLWDMWFQIQFILSCCMGFILNYSIMLCTQYNSALTTTIIGCLKNILLTYLGMFIGGDYVYSVNNFIGINISIIGSILYTIVTFKPAPVKKQTVTNEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAGAVDLVKAIMMTTNEDVEVYKYKRLTELQIEDSAVGSLDNIQPGDCIVCFSKNDVYTHQGVYTLGAEWSLGIGTSSKVLVRNKKSNTTNLFVPVHVKPNTDPTDANVGQELTVPVHVKPNTDPTDANVGQELTGGSIDKSETVKILNKFYQRQEIKIAAMDHGLDNTPSSHTKEAVSLVNYDTTIAKISTALFYALCSLFITIVNKSVLTSYVFPSFKIVALGQLLTTVVVLYVGKKLRFIQFPNYHRNIFFELMPLPFIYLGNMVFGLGGTKELSLPMFTMLRRFSILMTMIAEYYVLHIVPNRYLQHQAYISFRRYCLETQSLPVDLHVVLSDIIQGAGHVDDMFPYYLRHAKQMFPHLDCMDDLKKISDLRNPAEWYPNARSISRRIIFHAGPTNSGKTYHALERFLSAESGVYCGPLKIHAGPTNSGKTYHALERFLSAESGVYCGPLKMLATEVFKKSNDRGTPCDLITGEEKKFIQGEEKPANHVACTVEMTSVNIPYEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAGAVDLVKAIMMTTNEDVEVYKYKRLTELQIEDSAVGSLDNIQPGDCIVCFSKNDVYTVSRGIESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNFRGIESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNLSIRRVIFYSLIKPSLNEKGEREIDLISVSAALQIAGRAGRFNTHFEKLAGSHPALNEKGEREIDLISVSAALQIAGRAGRFNTHFEKGFVTTFKPDDLPILKNLLAQSPEPITKAGLHPTADQIELYAYHLPNSTLSNLMDIFVSLSTVDDSLYFMCNIEK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1269 2.2.26 [Sep-21-2011]
Q295E6 762 ATP-dependent RNA helicas yes N/A 0.345 0.574 0.591 0.0
Q9VN03 763 ATP-dependent RNA helicas yes N/A 0.343 0.571 0.596 0.0
A4IG62 763 ATP-dependent RNA helicas yes N/A 0.342 0.568 0.540 1e-171
Q5ZJT0 794 ATP-dependent RNA helicas yes N/A 0.340 0.544 0.529 1e-167
Q5EBA1 776 ATP-dependent RNA helicas yes N/A 0.340 0.556 0.522 1e-164
Q8IYB8 786 ATP-dependent RNA helicas yes N/A 0.340 0.549 0.524 1e-164
Q80YD1 779 ATP-dependent RNA helicas yes N/A 0.340 0.554 0.522 1e-163
Q17828 721 ATP-dependent RNA helicas yes N/A 0.336 0.592 0.420 1e-121
Q61SU7 721 ATP-dependent RNA helicas N/A N/A 0.331 0.583 0.425 1e-120
Q95YI5373 UDP-sugar transporter UST no N/A 0.269 0.916 0.526 1e-95
>sp|Q295E6|SUV3_DROPS ATP-dependent RNA helicase SUV3 homolog, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=GA22038 PE=3 SV=1 Back     alignment and function desciption
 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/560 (59%), Positives = 391/560 (69%), Gaps = 122/560 (21%)

Query: 709  NRYLQHQAYISFRRYCLETQSLPVDLHVVLSDIIQGAGHVDDMFPYYLRHAKQMFPHLDC 768
            + YLQ QA+ SFRRYC+E ++LPVDLH++ SDI+QGAGH+DD+FPY+LRHAK +FPHLDC
Sbjct: 103  DSYLQQQAFGSFRRYCIEAENLPVDLHIIFSDIMQGAGHIDDIFPYFLRHAKTVFPHLDC 162

Query: 769  MDDLKKISDLRNPAEWYPNARSISRRIIFHAGPTNSGKTYHALERFLSAESGVYCGPLKI 828
            MDDLKKISDLR PA WY NAR+++R+I+FH+G                            
Sbjct: 163  MDDLKKISDLRQPANWYTNARALTRKIVFHSG---------------------------- 194

Query: 829  HAGPTNSGKTYHALERFLSAESGVYCGPLKMLATEVFKKSNDRGTPCDLITGEEKKFIQG 888
               PTNSGKTYHA+ER+LSA++GVYCGPLK+LATEV+ K+N+RGTPCDL+TGEE+KF   
Sbjct: 195  ---PTNSGKTYHAMERYLSAKTGVYCGPLKLLATEVYNKANERGTPCDLVTGEERKFGIS 251

Query: 889  EEKPANHVACTVEMTSVNIPYEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAG 948
            +  PANHVACTVEMTSVN PYEVAVIDEIQ +RD  RGWAWTRA LGL+A E+HVCGEAG
Sbjct: 252  DNSPANHVACTVEMTSVNTPYEVAVIDEIQQIRDPQRGWAWTRAFLGLIADEVHVCGEAG 311

Query: 949  AVDLVKAIMMTTNEDVEVYKYKRLTELQIEDSAVGSLDNIQPGDCIVCFSKNDVYTVSRG 1008
            A++L++ I  TT E VEV +Y RLTEL +EDSA+GSLDN+ PGDCIVCFSK+D+YTVSR 
Sbjct: 312  ALELLQKICETTGETVEVRRYDRLTELTVEDSALGSLDNVMPGDCIVCFSKHDIYTVSRE 371

Query: 1009 IESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNFRGIESRGTEVA 1068
            IE+RG EVAVIYG LPP TKLAQA+KFNDP N CKVMVATDAIGMGLN            
Sbjct: 372  IEARGKEVAVIYGGLPPGTKLAQAAKFNDPANSCKVMVATDAIGMGLN------------ 419

Query: 1069 VIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNLSIRRVIFYSLIKPSLNEKGE 1128
                                                   LSIRR+IFYSL+KP++NE+GE
Sbjct: 420  ---------------------------------------LSIRRIIFYSLVKPTMNERGE 440

Query: 1129 REIDLISVSAALQIAGRAGRFNTHFEKLAGSHPALNEKGEREIDLISVSAALQIAGRAGR 1188
            REID ISVS+ALQIAGRAGRF                                       
Sbjct: 441  REIDTISVSSALQIAGRAGRF--------------------------------------- 461

Query: 1189 FNTHFEKGFVTTFKPDDLPILKNLLAQSPEPITKAGLHPTADQIELYAYHLPNSTLSNLM 1248
              T +E G+VT FK +DL  L+ +LAQ+PEP+ +AGLHPTADQIELYAYHLPNS+LSNLM
Sbjct: 462  -RTQWEHGYVTAFKSEDLQTLQRILAQTPEPLKQAGLHPTADQIELYAYHLPNSSLSNLM 520

Query: 1249 DIFVSLSTVDDSLYFMCNIE 1268
            DIFV+L TVDDSLYFMCNIE
Sbjct: 521  DIFVNLCTVDDSLYFMCNIE 540
ATPase and DNA/RNA helicase able to unwind DNA/DNA, DNA/RNA and RNA/RNA duplexes in the 5'-3' direction.
Drosophila pseudoobscura pseudoobscura (taxid: 46245)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q9VN03|SUV3_DROME ATP-dependent RNA helicase SUV3 homolog, mitochondrial OS=Drosophila melanogaster GN=CG9791 PE=2 SV=3 Back     alignment and function description
>sp|A4IG62|SUV3_DANRE ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Danio rerio GN=supv3l1 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZJT0|SUV3_CHICK ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Gallus gallus GN=SUPV3L1 PE=2 SV=1 Back     alignment and function description
>sp|Q5EBA1|SUV3_RAT ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Rattus norvegicus GN=Supv3l1 PE=2 SV=1 Back     alignment and function description
>sp|Q8IYB8|SUV3_HUMAN ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Homo sapiens GN=SUPV3L1 PE=1 SV=1 Back     alignment and function description
>sp|Q80YD1|SUV3_MOUSE ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Mus musculus GN=Supv3l1 PE=2 SV=1 Back     alignment and function description
>sp|Q17828|SUV3_CAEEL ATP-dependent RNA helicase SUV3 homolog, mitochondrial OS=Caenorhabditis elegans GN=C08F8.2 PE=3 SV=2 Back     alignment and function description
>sp|Q61SU7|SUV3_CAEBR ATP-dependent RNA helicase SUV3 homolog, mitochondrial OS=Caenorhabditis briggsae GN=CBG06022 PE=3 SV=3 Back     alignment and function description
>sp|Q95YI5|US74C_DROME UDP-sugar transporter UST74c OS=Drosophila melanogaster GN=frc PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1269
328705328767 PREDICTED: ATP-dependent RNA helicase SU 0.345 0.571 0.621 0.0
189240823742 PREDICTED: similar to ATP-dependent RNA 0.345 0.590 0.598 0.0
195109112767 GI23236 [Drosophila mojavensis] gi|19391 0.343 0.568 0.600 0.0
195036898767 GH18537 [Drosophila grimshawi] gi|193894 0.345 0.571 0.594 0.0
194743614763 GF18203 [Drosophila ananassae] gi|190627 0.345 0.574 0.594 0.0
195446006768 GK10952 [Drosophila willistoni] gi|19416 0.345 0.570 0.592 0.0
125777467762 GA22038 [Drosophila pseudoobscura pseudo 0.345 0.574 0.591 0.0
195156822764 GL12317 [Drosophila persimilis] gi|19411 0.345 0.573 0.589 0.0
195568145758 GD19716 [Drosophila simulans] gi|1941980 0.343 0.575 0.600 0.0
195343379620 GM10744 [Drosophila sechellia] gi|194133 0.343 0.703 0.600 0.0
>gi|328705328|ref|XP_001949841.2| PREDICTED: ATP-dependent RNA helicase SUV3 homolog, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/560 (62%), Positives = 398/560 (71%), Gaps = 122/560 (21%)

Query: 709  NRYLQHQAYISFRRYCLETQSLPVDLHVVLSDIIQGAGHVDDMFPYYLRHAKQMFPHLDC 768
            + YLQHQAYISFRRYCLE  +LPVDLHVV+SDI+QGAGHVDD+ PY+LRHAKQMFPHL+C
Sbjct: 98   DNYLQHQAYISFRRYCLEANTLPVDLHVVISDILQGAGHVDDILPYFLRHAKQMFPHLEC 157

Query: 769  MDDLKKISDLRNPAEWYPNARSISRRIIFHAGPTNSGKTYHALERFLSAESGVYCGPLKI 828
            MDDLKKISDLR+PA WYP AR+I+R+IIFHAG                            
Sbjct: 158  MDDLKKISDLRSPANWYPEARAINRKIIFHAG---------------------------- 189

Query: 829  HAGPTNSGKTYHALERFLSAESGVYCGPLKMLATEVFKKSNDRGTPCDLITGEEKKFIQG 888
               PTNSGKTYHALE++LS+ SGVYCGPLK+LATEV++KSN+RGTPCDL+TGEE+KF   
Sbjct: 190  ---PTNSGKTYHALEKYLSSNSGVYCGPLKLLATEVYRKSNERGTPCDLVTGEERKFADE 246

Query: 889  EEKPANHVACTVEMTSVNIPYEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAG 948
            + + + HV+CTVEM +VN PY++AVIDEIQMM+D +RGWAWTRALLGL+A EIH+CGE G
Sbjct: 247  KNEASKHVSCTVEMANVNTPYDIAVIDEIQMMKDPSRGWAWTRALLGLVANEIHICGEEG 306

Query: 949  AVDLVKAIMMTTNEDVEVYKYKRLTELQIEDSAVGSLDNIQPGDCIVCFSKNDVYTVSRG 1008
            AVDLVK +M+TT EDV+V +YKRLTEL +E+SAV +LDNI PGDCIVCFSKNDVYTVSRG
Sbjct: 307  AVDLVKGLMITTGEDVQVCRYKRLTELTVENSAVCTLDNIVPGDCIVCFSKNDVYTVSRG 366

Query: 1009 IESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNFRGIESRGTEVA 1068
            IESRG EVAVIYG LPP TKLAQA KFNDP N C V+VATDAIGMGLN            
Sbjct: 367  IESRGIEVAVIYGGLPPNTKLAQAQKFNDPKNSCSVLVATDAIGMGLN------------ 414

Query: 1069 VIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNLSIRRVIFYSLIKPSLNEKGE 1128
                                                   LSIRRVIFYSLIKP+LNEKGE
Sbjct: 415  ---------------------------------------LSIRRVIFYSLIKPTLNEKGE 435

Query: 1129 REIDLISVSAALQIAGRAGRFNTHFEKLAGSHPALNEKGEREIDLISVSAALQIAGRAGR 1188
            +E+D ISVS ALQIAGRAGR+ T                                     
Sbjct: 436  KEMDTISVSQALQIAGRAGRYGT------------------------------------- 458

Query: 1189 FNTHFEKGFVTTFKPDDLPILKNLLAQSPEPITKAGLHPTADQIELYAYHLPNSTLSNLM 1248
                +EKG VTTFKP DLP L+N+L++ PEPI KAGLHPTADQIELYAYHLPNSTLSNL+
Sbjct: 459  ---QYEKGCVTTFKPQDLPTLRNILSEKPEPILKAGLHPTADQIELYAYHLPNSTLSNLV 515

Query: 1249 DIFVSLSTVDDSLYFMCNIE 1268
            DIF+SLSTVDDSLYFMCNIE
Sbjct: 516  DIFISLSTVDDSLYFMCNIE 535

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189240823|ref|XP_001811917.1| PREDICTED: similar to ATP-dependent RNA and DNA helicase [Tribolium castaneum] gi|270013711|gb|EFA10159.1| hypothetical protein TcasGA2_TC012348 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195109112|ref|XP_001999134.1| GI23236 [Drosophila mojavensis] gi|193915728|gb|EDW14595.1| GI23236 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195036898|ref|XP_001989905.1| GH18537 [Drosophila grimshawi] gi|193894101|gb|EDV92967.1| GH18537 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|194743614|ref|XP_001954295.1| GF18203 [Drosophila ananassae] gi|190627332|gb|EDV42856.1| GF18203 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195446006|ref|XP_002070584.1| GK10952 [Drosophila willistoni] gi|194166669|gb|EDW81570.1| GK10952 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|125777467|ref|XP_001359616.1| GA22038 [Drosophila pseudoobscura pseudoobscura] gi|121989826|sp|Q295E6.1|SUV3_DROPS RecName: Full=ATP-dependent RNA helicase SUV3 homolog, mitochondrial; Flags: Precursor gi|54639364|gb|EAL28766.1| GA22038 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195156822|ref|XP_002019295.1| GL12317 [Drosophila persimilis] gi|194115886|gb|EDW37929.1| GL12317 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195568145|ref|XP_002102078.1| GD19716 [Drosophila simulans] gi|194198005|gb|EDX11581.1| GD19716 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195343379|ref|XP_002038275.1| GM10744 [Drosophila sechellia] gi|194133296|gb|EDW54812.1| GM10744 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1269
UNIPROTKB|Q295E6 762 GA22038 "ATP-dependent RNA hel 0.179 0.299 0.763 4.8e-205
FB|FBgn0037232 763 CG9791 [Drosophila melanogaste 0.179 0.298 0.767 5.7e-205
UNIPROTKB|E1BTJ2 796 SUPV3L1 "ATP-dependent RNA hel 0.179 0.286 0.714 1.9e-183
ZFIN|ZDB-GENE-030131-2838 763 supv3l1 "suppressor of var1, 3 0.179 0.298 0.710 1.7e-137
WB|WBGene00007444721 C08F8.2 [Caenorhabditis elegan 0.179 0.316 0.614 2e-135
UNIPROTKB|Q17828721 C08F8.2 "ATP-dependent RNA hel 0.179 0.316 0.614 2e-135
UNIPROTKB|F1SUG1 789 SUPV3L1 "Uncharacterized prote 0.179 0.288 0.719 2.7e-135
MGI|MGI:2441711 779 Supv3l1 "suppressor of var1, 3 0.179 0.292 0.701 1.5e-134
UNIPROTKB|F1NMV4 794 SUPV3L1 "ATP-dependent RNA hel 0.179 0.287 0.714 2.4e-134
UNIPROTKB|Q5ZJT0 794 SUPV3L1 "ATP-dependent RNA hel 0.179 0.287 0.714 2.4e-134
UNIPROTKB|Q295E6 GA22038 "ATP-dependent RNA helicase SUV3 homolog, mitochondrial" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
 Score = 946 (338.1 bits), Expect = 4.8e-205, Sum P(4) = 4.8e-205
 Identities = 174/228 (76%), Positives = 201/228 (88%)

Query:   829 HAGPTNSGKTYHALERFLSAESGVYCGPLKMLATEVFKKSNDRGTPCDLITGEEKKFIQG 888
             H+GPTNSGKTYHA+ER+LSA++GVYCGPLK+LATEV+ K+N+RGTPCDL+TGEE+KF   
Sbjct:   192 HSGPTNSGKTYHAMERYLSAKTGVYCGPLKLLATEVYNKANERGTPCDLVTGEERKFGIS 251

Query:   889 EEKPANHVACTVEMTSVNIPYEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAG 948
             +  PANHVACTVEMTSVN PYEVAVIDEIQ +RD  RGWAWTRA LGL+A E+HVCGEAG
Sbjct:   252 DNSPANHVACTVEMTSVNTPYEVAVIDEIQQIRDPQRGWAWTRAFLGLIADEVHVCGEAG 311

Query:   949 AVDLVKAIMMTTNEDVEVYKYKRLTELQIEDSAVGSLDNIQPGDCIVCFSKNDVYTVSRG 1008
             A++L++ I  TT E VEV +Y RLTEL +EDSA+GSLDN+ PGDCIVCFSK+D+YTVSR 
Sbjct:   312 ALELLQKICETTGETVEVRRYDRLTELTVEDSALGSLDNVMPGDCIVCFSKHDIYTVSRE 371

Query:  1009 IESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLN 1056
             IE+RG EVAVIYG LPP TKLAQA+KFNDP N CKVMVATDAIGMGLN
Sbjct:   372 IEARGKEVAVIYGGLPPGTKLAQAAKFNDPANSCKVMVATDAIGMGLN 419
GO:0003677 "DNA binding" evidence=ISS
GO:0003678 "DNA helicase activity" evidence=ISS
GO:0005759 "mitochondrial matrix" evidence=ISS
GO:0032508 "DNA duplex unwinding" evidence=ISS
FB|FBgn0037232 CG9791 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1BTJ2 SUPV3L1 "ATP-dependent RNA helicase SUPV3L1, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-2838 supv3l1 "suppressor of var1, 3-like 1 (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00007444 C08F8.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q17828 C08F8.2 "ATP-dependent RNA helicase SUV3 homolog, mitochondrial" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1SUG1 SUPV3L1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2441711 Supv3l1 "suppressor of var1, 3-like 1 (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMV4 SUPV3L1 "ATP-dependent RNA helicase SUPV3L1, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJT0 SUPV3L1 "ATP-dependent RNA helicase SUPV3L1, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5EBA1SUV3_RAT3, ., 6, ., 4, ., 1, 30.52250.34040.5567yesN/A
Q295E6SUV3_DROPS3, ., 6, ., 4, ., 1, 30.59100.34510.5748yesN/A
Q5ZJT0SUV3_CHICK3, ., 6, ., 4, ., 1, 30.52970.34040.5440yesN/A
Q5RDC9S35D2_PONABNo assigned EC number0.52270.24190.8647yesN/A
A4IG62SUV3_DANRE3, ., 6, ., 4, ., 1, 30.54030.34200.5688yesN/A
Q80YD1SUV3_MOUSE3, ., 6, ., 4, ., 1, 30.52250.34040.5545yesN/A
Q8IYB8SUV3_HUMAN3, ., 6, ., 4, ., 1, 30.52430.34040.5496yesN/A
Q9VN03SUV3_DROME3, ., 6, ., 4, ., 1, 30.59670.34350.5714yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.737
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1269
smart0049082 smart00490, HELICc, helicase superfamily c-termina 4e-12
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 9e-12
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 1e-10
COG5070309 COG5070, VRG4, Nucleotide-sugar transporter [Carbo 2e-10
pfam03151149 pfam03151, TPT, Triose-phosphate Transporter famil 5e-09
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 7e-09
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 4e-08
smart0049082 smart00490, HELICc, helicase superfamily c-termina 2e-06
TIGR00817302 TIGR00817, tpt, Tpt phosphate/phosphoenolpyruvate 2e-06
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-05
PTZ00343350 PTZ00343, PTZ00343, triose or hexose phosphate/pho 1e-05
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 5e-05
COG4581 1041 COG4581, COG4581, Superfamily II RNA helicase [DNA 0.002
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 0.003
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 0.003
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 0.004
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information 
 Score = 62.6 bits (153), Expect = 4e-12
 Identities = 28/92 (30%), Positives = 41/92 (44%), Gaps = 17/92 (18%)

Query: 1060 IESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNL-SIRRVIFYSL 1118
            ++  G +VA ++G L    +     KFN+     KV+VATD    GL+L  +  VI Y L
Sbjct: 7    LKELGIKVARLHGGLSQEEREEILDKFNNGKI--KVLVATDVAERGLDLPGVDLVIIYDL 64

Query: 1119 IKPSLNEKGEREIDLISVSAALQIAGRAGRFN 1150
                            S ++ +Q  GRAGR  
Sbjct: 65   --------------PWSPASYIQRIGRAGRAG 82

Length = 82
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|227402 COG5070, VRG4, Nucleotide-sugar transporter [Carbohydrate transport and metabolism / Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|217390 pfam03151, TPT, Triose-phosphate Transporter family Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|129898 TIGR00817, tpt, Tpt phosphate/phosphoenolpyruvate translocator Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|240371 PTZ00343, PTZ00343, triose or hexose phosphate/phosphate translocator; Provisional Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|226947 COG4581, COG4581, Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1269
KOG0953|consensus 700 100.0
KOG0331|consensus519 100.0
KOG0330|consensus476 100.0
KOG0345|consensus567 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0340|consensus442 100.0
KOG0333|consensus673 100.0
KOG0338|consensus691 100.0
PTZ00110545 helicase; Provisional 100.0
KOG0348|consensus708 100.0
KOG0328|consensus400 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0342|consensus543 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
KOG0335|consensus482 100.0
KOG0343|consensus 758 100.0
KOG0326|consensus459 100.0
KOG0336|consensus629 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0953|consensus700 99.98
KOG1444|consensus314 99.98
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.97
KOG0339|consensus731 99.97
COG1204 766 Superfamily II helicase [General function predicti 99.97
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.97
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.97
PRK02362 737 ski2-like helicase; Provisional 99.97
KOG1441|consensus316 99.97
PRK10689 1147 transcription-repair coupling factor; Provisional 99.97
PTZ00424401 helicase 45; Provisional 99.97
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.97
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.97
PTZ00343350 triose or hexose phosphate/phosphate translocator; 99.97
KOG0332|consensus477 99.97
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.97
PRK01172 674 ski2-like helicase; Provisional 99.97
TIGR00817302 tpt Tpt phosphate/phosphoenolpyruvate translocator 99.97
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.97
KOG0922|consensus 674 99.97
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.97
KOG0341|consensus610 99.97
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.97
KOG0350|consensus620 99.96
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.96
PHA02653675 RNA helicase NPH-II; Provisional 99.96
KOG0346|consensus569 99.96
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.96
PRK00254 720 ski2-like helicase; Provisional 99.96
PRK13767 876 ATP-dependent helicase; Provisional 99.96
KOG0952|consensus 1230 99.96
KOG0347|consensus731 99.96
KOG0334|consensus 997 99.96
KOG0344|consensus593 99.96
KOG0923|consensus 902 99.95
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.95
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.95
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.95
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.95
COG1202 830 Superfamily II helicase, archaea-specific [General 99.95
KOG1443|consensus349 99.95
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.95
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.95
KOG4284|consensus 980 99.95
KOG0924|consensus 1042 99.94
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.94
KOG1442|consensus347 99.94
KOG0951|consensus 1674 99.94
KOG0947|consensus 1248 99.94
KOG0327|consensus397 99.94
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.94
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.94
KOG0948|consensus 1041 99.94
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.93
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.93
KOG1444|consensus314 99.93
PF08449303 UAA: UAA transporter family; InterPro: IPR013657 T 99.93
KOG0337|consensus529 99.92
KOG0926|consensus 1172 99.92
COG5070309 VRG4 Nucleotide-sugar transporter [Carbohydrate tr 99.92
PLN00411358 nodulin MtN21 family protein; Provisional 99.9
PHA02558501 uvsW UvsW helicase; Provisional 99.9
KOG0352|consensus 641 99.89
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.89
KOG0920|consensus 924 99.88
KOG0351|consensus 941 99.88
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.87
PRK09401 1176 reverse gyrase; Reviewed 99.87
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.87
PRK14701 1638 reverse gyrase; Provisional 99.87
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.86
COG1205 851 Distinct helicase family with a unique C-terminal 99.86
KOG0925|consensus 699 99.85
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.84
KOG1581|consensus327 99.84
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.84
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.83
PRK13766 773 Hef nuclease; Provisional 99.83
PRK11453299 O-acetylserine/cysteine export protein; Provisiona 99.83
PF06027334 DUF914: Eukaryotic protein of unknown function (DU 99.82
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.82
KOG1441|consensus316 99.82
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.82
PRK05580679 primosome assembly protein PriA; Validated 99.81
PRK11272292 putative DMT superfamily transporter inner membran 99.81
KOG1580|consensus337 99.81
PRK11689295 aromatic amino acid exporter; Provisional 99.81
PRK10532293 threonine and homoserine efflux system; Provisiona 99.81
KOG0353|consensus 695 99.81
TIGR00950260 2A78 Carboxylate/Amino Acid/Amine Transporter. 99.8
KOG0950|consensus 1008 99.8
KOG0329|consensus387 99.8
PRK15430296 putative chloramphenical resistance permease RarD; 99.79
PRK09694878 helicase Cas3; Provisional 99.79
KOG0354|consensus 746 99.79
KOG0349|consensus725 99.78
KOG1582|consensus367 99.76
PRK04914 956 ATP-dependent helicase HepA; Validated 99.76
COG5070309 VRG4 Nucleotide-sugar transporter [Carbohydrate tr 99.74
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.73
KOG1442|consensus347 99.71
KOG0949|consensus 1330 99.7
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.7
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.69
TIGR03340281 phn_DUF6 phosphonate utilization associated putati 99.68
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.67
COG0697292 RhaT Permeases of the drug/metabolite transporter 99.66
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.65
KOG3912|consensus372 99.64
KOG1583|consensus330 99.63
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.63
PTZ00343350 triose or hexose phosphate/phosphate translocator; 99.62
KOG4510|consensus346 99.61
TIGR00688256 rarD rarD protein. This uncharacterized protein is 99.6
TIGR00817302 tpt Tpt phosphate/phosphoenolpyruvate translocator 99.57
KOG2765|consensus416 99.57
PF03151153 TPT: Triose-phosphate Transporter family; InterPro 99.54
KOG2234|consensus345 99.54
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.54
TIGR00776290 RhaT RhaT L-rhamnose-proton symporter family prote 99.54
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.53
PF04142244 Nuc_sug_transp: Nucleotide-sugar transporter; Inte 99.52
COG5006292 rhtA Threonine/homoserine efflux transporter [Amin 99.45
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.45
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.43
COG2962293 RarD Predicted permeases [General function predict 99.42
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.41
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.4
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.38
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.37
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.37
KOG0951|consensus1674 99.3
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.22
KOG2766|consensus336 99.21
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.18
smart0049082 HELICc helicase superfamily c-terminal domain. 99.17
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.15
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.14
KOG1443|consensus349 99.13
COG4096 875 HsdR Type I site-specific restriction-modification 99.13
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.12
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.11
KOG0921|consensus 1282 99.1
PF08449303 UAA: UAA transporter family; InterPro: IPR013657 T 99.06
PRK05298652 excinuclease ABC subunit B; Provisional 99.06
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.02
TIGR00803222 nst UDP-galactose transporter. NSTs generally appe 98.92
KOG4150|consensus 1034 98.92
KOG4314|consensus290 98.91
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 98.91
KOG0385|consensus 971 98.9
KOG1123|consensus776 98.86
KOG0390|consensus776 98.84
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 98.82
smart00487201 DEXDc DEAD-like helicases superfamily. 98.78
COG2510140 Predicted membrane protein [Function unknown] 98.76
KOG0387|consensus 923 98.74
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 98.71
CHL00122 870 secA preprotein translocase subunit SecA; Validate 98.68
PRK14873665 primosome assembly protein PriA; Provisional 98.6
PF04851184 ResIII: Type III restriction enzyme, res subunit; 98.57
COG4889 1518 Predicted helicase [General function prediction on 98.55
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 98.54
PF06800269 Sugar_transport: Sugar transport protein; InterPro 98.54
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.49
COG2510140 Predicted membrane protein [Function unknown] 98.45
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 98.43
PF00892126 EamA: EamA-like transporter family; InterPro: IPR0 98.42
KOG0384|consensus 1373 98.34
PF00892126 EamA: EamA-like transporter family; InterPro: IPR0 98.31
PF13536113 EmrE: Multidrug resistance efflux transporter 98.3
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 98.22
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.15
KOG1000|consensus689 98.14
PRK15430296 putative chloramphenical resistance permease RarD; 98.11
TIGR00688256 rarD rarD protein. This uncharacterized protein is 98.05
KOG0389|consensus941 98.03
KOG0392|consensus1549 98.0
KOG0952|consensus1230 98.0
TIGR00950260 2A78 Carboxylate/Amino Acid/Amine Transporter. 97.93
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 97.9
TIGR03340281 phn_DUF6 phosphonate utilization associated putati 97.89
PRK13499345 rhamnose-proton symporter; Provisional 97.89
PF05653300 Mg_trans_NIPA: Magnesium transporter NIPA; InterPr 97.87
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 97.84
KOG0330|consensus476 97.79
KOG1002|consensus791 97.78
PF03151153 TPT: Triose-phosphate Transporter family; InterPro 97.67
PLN00411358 nodulin MtN21 family protein; Provisional 97.6
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 97.59
PRK15051111 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl 97.46
PRK10532293 threonine and homoserine efflux system; Provisiona 97.45
KOG0386|consensus 1157 97.45
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 97.4
COG2962293 RarD Predicted permeases [General function predict 97.4
PRK11453299 O-acetylserine/cysteine export protein; Provisiona 97.33
PRK11689295 aromatic amino acid exporter; Provisional 97.33
PF13536113 EmrE: Multidrug resistance efflux transporter 97.23
PRK11272292 putative DMT superfamily transporter inner membran 97.22
KOG1580|consensus337 97.22
KOG2922|consensus335 97.14
COG4975288 GlcU Putative glucose uptake permease [Carbohydrat 97.12
COG0610 962 Type I site-specific restriction-modification syst 97.01
KOG4439|consensus901 96.95
PRK02971129 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl 96.89
PF06027334 DUF914: Eukaryotic protein of unknown function (DU 96.81
PRK02971129 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl 96.81
TIGR00776290 RhaT RhaT L-rhamnose-proton symporter family prote 96.65
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.64
PF1324576 AAA_19: Part of AAA domain 96.59
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 96.53
KOG0343|consensus 758 96.42
KOG1581|consensus327 96.29
KOG1802|consensus935 96.21
KOG1583|consensus330 96.2
PRK10452120 multidrug efflux system protein MdtJ; Provisional 96.18
PF04142244 Nuc_sug_transp: Nucleotide-sugar transporter; Inte 96.17
COG0697292 RhaT Permeases of the drug/metabolite transporter 96.15
PRK13499345 rhamnose-proton symporter; Provisional 96.13
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 96.07
KOG1803|consensus649 96.06
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.03
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 95.95
PRK15051111 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl 95.69
PRK09541110 emrE multidrug efflux protein; Reviewed 95.66
smart00488289 DEXDc2 DEAD-like helicases superfamily. 95.58
smart00489289 DEXDc3 DEAD-like helicases superfamily. 95.58
PRK11431105 multidrug efflux system protein; Provisional 95.54
KOG0391|consensus 1958 95.47
TIGR00376637 DNA helicase, putative. The gene product may repre 95.41
PRK10650109 multidrug efflux system protein MdtI; Provisional 95.38
PRK15483 986 type III restriction-modification system StyLTI en 95.28
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 95.27
COG2076106 EmrE Membrane transporters of cations and cationic 95.26
PF04657138 DUF606: Protein of unknown function, DUF606; Inter 95.07
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.02
KOG1582|consensus367 94.92
PRK06526254 transposase; Provisional 94.07
PRK04296190 thymidine kinase; Provisional 93.98
PRK08181269 transposase; Validated 93.96
COG1484254 DnaC DNA replication protein [DNA replication, rec 93.95
PF06800269 Sugar_transport: Sugar transport protein; InterPro 93.81
TIGR00803222 nst UDP-galactose transporter. NSTs generally appe 93.69
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 93.56
PRK10452120 multidrug efflux system protein MdtJ; Provisional 93.41
PF1324576 AAA_19: Part of AAA domain 93.41
COG5006292 rhtA Threonine/homoserine efflux transporter [Amin 93.35
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 93.33
PRK09541110 emrE multidrug efflux protein; Reviewed 93.32
KOG2234|consensus345 93.22
PF0089393 Multi_Drug_Res: Small Multidrug Resistance protein 93.13
PF07857254 DUF1632: CEO family (DUF1632); InterPro: IPR012435 92.94
PRK08727233 hypothetical protein; Validated 92.92
PRK10536262 hypothetical protein; Provisional 92.85
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 92.79
KOG3912|consensus372 92.74
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 92.66
COG2076106 EmrE Membrane transporters of cations and cationic 92.64
KOG0058|consensus716 92.51
KOG1805|consensus1100 92.47
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 92.43
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 92.43
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 92.39
PHA03368738 DNA packaging terminase subunit 1; Provisional 92.06
KOG4510|consensus346 91.99
PRK11431105 multidrug efflux system protein; Provisional 91.72
PF05653300 Mg_trans_NIPA: Magnesium transporter NIPA; InterPr 91.72
PRK10650109 multidrug efflux system protein MdtI; Provisional 91.4
PRK08084235 DNA replication initiation factor; Provisional 91.35
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 91.34
PRK12377248 putative replication protein; Provisional 91.32
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 91.21
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 91.17
PRK06921266 hypothetical protein; Provisional 91.08
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 90.91
COG3238150 Uncharacterized protein conserved in bacteria [Fun 90.89
PF10639113 UPF0546: Uncharacterised protein family UPF0546; I 90.83
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 90.78
KOG2765|consensus416 90.7
KOG0336|consensus629 90.6
PF04657138 DUF606: Protein of unknown function, DUF606; Inter 90.56
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 90.44
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 90.43
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 90.4
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 90.32
PRK10875615 recD exonuclease V subunit alpha; Provisional 90.14
PTZ00110545 helicase; Provisional 90.12
PTZ00293211 thymidine kinase; Provisional 90.07
PRK08116268 hypothetical protein; Validated 89.94
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 89.75
PF06379344 RhaT: L-rhamnose-proton symport protein (RhaT); In 89.75
PHA03311 828 helicase-primase subunit BBLF4; Provisional 89.74
PRK06893229 DNA replication initiation factor; Validated 89.67
COG2256436 MGS1 ATPase related to the helicase subunit of the 89.63
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 89.63
PF13173128 AAA_14: AAA domain 89.52
PRK07952244 DNA replication protein DnaC; Validated 89.52
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 89.46
PTZ00424401 helicase 45; Provisional 89.45
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 89.01
PRK05642234 DNA replication initiation factor; Validated 88.99
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 88.98
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 88.94
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 88.94
KOG2340|consensus698 88.81
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 88.75
KOG0335|consensus482 88.72
COG3973747 Superfamily I DNA and RNA helicases [General funct 88.62
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 88.52
COG4975288 GlcU Putative glucose uptake permease [Carbohydrat 88.46
PRK08903227 DnaA regulatory inactivator Hda; Validated 88.28
PRK14974336 cell division protein FtsY; Provisional 88.07
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 88.02
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 87.82
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 87.72
KOG0388|consensus1185 87.65
KOG0331|consensus519 87.62
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 87.51
COG2255332 RuvB Holliday junction resolvasome, helicase subun 87.44
KOG0989|consensus346 87.34
KOG0388|consensus1185 87.21
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 87.12
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 86.54
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 86.53
PRK00411394 cdc6 cell division control protein 6; Reviewed 86.42
PRK01172 674 ski2-like helicase; Provisional 86.32
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 86.23
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 85.99
KOG0391|consensus 1958 85.99
PHA03333752 putative ATPase subunit of terminase; Provisional 85.93
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 85.35
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 85.23
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 85.19
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 85.06
PRK00149450 dnaA chromosomal replication initiation protein; R 84.98
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 84.67
TIGR00362405 DnaA chromosomal replication initiator protein Dna 84.5
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 84.34
KOG1015|consensus 1567 84.32
KOG0345|consensus567 84.25
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 84.11
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 84.05
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 83.99
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 83.74
PRK14087450 dnaA chromosomal replication initiation protein; P 83.74
PRK08939306 primosomal protein DnaI; Reviewed 83.47
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 83.46
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 83.31
PF13871278 Helicase_C_4: Helicase_C-like 83.3
KOG0344|consensus593 83.25
PRK02362 737 ski2-like helicase; Provisional 83.2
PRK13851344 type IV secretion system protein VirB11; Provision 83.14
KOG0348|consensus708 83.09
COG1201 814 Lhr Lhr-like helicases [General function predictio 82.94
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 82.93
PRK11823446 DNA repair protein RadA; Provisional 82.89
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 82.73
KOG2227|consensus529 82.7
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 82.57
PRK07940394 DNA polymerase III subunit delta'; Validated 82.44
COG4128398 Zot Zonula occludens toxin [General function predi 82.4
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 82.3
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 82.23
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 82.14
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 82.02
PLN03025319 replication factor C subunit; Provisional 81.83
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 81.77
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 81.64
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 81.62
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 81.62
PRK12422445 chromosomal replication initiation protein; Provis 81.6
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 81.58
PRK12402337 replication factor C small subunit 2; Reviewed 81.55
TIGR02928365 orc1/cdc6 family replication initiation protein. M 81.53
PRK04195482 replication factor C large subunit; Provisional 81.46
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 81.33
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 81.29
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 81.11
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 80.79
PRK13342413 recombination factor protein RarA; Reviewed 80.56
PF04851184 ResIII: Type III restriction enzyme, res subunit; 80.48
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 80.29
PHA02544316 44 clamp loader, small subunit; Provisional 80.18
smart00489289 DEXDc3 DEAD-like helicases superfamily. 80.12
smart00488289 DEXDc2 DEAD-like helicases superfamily. 80.12
>KOG0953|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.4e-72  Score=630.33  Aligned_cols=408  Identities=63%  Similarity=1.084  Sum_probs=387.3

Q ss_pred             eehhhhHhhcCcCcccchHhHHHHHHHhhCCCCCcccccccccCCCCCCccCccccccCceEEEEECCCCCCcchHHHHH
Q psy12699        734 LHVVLSDIIQGAGHVDDMFPYYLRHAKQMFPHLDCMDDLKKISDLRNPAEWYPNARSISRRIIFHAGPTNSGKTYHALER  813 (1269)
Q Consensus       734 ~~~~l~~i~~~~~~v~~~~~~~l~~~k~~~p~~~~~~~l~~i~~l~~~~~~~~~~~~~~r~~v~~~g~TGsGKT~~al~~  813 (1269)
                      ++++.+++..++.+++++||+|.+|++|.||+++++|+++++.|++.|.+|||++|.++|++++++||||||||+.|++.
T Consensus       132 l~i~~~di~~g~~~~~~lfp~f~~~~k~~fp~l~~~Ddl~~isDLt~P~~WyP~AR~~~RkIi~H~GPTNSGKTy~ALqr  211 (700)
T KOG0953|consen  132 LHILTNDIRKGAKDIDFLFPFFLRHAKQEFPELTRMDDLKKISDLTNPANWYPEARKIRRKIIMHVGPTNSGKTYRALQR  211 (700)
T ss_pred             hhhhhhhhhcCCCchhhhhhHHHHHHHHHhcccccchhhhhhhccCCCcccCchhHhhhheEEEEeCCCCCchhHHHHHH
Confidence            35788999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhhcccccCCceEEeccCCCCchHHHHHHHhcCCcEEEEcchHHHHHHHHHHHhccCCCceeeecceeeeccCCCCCC
Q psy12699        814 FLSAESGVYCGPLKIHAGPTNSGKTYHALERFLSAESGVYCGPLKMLATEVFKKSNDRGTPCDLITGEEKKFIQGEEKPA  893 (1269)
Q Consensus       814 ~l~~~~~l~~g~~vlv~apTGsGKTl~~l~~l~~~~~~lil~Ptr~La~Qi~~~l~~~g~~v~~~~G~~~~~~~~~~~~~  893 (1269)
                      +                               ...++++|+.|.|.||.++++++++.|++|.++||++++....+...+
T Consensus       212 l-------------------------------~~aksGvycGPLrLLA~EV~~r~na~gipCdL~TGeE~~~~~~~~~~a  260 (700)
T KOG0953|consen  212 L-------------------------------KSAKSGVYCGPLRLLAHEVYDRLNALGIPCDLLTGEERRFVLDNGNPA  260 (700)
T ss_pred             H-------------------------------hhhccceecchHHHHHHHHHHHhhhcCCCccccccceeeecCCCCCcc
Confidence            9                               566899999999999999999999999999999999999988877789


Q ss_pred             CEEEEccccccCCCCeeEEEEecccccccCCchhHHHHHHhccCcceEEEEeecCChHHHHHHHHHcCCceEEEecccCC
Q psy12699        894 NHVACTVEMTSVNIPYEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAGAVDLVKAIMMTTNEDVEVYKYKRLT  973 (1269)
Q Consensus       894 ~Ivv~T~e~~~~l~~~~~lViDEah~~~d~~rg~~~~~~ll~l~~~~~~l~~s~~~~~~~~~l~~~~~~~~~v~~~~r~~  973 (1269)
                      +++-||+||.+....+++.||||+|+|.|++|||+|+++++|+.++++|+||.+...+++++++..+|++++++.|+|..
T Consensus       261 ~hvScTVEM~sv~~~yeVAViDEIQmm~Dp~RGwAWTrALLGl~AdEiHLCGepsvldlV~~i~k~TGd~vev~~YeRl~  340 (700)
T KOG0953|consen  261 QHVSCTVEMVSVNTPYEVAVIDEIQMMRDPSRGWAWTRALLGLAADEIHLCGEPSVLDLVRKILKMTGDDVEVREYERLS  340 (700)
T ss_pred             cceEEEEEEeecCCceEEEEehhHHhhcCcccchHHHHHHHhhhhhhhhccCCchHHHHHHHHHhhcCCeeEEEeecccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccccccccCCcCCCCEEEEecHHhHHHHHHHHHhcCCc-eEEEeCCCChhhHHHHhcccCCCCCCccchhhhhhhc
Q psy12699        974 ELQIEDSAVGSLDNIQPGDCIVCFSKNDVYTVSRGIESRGTE-VAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIG 1052 (1269)
Q Consensus       974 ~l~~~~~~~~~l~~~~~g~~iv~~s~~~~~~l~~~L~~~~~~-~~~i~g~l~~~~r~~~~~~f~~~~~~~~~l~~t~~~~ 1052 (1269)
                      |+.+.+..+..++++++|||+|+|||+++..+...+++.+.. +++|||++||++|.+|+                    
T Consensus       341 pL~v~~~~~~sl~nlk~GDCvV~FSkk~I~~~k~kIE~~g~~k~aVIYGsLPPeTr~aQA--------------------  400 (700)
T KOG0953|consen  341 PLVVEETALGSLSNLKPGDCVVAFSKKDIFTVKKKIEKAGNHKCAVIYGSLPPETRLAQA--------------------  400 (700)
T ss_pred             cceehhhhhhhhccCCCCCeEEEeehhhHHHHHHHHHHhcCcceEEEecCCCCchhHHHH--------------------
Confidence            999999999999999999999999999999999999998766 99999999999999999                    


Q ss_pred             cCccccccccCCceeEEEcCCCCHHhHHHHhhhccCCCCCeeEEEEcCccccccccCceEEEEcCCCCCCcccCCccccc
Q psy12699       1053 MGLNFRGIESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNLSIRRVIFYSLIKPSLNEKGEREID 1132 (1269)
Q Consensus      1053 ~~~~~~~l~~~gi~v~~~Hg~l~~~eR~~v~~~F~~~~g~~~VLVaTdv~~~GIDi~v~~VI~~~~~k~~~~~~G~~~~~ 1132 (1269)
                                                     ..|++|+++++||||||+++||+|++|++||++++.||+    | +++.
T Consensus       401 -------------------------------~~FNd~~~e~dvlVAsDAIGMGLNL~IrRiiF~sl~Kys----g-~e~~  444 (700)
T KOG0953|consen  401 -------------------------------ALFNDPSNECDVLVASDAIGMGLNLNIRRIIFYSLIKYS----G-RETE  444 (700)
T ss_pred             -------------------------------HHhCCCCCccceEEeecccccccccceeEEEEeecccCC----c-ccce
Confidence                                           889988899999999999999999999999999999986    4 3456


Q ss_pred             cCCHhHHHHHhcccCCCCCccccccCCCCcccccccchhhhhhhhhHHHhhccCCCCcccccccceEeeCCCChHHHHHh
Q psy12699       1133 LISVSAALQIAGRAGRFNTHFEKLAGSHPALNEKGEREIDLISVSAALQIAGRAGRFNTHFEKGFVTTFKPDDLPILKNL 1212 (1269)
Q Consensus      1133 p~s~~~y~QR~GRaGR~G~~g~~~~~~~p~~~~~~~~~~~~~~~~~~~qia~~~g~~~~~~~~~~v~~~~~~~~~~l~~~ 1212 (1269)
                      +++.++..|.+|||||                                        +++.+..|+||+++.+|++.|+++
T Consensus       445 ~it~sqikQIAGRAGR----------------------------------------f~s~~~~G~vTtl~~eDL~~L~~~  484 (700)
T KOG0953|consen  445 DITVSQIKQIAGRAGR----------------------------------------FGSKYPQGEVTTLHSEDLKLLKRI  484 (700)
T ss_pred             eccHHHHHHHhhcccc----------------------------------------cccCCcCceEEEeeHhhHHHHHHH
Confidence            8888888777777777                                        345568999999999999999999


Q ss_pred             hcCCCCcccccccccCccHHHHHHhhCCCCChHHHHHHHHhhcCCCCCCeeeccCCC
Q psy12699       1213 LAQSPEPITKAGLHPTADQIELYAYHLPNSTLSNLMDIFVSLSTVDDSLYFMCNIEK 1269 (1269)
Q Consensus      1213 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1269 (1269)
                      ++++++++..++++|+.+|+|+|.+|+|+.++++++++|..+|+++ +.||+||+++
T Consensus       485 l~~p~epi~~agl~pt~eqie~fa~~~Pd~t~snLld~f~~~~~~~-~~fflc~~~~  540 (700)
T KOG0953|consen  485 LKRPVEPIKNAGLWPTDEQIELFAYHLPDATPSNLLDIFVKLCEVD-GLFFLCNLDD  540 (700)
T ss_pred             HhCCchHHHhccCCccHHHHHHHHHhCCCccHHHHHHHHHHHHccC-CceEEecchh
Confidence            9999999999999999999999999999999999999999999999 6999999975

>KOG0331|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>KOG1444|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG1441|consensus Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PTZ00343 triose or hexose phosphate/phosphate translocator; Provisional Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG1443|consensus Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG1442|consensus Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG1444|consensus Back     alignment and domain information
>PF08449 UAA: UAA transporter family; InterPro: IPR013657 This family includes transporters with a specificity for UDP-N-acetylglucosamine [] Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>COG5070 VRG4 Nucleotide-sugar transporter [Carbohydrate transport and metabolism / Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PLN00411 nodulin MtN21 family protein; Provisional Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG1581|consensus Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK11453 O-acetylserine/cysteine export protein; Provisional Back     alignment and domain information
>PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG1441|consensus Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK11272 putative DMT superfamily transporter inner membrane protein; Provisional Back     alignment and domain information
>KOG1580|consensus Back     alignment and domain information
>PRK11689 aromatic amino acid exporter; Provisional Back     alignment and domain information
>PRK10532 threonine and homoserine efflux system; Provisional Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PRK15430 putative chloramphenical resistance permease RarD; Provisional Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>KOG1582|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>COG5070 VRG4 Nucleotide-sugar transporter [Carbohydrate transport and metabolism / Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1442|consensus Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG3912|consensus Back     alignment and domain information
>KOG1583|consensus Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PTZ00343 triose or hexose phosphate/phosphate translocator; Provisional Back     alignment and domain information
>KOG4510|consensus Back     alignment and domain information
>TIGR00688 rarD rarD protein Back     alignment and domain information
>TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator Back     alignment and domain information
>KOG2765|consensus Back     alignment and domain information
>PF03151 TPT: Triose-phosphate Transporter family; InterPro: IPR004853 This family consists entirely of aligned regions from Drosophila melanogaster proteins Back     alignment and domain information
>KOG2234|consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF04142 Nuc_sug_transp: Nucleotide-sugar transporter; InterPro: IPR007271 This family of membrane proteins transport nucleotide sugars from the cytoplasm into golgi vesicles Back     alignment and domain information
>COG5006 rhtA Threonine/homoserine efflux transporter [Amino acid transport and metabolism] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG2962 RarD Predicted permeases [General function prediction only] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG2766|consensus Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1443|consensus Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>PF08449 UAA: UAA transporter family; InterPro: IPR013657 This family includes transporters with a specificity for UDP-N-acetylglucosamine [] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00803 nst UDP-galactose transporter Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>KOG4314|consensus Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG2510 Predicted membrane protein [Function unknown] Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PF06800 Sugar_transport: Sugar transport protein; InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>COG2510 Predicted membrane protein [Function unknown] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00892 EamA: EamA-like transporter family; InterPro: IPR000620 This domain is found in proteins including the Erwinia chrysanthemi PecM protein, which is involved in pectinase, cellulase and blue pigment regulation; and the Salmonella typhimurium PagO protein, the function of which is unknown Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>PF00892 EamA: EamA-like transporter family; InterPro: IPR000620 This domain is found in proteins including the Erwinia chrysanthemi PecM protein, which is involved in pectinase, cellulase and blue pigment regulation; and the Salmonella typhimurium PagO protein, the function of which is unknown Back     alignment and domain information
>PF13536 EmrE: Multidrug resistance efflux transporter Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>PRK15430 putative chloramphenical resistance permease RarD; Provisional Back     alignment and domain information
>TIGR00688 rarD rarD protein Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein Back     alignment and domain information
>PRK13499 rhamnose-proton symporter; Provisional Back     alignment and domain information
>PF05653 Mg_trans_NIPA: Magnesium transporter NIPA; InterPro: IPR008521 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>PF03151 TPT: Triose-phosphate Transporter family; InterPro: IPR004853 This family consists entirely of aligned regions from Drosophila melanogaster proteins Back     alignment and domain information
>PLN00411 nodulin MtN21 family protein; Provisional Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PRK15051 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; Provisional Back     alignment and domain information
>PRK10532 threonine and homoserine efflux system; Provisional Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG2962 RarD Predicted permeases [General function prediction only] Back     alignment and domain information
>PRK11453 O-acetylserine/cysteine export protein; Provisional Back     alignment and domain information
>PRK11689 aromatic amino acid exporter; Provisional Back     alignment and domain information
>PF13536 EmrE: Multidrug resistance efflux transporter Back     alignment and domain information
>PRK11272 putative DMT superfamily transporter inner membrane protein; Provisional Back     alignment and domain information
>KOG1580|consensus Back     alignment and domain information
>KOG2922|consensus Back     alignment and domain information
>COG4975 GlcU Putative glucose uptake permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>PRK02971 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; Provisional Back     alignment and domain information
>PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function Back     alignment and domain information
>PRK02971 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; Provisional Back     alignment and domain information
>TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG1581|consensus Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>KOG1583|consensus Back     alignment and domain information
>PRK10452 multidrug efflux system protein MdtJ; Provisional Back     alignment and domain information
>PF04142 Nuc_sug_transp: Nucleotide-sugar transporter; InterPro: IPR007271 This family of membrane proteins transport nucleotide sugars from the cytoplasm into golgi vesicles Back     alignment and domain information
>COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK13499 rhamnose-proton symporter; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15051 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; Provisional Back     alignment and domain information
>PRK09541 emrE multidrug efflux protein; Reviewed Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PRK11431 multidrug efflux system protein; Provisional Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PRK10650 multidrug efflux system protein MdtI; Provisional Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>COG2076 EmrE Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF04657 DUF606: Protein of unknown function, DUF606; InterPro: IPR006750 This family contains uncharacterised bacterial proteins Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG1582|consensus Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF06800 Sugar_transport: Sugar transport protein; InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long Back     alignment and domain information
>TIGR00803 nst UDP-galactose transporter Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK10452 multidrug efflux system protein MdtJ; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>COG5006 rhtA Threonine/homoserine efflux transporter [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09541 emrE multidrug efflux protein; Reviewed Back     alignment and domain information
>KOG2234|consensus Back     alignment and domain information
>PF00893 Multi_Drug_Res: Small Multidrug Resistance protein; InterPro: IPR000390 Members of this family which have been characterised, belong to the small multidrug resistance (Smr) protein family and are integral membrane proteins Back     alignment and domain information
>PF07857 DUF1632: CEO family (DUF1632); InterPro: IPR012435 These sequences are found in hypothetical eukaryotic proteins of unknown function Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG3912|consensus Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG2076 EmrE Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>KOG4510|consensus Back     alignment and domain information
>PRK11431 multidrug efflux system protein; Provisional Back     alignment and domain information
>PF05653 Mg_trans_NIPA: Magnesium transporter NIPA; InterPro: IPR008521 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PRK10650 multidrug efflux system protein MdtI; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>COG3238 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10639 UPF0546: Uncharacterised protein family UPF0546; InterPro: IPR018908 This family of proteins has no known function Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>KOG2765|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PF04657 DUF606: Protein of unknown function, DUF606; InterPro: IPR006750 This family contains uncharacterised bacterial proteins Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PF06379 RhaT: L-rhamnose-proton symport protein (RhaT); InterPro: IPR004673 These proteins are members of the L-Rhamnose Symporter (RhaT) family Back     alignment and domain information
>PHA03311 helicase-primase subunit BBLF4; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>COG4975 GlcU Putative glucose uptake permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG2227|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG4128 Zot Zonula occludens toxin [General function prediction only] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1269
3rc8_A 677 Human Mitochondrial Helicase Suv3 In Complex With S 1e-165
3rc3_A 677 Human Mitochondrial Helicase Suv3 Length = 677 1e-161
>pdb|3RC8|A Chain A, Human Mitochondrial Helicase Suv3 In Complex With Short Rna Fragment Length = 677 Back     alignment and structure 
Iteration: 1

 Score =  578 bits (1491), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 292/557 (52%), Positives = 363/557 (65%), Gaps = 123/557 (22%)
Query: 712  LQHQAYISFRRYCLETQSLPVDLHVVLSDIIQGAGHVDDMFPYYLRHAKQMFPHLDCMDD 771
            L HQA+ISFR Y +++ SL VD+H+VL+DI  GA H DD+FP++LRHAKQ+FP LDC DD
Sbjct: 74   LFHQAFISFRNYIMQSHSLDVDIHIVLNDICFGAAHADDLFPFFLRHAKQIFPVLDCKDD 133
Query: 772  LKKISDLRNPAEWYPNARSISRRIIFHAGPTNSGKTYHALERFLSAESGVYCGPLKIHAG 831
            L+KISDLR P  WYP+AR++ R+IIFH+G                               
Sbjct: 134  LRKISDLRIPPNWYPDARAMQRKIIFHSG------------------------------- 162
Query: 832  PTNSGKTYHALERFLSAESGVYCGPLKMLATEVFKKSNDRGTPCDLITGEEKKFIQGEEK 891
            PTNSGKTYHA++++ SA+SGVYCGPLK+LA E+F+KSN  G PCDL+TGEE+  +Q   K
Sbjct: 163  PTNSGKTYHAIQKYFSAKSGVYCGPLKLLAHEIFEKSNAAGVPCDLVTGEERVTVQPNGK 222
Query: 892  PANHVACTVEMTSVNIPYEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAGAVD 951
             A+HV+CTVEM SV  PYEVAVIDEIQM+RD  RGWAWTRALLGL A+E+H+CGE  A+D
Sbjct: 223  QASHVSCTVEMCSVTTPYEVAVIDEIQMIRDPARGWAWTRALLGLCAEEVHLCGEPAAID 282
Query: 952  LVKAIMMTTNEDVEVYKYKRLTELQIEDSAVGSLDNIQPGDCIVCFSKNDVYTVSRGIES 1011
            LV  +M TT E+VEV  YKRLT + + D A+ SLDN++PGDCIVCFSKND+Y+VSR IE 
Sbjct: 283  LVMELMYTTGEEVEVRDYKRLTPISVLDHALESLDNLRPGDCIVCFSKNDIYSVSRQIEI 342
Query: 1012 RGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNFRGIESRGTEVAVIY 1071
            RG E AVIYGSLPP TKLAQA KFNDP++PCK++VATDAIGMGLN               
Sbjct: 343  RGLESAVIYGSLPPGTKLAQAKKFNDPNDPCKILVATDAIGMGLN--------------- 387
Query: 1072 GSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNLSIRRVIFYSLIKPSLNEKGEREI 1131
                                                LSIRR+IFYSLIKPS+NEKGERE+
Sbjct: 388  ------------------------------------LSIRRIIFYSLIKPSINEKGEREL 411
Query: 1132 DLISVSAALQIAGRAGRFNTHFEKLAGSHPALNEKGEREIDLISVSAALQIAGRAGRFNT 1191
            + I+ S ALQIAGRAGRF                                        ++
Sbjct: 412  EPITTSQALQIAGRAGRF----------------------------------------SS 431
Query: 1192 HFEKGFVTTFKPDDLPILKNLLAQSPEPITKAGLHPTADQIELYAYHLPNSTLSNLMDIF 1251
             F++G VTT   +DL +LK +L +  +PI  AGLHPTA+QIE++AYHLP++TLSNL+DIF
Sbjct: 432  RFKEGEVTTMNHEDLSLLKEILKRPVDPIRAAGLHPTAEQIEMFAYHLPDATLSNLIDIF 491
Query: 1252 VSLSTVDDSLYFMCNIE 1268
            V  S VD   YF+CN++
Sbjct: 492  VDFSQVDGQ-YFVCNMD 507
>pdb|3RC3|A Chain A, Human Mitochondrial Helicase Suv3 Length = 677 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1269
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 1e-142
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 8e-14
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 4e-09
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 3e-14
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 6e-13
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 6e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
1yks_A440 Genome polyprotein [contains: flavivirin protease 8e-07
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 4e-06
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 6e-05
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 7e-05
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 8e-05
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 1e-04
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 1e-04
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 9e-04
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 2e-04
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 2e-04
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 4e-04
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 9e-04
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Length = 677 Back     alignment and structure
 Score =  445 bits (1145), Expect = e-142
 Identities = 290/560 (51%), Positives = 363/560 (64%), Gaps = 123/560 (21%)

Query: 709  NRYLQHQAYISFRRYCLETQSLPVDLHVVLSDIIQGAGHVDDMFPYYLRHAKQMFPHLDC 768
            +  L HQA+ISFR Y +++ SL VD+H+VL+DI  GA H DD+FP++LRHAKQ+FP LDC
Sbjct: 71   DARLFHQAFISFRNYIMQSHSLDVDIHIVLNDICFGAAHADDLFPFFLRHAKQIFPVLDC 130

Query: 769  MDDLKKISDLRNPAEWYPNARSISRRIIFHAGPTNSGKTYHALERFLSAESGVYCGPLKI 828
             DDL+KISDLR P  WYP+AR++ R+IIFH+GPTNSG                       
Sbjct: 131  KDDLRKISDLRIPPNWYPDARAMQRKIIFHSGPTNSG----------------------- 167

Query: 829  HAGPTNSGKTYHALERFLSAESGVYCGPLKMLATEVFKKSNDRGTPCDLITGEEKKFIQG 888
                    KTYHA++++ SA+SGVYCGPLK+LA E+F+KSN  G PCDL+TGEE+  +Q 
Sbjct: 168  --------KTYHAIQKYFSAKSGVYCGPLKLLAHEIFEKSNAAGVPCDLVTGEERVTVQP 219

Query: 889  EEKPANHVACTVEMTSVNIPYEVAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAG 948
              K A+HV+CTVEM SV  PYEVAVIDEIQM+RD  RGWAWTRALLGL A+E+H+CGE  
Sbjct: 220  NGKQASHVSCTVEMCSVTTPYEVAVIDEIQMIRDPARGWAWTRALLGLCAEEVHLCGEPA 279

Query: 949  AVDLVKAIMMTTNEDVEVYKYKRLTELQIEDSAVGSLDNIQPGDCIVCFSKNDVYTVSRG 1008
            A+DLV  +M TT E+VEV  YKRLT + + D A+ SLDN++PGDCIVCFSKND+Y+VSR 
Sbjct: 280  AIDLVMELMYTTGEEVEVRDYKRLTPISVLDHALESLDNLRPGDCIVCFSKNDIYSVSRQ 339

Query: 1009 IESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNFRGIESRGTEVA 1068
            IE RG E AVIYGSLPP TKLAQA KFNDP++PCK++VATDAIGMGLN            
Sbjct: 340  IEIRGLESAVIYGSLPPGTKLAQAKKFNDPNDPCKILVATDAIGMGLNL----------- 388

Query: 1069 VIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNLSIRRVIFYSLIKPSLNEKGE 1128
                                                    SIRR+IFYSLIKPS+NEKGE
Sbjct: 389  ----------------------------------------SIRRIIFYSLIKPSINEKGE 408

Query: 1129 REIDLISVSAALQIAGRAGRFNTHFEKLAGSHPALNEKGEREIDLISVSAALQIAGRAGR 1188
            RE++ I+ S                                +         LQIAGRAGR
Sbjct: 409  RELEPITTS--------------------------------QA--------LQIAGRAGR 428

Query: 1189 FNTHFEKGFVTTFKPDDLPILKNLLAQSPEPITKAGLHPTADQIELYAYHLPNSTLSNLM 1248
            F++ F++G VTT   +DL +LK +L +  +PI  AGLHPTA+QIE++AYHLP++TLSNL+
Sbjct: 429  FSSRFKEGEVTTMNHEDLSLLKEILKRPVDPIRAAGLHPTAEQIEMFAYHLPDATLSNLI 488

Query: 1249 DIFVSLSTVDDSLYFMCNIE 1268
            DIFV  S VD   YF+CN++
Sbjct: 489  DIFVDFSQVDG-QYFVCNMD 507
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Length = 677 Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Length = 677 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Length = 997 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1269
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.97
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.97
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.97
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.97
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.97
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.97
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.97
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.97
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 99.97
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.97
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.97
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.97
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.96
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.96
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.96
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.96
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.96
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.96
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.96
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.96
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.96
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.96
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.96
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.96
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.96
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.95
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.95
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.94
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.94
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.94
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.94
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.94
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.94
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.94
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.93
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.93
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.93
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.93
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.93
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.92
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.92
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.92
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.92
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.92
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.92
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.91
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.91
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.91
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.9
3h1t_A590 Type I site-specific restriction-modification syst 99.87
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.85
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.8
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.76
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.7
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.69
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.69
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.66
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.66
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.65
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.64
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.63
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.63
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.62
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.61
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.61
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.61
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.61
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.61
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.6
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.59
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.59
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.59
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.58
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.58
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.57
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.57
3bor_A237 Human initiation factor 4A-II; translation initiat 99.55
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.32
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.55
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.54
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.54
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.52
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.35
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.32
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.28
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.26
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.25
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.24
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.08
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 98.74
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 98.47
2i68_A137 Protein EMRE; transmembrane protein, small-multidr 97.46
3b5d_A110 Multidrug transporter EMRE; helical membrane prote 97.41
2i68_A137 Protein EMRE; transmembrane protein, small-multidr 97.36
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 97.32
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 97.1
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 96.85
3b5d_A110 Multidrug transporter EMRE; helical membrane prote 96.68
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 96.54
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 96.35
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 96.35
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.26
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 95.96
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.61
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 95.53
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 95.42
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 95.26
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 94.39
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 94.1
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 93.73
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 93.64
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 93.51
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 93.21
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 92.98
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 92.91
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 92.71
1yks_A440 Genome polyprotein [contains: flavivirin protease 92.55
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 92.54
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 92.42
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 92.4
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 92.23
2kjq_A149 DNAA-related protein; solution structure, NESG, st 92.21
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 92.2
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 92.08
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 92.07
3bor_A237 Human initiation factor 4A-II; translation initiat 91.99
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 91.87
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 91.81
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 91.56
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 91.56
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 91.2
3bos_A242 Putative DNA replication factor; P-loop containing 91.2
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 90.94
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 90.82
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 90.76
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 90.69
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 90.63
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 90.36
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 90.14
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 90.12
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 89.73
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 89.71
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 89.64
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 89.52
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 89.4
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 89.06
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 88.94
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 88.86
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 88.83
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 87.91
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 87.91
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 87.52
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 87.22
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 87.16
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 86.63
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 86.27
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 85.86
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 85.74
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 85.63
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 85.35
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 85.11
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 84.98
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 84.8
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 84.51
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 84.37
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 84.32
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 84.28
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 84.25
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 83.98
2v1u_A387 Cell division control protein 6 homolog; DNA repli 83.95
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 83.84
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 83.45
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 83.07
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 82.61
3b6e_A216 Interferon-induced helicase C domain-containing P; 82.25
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 82.23
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 82.09
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 81.86
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 80.92
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 80.82
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 80.5
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 80.22
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 80.02
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
Probab=100.00  E-value=1.2e-59  Score=586.49  Aligned_cols=496  Identities=64%  Similarity=1.084  Sum_probs=409.2

Q ss_pred             CCCceeeeccccCCCCCCCCcccccccccCCCChhHHHHHHHHhhhhHHHHHHHHhcCCCCCCCCCccccccccccccch
Q psy12699        511 NVGQELTVPVHVKPNTDPTDANVGQELTGGSIDKSETVKILNKFYQRQEIKIAAMDHGLDNTPSSHTKEAVSLVNYDTTI  590 (1269)
Q Consensus       511 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  590 (1269)
                      .+.++||+|+++++++.+.|.|+|.+++ +|++|.|..++||+|++|.+++.++.++|.+.                   
T Consensus        13 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------------------   72 (677)
T 3rc3_A           13 IPNTSLFVPLTVKPQGPSADGDVGAELT-RPLDKNEVKKVLDKFYKRKEIQKLGADYGLDA-------------------   72 (677)
T ss_dssp             CCCGGGCCCCCCCCC---------------CCCHHHHHHHHHHHHHCHHHHHHHHHTTCCH-------------------
T ss_pred             CCCcceEEeeeccCCCCcccccccceee-eecchHHHHHHHHHHhhcHHHHHHHHhcCcch-------------------
Confidence            3455799999999988888999999999 89999999999999999999999877777633                   


Q ss_pred             hHHHHHHHHHhHhhHhhhhhhhhhccCCCChhHHHHHHHHHHHHHHHHHHHHcCccccCCCChhhhhhhchhhHHHHHHH
Q psy12699        591 AKISTALFYALCSLFITIVNKSVLTSYVFPSFKIVALGQLLTTVVVLYVGKKLRFIQFPNYHRNIFFELMPLPFIYLGNM  670 (1269)
Q Consensus       591 ~~~~~~~~y~~~S~~~~~~NK~~l~~~~f~~~~~l~~~q~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~p~~~~~~~~i  670 (1269)
                                                         ..+|+.+                                      
T Consensus        73 -----------------------------------~~~~~~~--------------------------------------   79 (677)
T 3rc3_A           73 -----------------------------------RLFHQAF--------------------------------------   79 (677)
T ss_dssp             -----------------------------------HHHHHHH--------------------------------------
T ss_pred             -----------------------------------HHHHHHH--------------------------------------
Confidence                                               1112111                                      


Q ss_pred             hhhhhcccccCchHHHHhhhhhHHHHHHHhhhhcccccchhhHHHHHHhhhheeeeccCCCcceehhhhHhhcCcCcccc
Q psy12699        671 VFGLGGTKELSLPMFTMLRRFSILMTMIAEYYVLHIVPNRYLQHQAYISFRRYCLETQSLPVDLHVVLSDIIQGAGHVDD  750 (1269)
Q Consensus       671 ~~~~~sl~~~sV~f~~~~k~~t~~~~~~~~~~~~~~~~s~~~~~s~~~~~g~~~~~~~d~~f~~~~~l~~i~~~~~~v~~  750 (1269)
                                                                     +-+.-+++..+.+..+++..++++++.++++++
T Consensus        80 -----------------------------------------------~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  112 (677)
T 3rc3_A           80 -----------------------------------------------ISFRNYIMQSHSLDVDIHIVLNDICFGAAHADD  112 (677)
T ss_dssp             -----------------------------------------------HHHHHHHHHCSSCCHHHHHHHHHHHTTSSCGGG
T ss_pred             -----------------------------------------------HHHHHHhhccCCCCcchhhHHHHHhhccCcccc
Confidence                                                           011223455666778889999999999999999


Q ss_pred             hHhHHHHHHHhhCCCCCcccccccccCCCCCCccCccccccCceEEEEECCCCCCcchHHHHHHHhhhcccccCCceEEe
Q psy12699        751 MFPYYLRHAKQMFPHLDCMDDLKKISDLRNPAEWYPNARSISRRIIFHAGPTNSGKTYHALERFLSAESGVYCGPLKIHA  830 (1269)
Q Consensus       751 ~~~~~l~~~k~~~p~~~~~~~l~~i~~l~~~~~~~~~~~~~~r~~v~~~g~TGsGKT~~al~~~l~~~~~l~~g~~vlv~  830 (1269)
                      ++|+|++|+++.||++++++++++|.|++.|.+|||.++.++|++++++||||||||+.+++.+                
T Consensus       113 ~~p~f~~~~~~~fp~~e~~d~l~~i~dl~~p~~~~p~ar~l~rk~vlv~apTGSGKT~~al~~l----------------  176 (677)
T 3rc3_A          113 LFPFFLRHAKQIFPVLDCKDDLRKISDLRIPPNWYPDARAMQRKIIFHSGPTNSGKTYHAIQKY----------------  176 (677)
T ss_dssp             GHHHHHHHHHHHCGGGGCHHHHHHHTBCCCGGGGCHHHHTSCCEEEEEECCTTSSHHHHHHHHH----------------
T ss_pred             ccchHHHHHHhhCCCcCCHHHHHHHhhccChhhhCHHHHhcCCCEEEEEcCCCCCHHHHHHHHH----------------
Confidence            9999999999999999999999999999999999999999999999999999999999777666                


Q ss_pred             ccCCCCchHHHHHHHhcCCcEEEEcchHHHHHHHHHHHhccCCCceeeecceeeeccCCCCCCCEEEEccccccCCCCee
Q psy12699        831 GPTNSGKTYHALERFLSAESGVYCGPLKMLATEVFKKSNDRGTPCDLITGEEKKFIQGEEKPANHVACTVEMTSVNIPYE  910 (1269)
Q Consensus       831 apTGsGKTl~~l~~l~~~~~~lil~Ptr~La~Qi~~~l~~~g~~v~~~~G~~~~~~~~~~~~~~Ivv~T~e~~~~l~~~~  910 (1269)
                                     ...++++|++|||+||.|+++++++.|.++++++|++...........+++++|+|++.....++
T Consensus       177 ---------------~~~~~gl~l~PtR~LA~Qi~~~l~~~g~~v~lltG~~~~iv~TpGr~~~il~~T~e~~~l~~~v~  241 (677)
T 3rc3_A          177 ---------------FSAKSGVYCGPLKLLAHEIFEKSNAAGVPCDLVTGEERVTVQPNGKQASHVSCTVEMCSVTTPYE  241 (677)
T ss_dssp             ---------------HHSSSEEEEESSHHHHHHHHHHHHHTTCCEEEECSSCEECCSTTCCCCSEEEEEGGGCCSSSCEE
T ss_pred             ---------------HhcCCeEEEeCHHHHHHHHHHHHHhcCCcEEEEECCeeEEecCCCcccceeEecHhHhhhcccCC
Confidence                           34467799999999999999999999999999999987754433446899999999999999999


Q ss_pred             EEEEecccccccCCchhHHHHHHhccCcceEEEEeecCChHHHHHHHHHcCCceEEEecccCCccccccccccccCCcCC
Q psy12699        911 VAVIDEIQMMRDITRGWAWTRALLGLMAKEIHVCGEAGAVDLVKAIMMTTNEDVEVYKYKRLTELQIEDSAVGSLDNIQP  990 (1269)
Q Consensus       911 ~lViDEah~~~d~~rg~~~~~~ll~l~~~~~~l~~s~~~~~~~~~l~~~~~~~~~v~~~~r~~~l~~~~~~~~~l~~~~~  990 (1269)
                      ++||||+|+++|.+||..++.++.+++++.+.+++.++..+.++.+....+..+.+..+.+..++.+....+..+..+.+
T Consensus       242 lvVIDEaH~l~d~~~g~~~~~~l~~l~~~~i~il~~SAT~~~i~~l~~~~~~~~~v~~~~r~~~l~~~~~~l~~l~~~~~  321 (677)
T 3rc3_A          242 VAVIDEIQMIRDPARGWAWTRALLGLCAEEVHLCGEPAAIDLVMELMYTTGEEVEVRDYKRLTPISVLDHALESLDNLRP  321 (677)
T ss_dssp             EEEECSGGGGGCTTTHHHHHHHHHHCCEEEEEEEECGGGHHHHHHHHHHHTCCEEEEECCCSSCEEECSSCCCSGGGCCT
T ss_pred             EEEEecceecCCccchHHHHHHHHccCccceEEEeccchHHHHHHHHHhcCCceEEEEeeecchHHHHHHHHHHHHhcCC
Confidence            99999999999999999999999999877777777777778888888888888889888888888877666666666777


Q ss_pred             CCEEEEecHHhHHHHHHHHHhcCCceEEEeCCCChhhHHHHhcccCCCCCCccchhhhhhhccCccccccccCCceeEEE
Q psy12699        991 GDCIVCFSKNDVYTVSRGIESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNFRGIESRGTEVAVI 1070 (1269)
Q Consensus       991 g~~iv~~s~~~~~~l~~~L~~~~~~~~~i~g~l~~~~r~~~~~~f~~~~~~~~~l~~t~~~~~~~~~~~l~~~gi~v~~~ 1070 (1269)
                      |++++|+++++++.+++.|++.+..                                                   +.++
T Consensus       322 g~iIf~~s~~~ie~la~~L~~~g~~---------------------------------------------------v~~l  350 (677)
T 3rc3_A          322 GDCIVCFSKNDIYSVSRQIEIRGLE---------------------------------------------------SAVI  350 (677)
T ss_dssp             TEEEECSSHHHHHHHHHHHHHTTCC---------------------------------------------------CEEE
T ss_pred             CCEEEEcCHHHHHHHHHHHHhcCCC---------------------------------------------------eeee
Confidence            8888777999999999998775432                                                   7889


Q ss_pred             cCCCCHHhHHHHhhhccCCCCCeeEEEEcCccccccccCceEEEEcCCCCCCcccCCccccccCCHhHHHHHhcccCCCC
Q psy12699       1071 YGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNLSIRRVIFYSLIKPSLNEKGEREIDLISVSAALQIAGRAGRFN 1150 (1269)
Q Consensus      1071 Hg~l~~~eR~~v~~~F~~~~g~~~VLVaTdv~~~GIDi~v~~VI~~~~~k~~~~~~G~~~~~p~s~~~y~QR~GRaGR~G 1150 (1269)
                      ||+|++++|+++++.|++++|+++||||||++++|||+++++||++|..|++||+.|..+.+|.+.++|+||+|||||.|
T Consensus       351 HG~L~~~~R~~~~~~F~~~~g~~~VLVATdi~e~GlDi~v~~VI~~~~~k~~~~~~G~~~~~p~s~~~~~QR~GRAGR~g  430 (677)
T 3rc3_A          351 YGSLPPGTKLAQAKKFNDPNDPCKILVATDAIGMGLNLSIRRIIFYSLIKPSINEKGERELEPITTSQALQIAGRAGRFS  430 (677)
T ss_dssp             CTTSCHHHHHHHHHHHHCTTSSCCEEEECGGGGSSCCCCBSEEEESCSBC-----------CBCCHHHHHHHHTTBTCTT
T ss_pred             eccCCHHHHHHHHHHHHccCCCeEEEEeCcHHHCCcCcCccEEEECCccccccccCCccccccCCHHHHHHHhcCCCCCC
Confidence            99999999999999999333999999999999999999999999999999888887876788999999999999999966


Q ss_pred             CccccccCCCCcccccccchhhhhhhhhHHHhhccCCCCcccccccceEeeCCCChHHHHHhhcCCCCcccccccccCcc
Q psy12699       1151 THFEKLAGSHPALNEKGEREIDLISVSAALQIAGRAGRFNTHFEKGFVTTFKPDDLPILKNLLAQSPEPITKAGLHPTAD 1230 (1269)
Q Consensus      1151 ~~g~~~~~~~p~~~~~~~~~~~~~~~~~~~qia~~~g~~~~~~~~~~v~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~ 1230 (1269)
                      ++|                                        ..|.|..+..++.+.+++++...++++.++++.|..+
T Consensus       431 ~~g----------------------------------------~~G~v~~l~~~d~~~~~~~~~~~~~~i~~~~l~p~~~  470 (677)
T 3rc3_A          431 SRF----------------------------------------KEGEVTTMNHEDLSLLKEILKRPVDPIRAAGLHPTAE  470 (677)
T ss_dssp             SSC----------------------------------------SSEEEEESSTTHHHHHHHHHHSCCCCCCCEEECCCHH
T ss_pred             CCC----------------------------------------CCEEEEEEecchHHHHHHHHhcCcchhhhccCCChHH
Confidence            542                                        2467777877888899999999999999999999999


Q ss_pred             HHHHHHhhCCCCChHHHHHHHHhhcCCCCCCeeeccCCC
Q psy12699       1231 QIELYAYHLPNSTLSNLMDIFVSLSTVDDSLYFMCNIEK 1269 (1269)
Q Consensus      1231 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1269 (1269)
                      +++.+.+++|+..+.++++.+.++++++ ..|++||+++
T Consensus       471 ~l~~~~~~l~~~~l~ell~~l~~~~~vd-~~f~~~~l~~  508 (677)
T 3rc3_A          471 QIEMFAYHLPDATLSNLIDIFVDFSQVD-GQYFVCNMDD  508 (677)
T ss_dssp             HHHHHHHHSTTSCHHHHHHHHHHHCBCC-TTEEECCCHH
T ss_pred             HHHHHhccCCcchHHHHHHHHHHhhccc-chhhccchHH
Confidence            9999999999999999999999999998 7999999863
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2i68_A Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli} Back     alignment and structure
>3b5d_A Multidrug transporter EMRE; helical membrane protein, multidrug resistance transporter, SMR, antiport, inner membrane, transmembrane; HET: P4P; 3.80A {Escherichia coli K12} PDB: 3b61_A 3b62_A* Back     alignment and structure
>2i68_A Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3b5d_A Multidrug transporter EMRE; helical membrane protein, multidrug resistance transporter, SMR, antiport, inner membrane, transmembrane; HET: P4P; 3.80A {Escherichia coli K12} PDB: 3b61_A 3b62_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1269
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 8e-08
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 2e-04
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 1e-07
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 0.002
d2b8ta1139 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-term 0.003
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

 Score = 53.1 bits (127), Expect = 8e-08
 Identities = 25/95 (26%), Positives = 36/95 (37%), Gaps = 11/95 (11%)

Query: 1060 IESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNLSIRRVIFYSL- 1118
            +   G  V V+           +             ++ATD   MG NL + RV+     
Sbjct: 56   LRKAGKSVVVLNRKTFE----REYPTIKQKKPDF--ILATDIAEMGANLCVERVLDCRTA 109

Query: 1119 IKPSLNEKGER----EIDLISVSAALQIAGRAGRF 1149
             KP L ++G +        IS S+A Q  GR GR 
Sbjct: 110  FKPVLVDEGRKVAIKGPLRISASSAAQRRGRIGRN 144
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Length = 139 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1269
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.95
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.73
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.72
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.71
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.71
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.69
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.69
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.69
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.69
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.69
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.69
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.69
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.66
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.65
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.65
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.63
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.62
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.59
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.58
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.58
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.54
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.52
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.46
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.45
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.45
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.42
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.4
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.38
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.37
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.34
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.31
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.29
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.29
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.22
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.13
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.1
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.06
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.98
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.27
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.15
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 97.7
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 97.57
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 97.31
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 96.41
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 96.32
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 95.44
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 95.33
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 94.9
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 94.74
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 94.21
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 94.2
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 94.16
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 93.91
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 93.53
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 93.44
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 93.22
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 92.34
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 92.31
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 92.3
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 92.27
d1ls1a2207 GTPase domain of the signal sequence recognition p 91.45
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 91.44
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 90.98
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 90.97
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 90.68
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 90.3
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 89.83
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 89.71
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 88.91
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 88.47
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 87.56
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 87.49
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 87.0
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 86.43
d1okkd2207 GTPase domain of the signal recognition particle r 86.15
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 85.54
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 85.31
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 84.88
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 84.49
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 84.37
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 84.28
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 83.05
d2qy9a2211 GTPase domain of the signal recognition particle r 82.93
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 82.83
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 82.79
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 82.19
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 81.79
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 81.51
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 81.47
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 80.29
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]

Probab=99.95  E-value=3.4e-28  Score=276.67  Aligned_cols=275  Identities=15%  Similarity=0.052  Sum_probs=162.6

Q ss_pred             cccCCceEEeccCCCCchHHHHHH-----HhcCCcEEEEcchHHHHHHHHHHHhccCCCceeeecceeeeccCCCCCCCE
Q psy12699        821 VYCGPLKIHAGPTNSGKTYHALER-----FLSAESGVYCGPLKMLATEVFKKSNDRGTPCDLITGEEKKFIQGEEKPANH  895 (1269)
Q Consensus       821 l~~g~~vlv~apTGsGKTl~~l~~-----l~~~~~~lil~Ptr~La~Qi~~~l~~~g~~v~~~~G~~~~~~~~~~~~~~I  895 (1269)
                      +.+|+++++.||||||||++++.+     +.++.+++|++|||+||.|+++++++++..+.....+..     ......+
T Consensus         6 ~~~~~~~lv~~~TGsGKT~~~l~~~~~~~~~~~~~~lvi~Ptr~La~q~~~~l~~~~~~~~~~~~~~~-----~~~~~~i   80 (305)
T d2bmfa2           6 FRKKRLTIMDLHPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVVAAEMEEALRGLPIRYQTPAIRAE-----HTGREIV   80 (305)
T ss_dssp             SSTTCEEEECCCTTSSTTTTHHHHHHHHHHHHTCCEEEEESSHHHHHHHHHHTTTSCCBCCC-------------CCCSE
T ss_pred             hhcCCcEEEEECCCCCHHHHHHHHHHHHHHhcCCEEEEEccHHHHHHHHHHHHhcCCcceeeeEEeec-----ccCcccc
Confidence            344555566666666666544222     234789999999999999999999887654433322211     1235779


Q ss_pred             EEEcccccc-------CCCCeeEEEEecccccccCCchhHHHHHHhcc--CcceEEEEeecCChHHHHHHHHHcCCceEE
Q psy12699        896 VACTVEMTS-------VNIPYEVAVIDEIQMMRDITRGWAWTRALLGL--MAKEIHVCGEAGAVDLVKAIMMTTNEDVEV  966 (1269)
Q Consensus       896 vv~T~e~~~-------~l~~~~~lViDEah~~~d~~rg~~~~~~ll~l--~~~~~~l~~s~~~~~~~~~l~~~~~~~~~v  966 (1269)
                      +++|++.+.       .+.+++++|+||+|++.+.+  ......+..+  ..+...++.++++......   .......+
T Consensus        81 ~~~t~~~l~~~~~~~~~~~~~~~vViDE~H~~~~~~--~~~~~~l~~~~~~~~~~~v~~SAT~~~~~~~---~~~~~~~~  155 (305)
T d2bmfa2          81 DLMCHATFTMRLLSPIRVPNYNLIIMDEAHFTDPAS--IAARGYISTRVEMGEAAGIFMTATPPGSRDP---FPQSNAPI  155 (305)
T ss_dssp             EEEEHHHHHHHHTSSSCCCCCSEEEEESTTCCSHHH--HHHHHHHHHHHHHTSCEEEEECSSCTTCCCS---SCCCSSCE
T ss_pred             ccCCcHHHHHHHhcCccccceeEEEeeeeeecchhh--HHHHHHHHHhhccccceEEEeecCCCcceee---ecccCCcc
Confidence            999977442       36799999999999995422  1111111111  1222334444444311110   01111111


Q ss_pred             EecccCCccccccccccccCCcCCCCEEEEe-cHHhHHHHHHHHHhcCCceEEEeCCCChhhHHHHhcccCCCCCCccch
Q psy12699        967 YKYKRLTELQIEDSAVGSLDNIQPGDCIVCF-SKNDVYTVSRGIESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVM 1045 (1269)
Q Consensus       967 ~~~~r~~~l~~~~~~~~~l~~~~~g~~iv~~-s~~~~~~l~~~L~~~~~~~~~i~g~l~~~~r~~~~~~f~~~~~~~~~l 1045 (1269)
                      .......+..........+. -..+..++|+ ++++++++++.|++.+.+                              
T Consensus       156 ~~~~~~~~~~~~~~~~~~~~-~~~~~~lvf~~~~~~~~~l~~~L~~~~~~------------------------------  204 (305)
T d2bmfa2         156 MDEEREIPERSWNSGHEWVT-DFKGKTVWFVPSIKAGNDIAACLRKNGKK------------------------------  204 (305)
T ss_dssp             EEEECCCCCSCCSSCCHHHH-SSCSCEEEECSCHHHHHHHHHHHHHHTCC------------------------------
T ss_pred             eEEEEeccHHHHHHHHHHHH-hhCCCEEEEeccHHHHHHHHHHHHhCCCC------------------------------
Confidence            11111111111111111111 1345677777 999999999999887765                              


Q ss_pred             hhhhhhccCccccccccCCceeEEEcCCCCHHhHHHHhhhccCCCCCeeEEEEcCccccccccCceEEEEcCCCCCC---
Q psy12699       1046 VATDAIGMGLNFRGIESRGTEVAVIYGSLPPTTKLAQASKFNDPDNPCKVMVATDAIGMGLNLSIRRVIFYSLIKPS--- 1122 (1269)
Q Consensus      1046 ~~t~~~~~~~~~~~l~~~gi~v~~~Hg~l~~~eR~~v~~~F~~~~g~~~VLVaTdv~~~GIDi~v~~VI~~~~~k~~--- 1122 (1269)
                                           +..+||++++++|    ..|+  +|..+++|||+++++|+|+++++||+++.....   
T Consensus       205 ---------------------~~~l~~~~~~~~~----~~~~--~~~~~~lvaT~~~~~G~~~~~~~Vi~~~~~~~~~~~  257 (305)
T d2bmfa2         205 ---------------------VIQLSRKTFDSEY----IKTR--TNDWDFVVTTDISEMGANFKAERVIDPRRCMKPVIL  257 (305)
T ss_dssp             ---------------------CEECCTTCHHHHG----GGGG--TSCCSEEEECGGGGTTCCCCCSEEEECCEEEEEEEE
T ss_pred             ---------------------EEEeCCcChHHHH----hhhh--ccchhhhhhhHHHHhcCCCCccEEEEcCCceeeeEe
Confidence                                 3445666655444    5677  899999999999999999999999987753211   


Q ss_pred             cccCCc-c--ccccCCHhHHHHHhcccCCCCCcccc--ccCCCCcc
Q psy12699       1123 LNEKGE-R--EIDLISVSAALQIAGRAGRFNTHFEK--LAGSHPAL 1163 (1269)
Q Consensus      1123 ~~~~G~-~--~~~p~s~~~y~QR~GRaGR~G~~g~~--~~~~~p~~ 1163 (1269)
                      ++.... .  ...|.|.++|+||+||+||.|+++..  +....|.+
T Consensus       258 ~~~~~~~~~~~~~~~s~~~~~Qr~GR~GR~~~~~~~~~~~~~~~~~  303 (305)
T d2bmfa2         258 TDGEERVILAGPMPVTHSSAAQRRGRVGRNPKNENDQYIYMGEPLE  303 (305)
T ss_dssp             CSSSCEEEEEEEEECCHHHHHHHHTTSSCSSSCCCEEEEECSCCCC
T ss_pred             cCCCCceEEeccccCCHHHHhhhhcCcCcCCCCceEEEEECCCCCC
Confidence            122111 1  13589999999999999999988765  44444443
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure