Psyllid ID: psy12724


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------
FVFWPVAVISQYYEAQVYDVFVIKGNAAVFKCNLPSFVSDHLDVVSWADTDGGQYQIDNQDFVVSQSYTVNIMDEHVLKGNSAVLKCHIPSFVADYVAVESWISDQGEELFVDMTESTDGKYLVLPSGELHIRDVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
ccEEccEEEEEEEEccccEEEEEEEEEEEEEEccccccccEEEEEEEEEccccEEEEEcccEEEEEccEEEEcEEEEEEcccEEEEccccccccccEEEEEEEEcccccEEEEccccccccEEEcccccEEEEcccccccccccEEEEEcccccEEEEEccccEEEc
cccccccHEEEEEcccccccccEEEEEEEcccccHHHHHHHHHHEEEEEccccccEEccccEEEEEEEEEEEEccEEEEccEEEEEEEcccHHHHHEEEEEEEcccccEEEcccccccccEEEEEcccEEEEEEcccccccccEEEEEEEEccccEEEEccccEEEc
FVFWPVAVISQYYEAQVYDVFVIKGNAavfkcnlpsfvsdhldvvswadtdggqyqidnqdfVVSQSYTVNIMDEHVLKGNSAVLKCHIPSFVADYVAVESWISDQGEELFVDmtestdgkylvlpsgelhirdvgpedgyksyqcrtkhrltgetrlsatkgrlvi
FVFWPVAVISQYYEAQVYDVFVIKGNAAVFKCNLPSFVSDHLDVVSWADTDGGQYQIDNQDFVVSQSYTVNIMDEHVLKGNSAVLKCHIPSFVADYVAVESWISDQGEELFVDMTESTDGKYLVLPSGELHirdvgpedgyksyqcrtkhrltgetrlsatkgrlvi
FVFWPVAVISQYYEAQVYDVFVIKGNAAVFKCNLPSFVSDHLDVVSWADTDGGQYQIDNQDFVVSQSYTVNIMDEHVLKGNSAVLKCHIPSFVADYVAVESWISDQGEELFVDMTESTDGKYLVLPSGELHIRDVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
*VFWPVAVISQYYEAQVYDVFVIKGNAAVFKCNLPSFVSDHLDVVSWADTDGGQYQIDNQDFVVSQSYTVNIMDEHVLKGNSAVLKCHIPSFVADYVAVESWISDQGEELFVDMTESTDGKYLVLPSGELHIRDVGPEDGYKSYQC*********************
FVFWPVAVISQYYEAQVYDVFVIKGNAAVFKCNLPSFVSDHLDVVSWADTDGGQYQIDNQDFVVSQSYTVNIMDEHVLKGNSAVLKCHIPSFVADYVAVESWISDQGEELF******T**KYLVLPSGELHIRDVGPEDGYKSYQCRTKHRLTGETRLSA*KGRLVI
FVFWPVAVISQYYEAQVYDVFVIKGNAAVFKCNLPSFVSDHLDVVSWADTDGGQYQIDNQDFVVSQSYTVNIMDEHVLKGNSAVLKCHIPSFVADYVAVESWISDQGEELFVDMTESTDGKYLVLPSGELHIRDVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
FVFWPVAVISQYYEAQVYDVFVIKGNAAVFKCNLPSFVSDHLDVVSWADTDGGQYQIDNQDFVVSQSYTVNIMDEHVLKGNSAVLKCHIPSFVADYVAVESWISDQGEELFVDMTESTDGKYLVLPSGELHIRDVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FVFWPVAVISQYYEAQVYDVFVIKGNAAVFKCNLPSFVSDHLDVVSWADTDGGQYQIDNQDFVVSQSYTVNIMDEHVLKGNSAVLKCHIPSFVADYVAVESWISDQGEELFVDMTESTDGKYLVLPSGELHIRDVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query167 2.2.26 [Sep-21-2011]
Q8VHZ8 2013 Down syndrome cell adhesi yes N/A 0.862 0.071 0.341 7e-16
Q9ERC8 2013 Down syndrome cell adhesi yes N/A 0.862 0.071 0.341 8e-16
O60469 2012 Down syndrome cell adhesi yes N/A 0.862 0.071 0.335 9e-16
Q4VA61 2053 Down syndrome cell adhesi no N/A 0.694 0.056 0.349 3e-13
Q8TD84 2053 Down syndrome cell adhesi no N/A 0.694 0.056 0.357 2e-12
Q9VS29 2074 Down syndrome cell adhesi no N/A 0.616 0.049 0.342 3e-12
Q9BWV1 1114 Brother of CDO OS=Homo sa no N/A 0.538 0.080 0.285 3e-05
>sp|Q8VHZ8|DSCAM_RAT Down syndrome cell adhesion molecule homolog OS=Rattus norvegicus GN=Dscam PE=1 SV=1 Back     alignment and function desciption
 Score = 83.2 bits (204), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 84/161 (52%), Gaps = 17/161 (10%)

Query: 16  QVYDVFVIK-----GNAAVFKCNLPSFVSDHLDVVSWADTDGGQYQIDNQDF----VVSQ 66
           ++YDV  I+     G   +F     SF +   D   +   +    +I +QD     V+ +
Sbjct: 65  EIYDVPGIRHVHPNGTLQIFPFPPSSFSTLIHDNTYYCTAENPSGKIRSQDVHIKAVLRE 124

Query: 67  SYTVNIMDEHVLKGNSAVLKCHIPSFVADYVAVESWISDQGEELFVDMTESTDGKYLVLP 126
            YTV + D+  ++GN AV KC IPS V  YV V SW  D        ++  +  ++L+  
Sbjct: 125 PYTVRVEDQKTMRGNVAVFKCIIPSSVEAYVTVVSWEKDT-------VSLVSGSRFLITS 177

Query: 127 SGELHIRDVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI 167
           +G L+I+DV  EDG  +Y+C T+HR TGETR S +  RL +
Sbjct: 178 TGALYIKDVQNEDGLYNYRCITRHRYTGETRQSNS-ARLFV 217




Cell adhesion molecule that plays a role in neuronal self-avoidance. Promotes repulsion between specific neuronal processes of either the same cell or the same subtype of cells. Mediates within retinal amacrine and ganglion cell subtypes both isoneuronal self-avoidance for creating an orderly dendritic arborization and heteroneuronal self-avoidance to maintain the mosaic spacing between amacrine and ganglion cell bodies. In spinal chord development plays a role in guiding commissural axons projection and pathfinding across the ventral midline to reach the floor plate upon ligand binding. Enhances netrin-induced phosphorylation of PAK1 and FYN. Mediates intracellular signaling by stimulating the activation of MAPK8 and MAP kinase p38 (By similarity). Receptor for netrin required for axon guidance independently of and in collaboration with the receptor DCC.
Rattus norvegicus (taxid: 10116)
>sp|Q9ERC8|DSCAM_MOUSE Down syndrome cell adhesion molecule homolog OS=Mus musculus GN=Dscam PE=1 SV=1 Back     alignment and function description
>sp|O60469|DSCAM_HUMAN Down syndrome cell adhesion molecule OS=Homo sapiens GN=DSCAM PE=1 SV=2 Back     alignment and function description
>sp|Q4VA61|DSCL1_MOUSE Down syndrome cell adhesion molecule-like protein 1 homolog OS=Mus musculus GN=Dscaml1 PE=1 SV=2 Back     alignment and function description
>sp|Q8TD84|DSCL1_HUMAN Down syndrome cell adhesion molecule-like protein 1 OS=Homo sapiens GN=DSCAML1 PE=1 SV=2 Back     alignment and function description
>sp|Q9VS29|DSCL_DROME Down syndrome cell adhesion molecule-like protein Dscam2 OS=Drosophila melanogaster GN=Dscam2 PE=2 SV=3 Back     alignment and function description
>sp|Q9BWV1|BOC_HUMAN Brother of CDO OS=Homo sapiens GN=BOC PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
198456023 6743 dscam [Drosophila pseudoobscura pseudoob 0.940 0.023 0.672 9e-60
195581170 2908 GD10266 [Drosophila simulans] gi|1941924 0.940 0.053 0.679 2e-59
195382125 2232 dscam [Drosophila virilis] gi|194144578| 0.952 0.071 0.639 7e-54
195123131 2326 dscam [Drosophila mojavensis] gi|1939111 0.952 0.068 0.633 9e-54
195025469 2230 GH20743 [Drosophila grimshawi] gi|193902 0.952 0.071 0.627 1e-53
195431192 2234 GK22019 [Drosophila willistoni] gi|19415 0.982 0.073 0.625 3e-53
195332081 2283 GM20804 [Drosophila sechellia] gi|194124 0.982 0.071 0.619 6e-53
194863848 1317 GG10759 [Drosophila erecta] gi|190662511 0.952 0.120 0.633 8e-53
194753578 2283 dscam [Drosophila ananassae] gi|19062038 0.982 0.071 0.613 1e-52
357628590 3282 dscam [Danaus plexippus] 0.958 0.048 0.613 1e-52
>gi|198456023|ref|XP_001360206.2| dscam [Drosophila pseudoobscura pseudoobscura] gi|198135489|gb|EAL24780.2| dscam [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
 Score =  234 bits (597), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 135/162 (83%), Gaps = 5/162 (3%)

Query: 8   VISQYYEAQVYDVFVIKGNAAVFKCNLPSFVSDHLDVVSWADTDGGQYQIDNQDFVVSQS 67
           V+ Q++E+QVYD +VIKGNAA+FKC  PSFV+DH+++  W DT+G  Y       VV QS
Sbjct: 687 VVKQFFESQVYDEYVIKGNAAIFKCQTPSFVADHIEITDWIDTEGEVYT--KNITVVPQS 744

Query: 68  YTVNIMDEHVLKGNSAVLKCHIPSFVADYVAVESWISDQGEELFV--DMTESTDGKYLVL 125
           YTVN+MDE +L+GNSA++KCHIPSFVAD++ V+SW+ D+  +++   D+T S DGKYLVL
Sbjct: 745 YTVNVMDESILRGNSAIMKCHIPSFVADFIVVDSWVEDEERDIYPQEDITAS-DGKYLVL 803

Query: 126 PSGELHIRDVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI 167
           PSGELHIR+VGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
Sbjct: 804 PSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI 845




Source: Drosophila pseudoobscura pseudoobscura

Species: Drosophila pseudoobscura

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195581170|ref|XP_002080407.1| GD10266 [Drosophila simulans] gi|194192416|gb|EDX05992.1| GD10266 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195382125|ref|XP_002049781.1| dscam [Drosophila virilis] gi|194144578|gb|EDW60974.1| dscam [Drosophila virilis] Back     alignment and taxonomy information
>gi|195123131|ref|XP_002006063.1| dscam [Drosophila mojavensis] gi|193911131|gb|EDW09998.1| dscam [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195025469|ref|XP_001986065.1| GH20743 [Drosophila grimshawi] gi|193902065|gb|EDW00932.1| GH20743 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195431192|ref|XP_002063632.1| GK22019 [Drosophila willistoni] gi|194159717|gb|EDW74618.1| GK22019 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195332081|ref|XP_002032727.1| GM20804 [Drosophila sechellia] gi|194124697|gb|EDW46740.1| GM20804 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|194863848|ref|XP_001970644.1| GG10759 [Drosophila erecta] gi|190662511|gb|EDV59703.1| GG10759 [Drosophila erecta] Back     alignment and taxonomy information
>gi|194753578|ref|XP_001959089.1| dscam [Drosophila ananassae] gi|190620387|gb|EDV35911.1| dscam [Drosophila ananassae] Back     alignment and taxonomy information
>gi|357628590|gb|EHJ77866.1| dscam [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
FB|FBgn0033159 2037 Dscam "Down syndrome cell adhe 0.616 0.050 0.752 1.2e-36
FB|FBgn0263219 1918 Dscam4 "Down syndrome cell adh 0.616 0.053 0.485 2.7e-23
MGI|MGI:1196281 2013 Dscam "Down syndrome cell adhe 0.862 0.071 0.347 1.5e-14
RGD|619992 2013 Dscam "Down syndrome cell adhe 0.862 0.071 0.347 1.5e-14
UNIPROTKB|O60469 2012 DSCAM "Down syndrome cell adhe 0.862 0.071 0.341 1.9e-14
UNIPROTKB|F1NY98 1994 DSCAM "Uncharacterized protein 0.862 0.072 0.341 1.1e-13
MGI|MGI:2150309 2053 Dscaml1 "Down syndrome cell ad 0.694 0.056 0.365 3.7e-13
RGD|1304887 2111 Dscaml1 "Down syndrome cell ad 0.694 0.054 0.365 3.8e-13
UNIPROTKB|E1BZF3 1870 E1BZF3 "Uncharacterized protei 0.694 0.062 0.357 4.3e-13
UNIPROTKB|Q8TD84 2053 DSCAML1 "Down syndrome cell ad 0.694 0.056 0.357 1.6e-12
FB|FBgn0033159 Dscam "Down syndrome cell adhesion molecule" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 410 (149.4 bits), Expect = 1.2e-36, P = 1.2e-36
 Identities = 79/105 (75%), Positives = 90/105 (85%)

Query:    63 VVSQSYTVNIMDEHVLKGNSAVLKCHIPSFVADYVAVESWISDQGEELFVDMTESTDGKY 122
             VV+Q Y   IM E+V++GN+AVLKC IPSFVAD+V VESWI D+G  L    +++ DGKY
Sbjct:   136 VVNQFYEAEIMTEYVIRGNAAVLKCSIPSFVADFVRVESWIDDEGNVL--SFSDNYDGKY 193

Query:   123 LVLPSGELHIRDVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI 167
             LVLPSGELHIR+VGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
Sbjct:   194 LVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI 238


GO:0005887 "integral to plasma membrane" evidence=ISM;ISS
GO:0007411 "axon guidance" evidence=IGI;IMP;TAS
GO:0008046 "axon guidance receptor activity" evidence=IMP;NAS
GO:0007422 "peripheral nervous system development" evidence=IMP
GO:0016319 "mushroom body development" evidence=IMP
GO:0007413 "axonal fasciculation" evidence=IMP
GO:0006909 "phagocytosis" evidence=IMP
GO:0051635 "bacterial cell surface binding" evidence=IDA
GO:0048666 "neuron development" evidence=IMP
GO:0030424 "axon" evidence=IDA
GO:0070593 "dendrite self-avoidance" evidence=IMP;IDA
GO:0043025 "neuronal cell body" evidence=IDA
GO:0030425 "dendrite" evidence=IDA
GO:0042802 "identical protein binding" evidence=IPI
GO:0021551 "central nervous system morphogenesis" evidence=IMP
GO:0048846 "axon extension involved in axon guidance" evidence=IMP
GO:0042803 "protein homodimerization activity" evidence=IPI
FB|FBgn0263219 Dscam4 "Down syndrome cell adhesion molecule 4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1196281 Dscam "Down syndrome cell adhesion molecule" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|619992 Dscam "Down syndrome cell adhesion molecule" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O60469 DSCAM "Down syndrome cell adhesion molecule" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NY98 DSCAM "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2150309 Dscaml1 "Down syndrome cell adhesion molecule like 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1304887 Dscaml1 "Down syndrome cell adhesion molecule-like 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZF3 E1BZF3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TD84 DSCAML1 "Down syndrome cell adhesion molecule-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 167
KOG3513|consensus 1051 99.85
KOG3513|consensus 1051 99.8
KOG4221|consensus 1381 99.75
PHA02826227 IL-1 receptor-like protein; Provisional 99.74
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 99.73
KOG4194|consensus 873 99.73
KOG4221|consensus 1381 99.73
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 99.7
KOG4222|consensus 1281 99.68
KOG4194|consensus873 99.68
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 99.67
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 99.64
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 99.64
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 99.64
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 99.63
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 99.63
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 99.63
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 99.63
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 99.62
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 99.62
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 99.62
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 99.61
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 99.61
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 99.61
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 99.61
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 99.61
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 99.61
KOG4222|consensus 1281 99.61
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 99.6
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 99.6
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 99.6
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 99.59
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 99.59
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 99.59
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 99.58
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 99.58
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 99.57
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 99.57
PHA02785 326 IL-beta-binding protein; Provisional 99.57
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 99.56
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 99.56
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 99.56
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 99.55
PHA02785326 IL-beta-binding protein; Provisional 99.55
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 99.55
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 99.55
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 99.55
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 99.55
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 99.54
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 99.53
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 99.53
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 99.53
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 99.53
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 99.53
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 99.52
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 99.52
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 99.52
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 99.51
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 99.51
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 99.51
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 99.51
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 99.51
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 99.51
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 99.5
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 99.5
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 99.5
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 99.5
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 99.49
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 99.49
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 99.49
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 99.49
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 99.49
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 99.48
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 99.48
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 99.47
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 99.47
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 99.47
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 99.46
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 99.46
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 99.46
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 99.45
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 99.45
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 99.45
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 99.44
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 99.43
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 99.43
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 99.43
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 99.41
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 99.4
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 99.39
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 99.37
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 99.35
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 99.35
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 99.34
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 99.3
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 99.3
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 99.27
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 99.25
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 99.25
smart0040863 IGc2 Immunoglobulin C-2 Type. 99.22
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 99.19
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 99.16
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 99.14
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 99.14
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 99.14
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 99.13
PF0004764 ig: Immunoglobulin domain The Prosite family only 99.12
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 99.09
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 99.07
smart0040986 IG Immunoglobulin. 99.06
smart0041086 IG_like Immunoglobulin like. IG domains that canno 99.06
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 99.05
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 99.03
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 98.99
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 98.98
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 98.95
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 98.93
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 98.92
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 98.89
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 98.87
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 98.86
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 98.86
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 98.86
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 98.85
PHA02826227 IL-1 receptor-like protein; Provisional 98.84
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 98.83
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 98.83
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 98.82
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 98.77
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 98.76
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 98.75
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 98.75
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 98.71
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 98.71
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 98.69
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 98.67
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 98.63
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 98.62
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 98.61
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 98.6
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 98.57
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 98.57
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 98.56
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 98.55
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 98.52
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 98.51
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 98.47
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 98.47
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 98.47
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 98.45
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 98.42
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 98.42
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 98.41
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 98.4
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 98.38
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 98.37
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 98.37
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 98.37
PHA03376221 BARF1; Provisional 98.36
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 98.33
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 98.33
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 98.32
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 98.31
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 98.3
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 98.3
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 98.29
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 98.28
KOG1480|consensus 909 98.24
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 98.22
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 98.21
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 98.2
PHA02987189 Ig domain OX-2-like protein; Provisional 98.18
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 98.18
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 98.18
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 98.16
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 98.15
cd0576182 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like 98.14
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 98.13
cd0588382 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain 98.13
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 98.12
smart0040681 IGv Immunoglobulin V-Type. 98.11
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 98.1
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 98.09
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 98.09
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 98.08
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 98.07
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 98.06
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 98.03
cd0770583 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain 98.03
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 98.03
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 98.01
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 98.0
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 97.98
cd0769488 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. 97.97
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 97.95
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 97.94
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 97.91
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 97.89
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 97.89
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 97.87
cd0588483 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain 97.87
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 97.86
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 97.86
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 97.83
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 97.82
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 97.82
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 97.82
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 97.82
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 97.8
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 97.79
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 97.78
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 97.78
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 97.75
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 97.74
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 97.72
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 97.72
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 97.7
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 97.68
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 97.67
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 97.66
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 97.65
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 97.65
PF0820589 C2-set_2: CD80-like C2-set immunoglobulin domain ; 97.64
smart0040775 IGc1 Immunoglobulin C-Type. 97.62
cd0769893 IgC_MHC_I_alpha3 Class I major histocompatibility 97.61
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 97.6
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 97.59
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 97.56
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 97.54
cd05772111 IgC_SIRP Signal-regulatory protein (SIRP) immunogl 97.5
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 97.45
cd0770395 Ig2_Nectin-2_like Second immunoglobulin (Ig) domai 97.45
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 97.44
cd0769265 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of 97.41
KOG3515|consensus 741 97.39
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 97.38
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 97.37
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 97.35
cd0571995 Ig2_PVR_like Second immunoglobulin (Ig) domain of 97.34
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 97.34
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 97.33
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 97.33
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 97.32
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 97.32
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 97.31
cd0576694 IgC_MHC_II_beta Class II major histocompatibility 97.3
cd0577093 IgC_beta2m Class I major histocompatibility comple 97.3
PHA03376221 BARF1; Provisional 97.21
cd07699100 IgC_L Immunoglobulin Constant domain. IgC_L: Immun 97.21
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 97.17
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 97.16
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 97.16
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 97.15
cd0576794 IgC_MHC_II_alpha Class II major histocompatibility 97.13
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 97.11
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 97.09
PF07354 271 Sp38: Zona-pellucida-binding protein (Sp38); Inter 97.07
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 97.04
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 97.04
smart0040863 IGc2 Immunoglobulin C-2 Type. 97.01
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 97.0
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 96.99
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 96.99
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 96.99
cd0769696 IgC_CH3 CH3 domain (third constant Ig domain of th 96.98
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 96.97
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 96.97
PHA0263363 hypothetical protein; Provisional 96.92
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 96.9
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 96.89
cd0584794 IgC_CH2_IgE CH2 domain (second constant Ig domain 96.86
PF0004764 ig: Immunoglobulin domain The Prosite family only 96.77
cd0770497 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom 96.75
PF0765483 C1-set: Immunoglobulin C1-set domain; InterPro: IP 96.73
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 96.63
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 96.63
cd0769796 IgC_TCR_gamma T cell receptor (TCR) gamma chain co 96.62
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 96.61
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 96.58
PF08204130 V-set_CD47: CD47 immunoglobulin-like domain; Inter 96.55
cd05768102 IgC_CH4 CH4 domain (fourth constant Ig domain of t 96.51
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 96.49
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 96.45
PHA02982 251 hypothetical protein; Provisional 96.36
cd05721115 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic 96.35
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 96.32
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 96.31
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 96.27
cd0498699 IgC_CH2 CH2 domain (second constant Ig domain of t 96.17
smart0040986 IG Immunoglobulin. 96.16
smart0041086 IG_like Immunoglobulin like. IG domains that canno 96.16
cd0769169 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain 96.12
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 96.02
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 95.97
cd05769115 IgC_TCR_beta T cell receptor (TCR) beta chain cons 95.95
cd0769893 IgC_MHC_I_alpha3 Class I major histocompatibility 95.94
cd0498595 IgC_CH1 CH1 domain (first constant Ig domain of th 95.9
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 95.88
cd0576694 IgC_MHC_II_beta Class II major histocompatibility 95.8
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 95.79
cd0769696 IgC_CH3 CH3 domain (third constant Ig domain of th 95.79
cd0576794 IgC_MHC_II_alpha Class II major histocompatibility 95.63
KOG4597|consensus 560 95.59
KOG3515|consensus 741 95.37
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 95.34
cd0577093 IgC_beta2m Class I major histocompatibility comple 95.13
cd0768999 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain 95.06
cd05768102 IgC_CH4 CH4 domain (fourth constant Ig domain of t 94.51
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 94.47
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 94.0
PHA03042 286 CD47-like protein; Provisional 93.82
cd05772111 IgC_SIRP Signal-regulatory protein (SIRP) immunogl 93.81
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 93.62
PF0765483 C1-set: Immunoglobulin C1-set domain; InterPro: IP 93.48
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 93.44
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 93.23
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 93.21
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 92.76
smart0040775 IGc1 Immunoglobulin C-Type. 92.66
cd0770583 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain 92.53
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 92.4
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 92.37
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 91.94
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 91.68
cd0769265 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of 91.44
cd0769488 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. 91.41
cd0588483 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain 90.93
PF0820589 C2-set_2: CD80-like C2-set immunoglobulin domain ; 90.72
PF0632889 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: 90.64
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 89.95
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 89.69
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 89.14
PHA02865338 MHC-like TNF binding protein; Provisional 88.9
PHA02914 500 Immunoglobulin-like domain protein; Provisional 88.67
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 87.8
PF11465108 Receptor_2B4: Natural killer cell receptor 2B4; In 87.78
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 86.81
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 86.76
cd0576182 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like 86.65
cd0769796 IgC_TCR_gamma T cell receptor (TCR) gamma chain co 85.98
cd07699100 IgC_L Immunoglobulin Constant domain. IgC_L: Immun 85.86
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 85.86
cd0588382 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain 85.44
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 85.1
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 85.07
cd0584794 IgC_CH2_IgE CH2 domain (second constant Ig domain 84.81
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 84.68
PHA02865338 MHC-like TNF binding protein; Provisional 84.64
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 84.63
cd0498595 IgC_CH1 CH1 domain (first constant Ig domain of th 84.62
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 84.25
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 83.84
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 82.14
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 82.06
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 81.24
PHA02987189 Ig domain OX-2-like protein; Provisional 80.74
cd05769115 IgC_TCR_beta T cell receptor (TCR) beta chain cons 80.24
>KOG3513|consensus Back     alignment and domain information
Probab=99.85  E-value=1e-20  Score=170.64  Aligned_cols=136  Identities=18%  Similarity=0.332  Sum_probs=109.9

Q ss_pred             eceeeEEeEEEEEeCCcEEEEeecCCCCCCcceeeEEeeCCCceeeecCC---ce-----E--------EEeeeEEEecC
Q psy12724         11 QYYEAQVYDVFVIKGNAAVFKCNLPSFVSDHLDVVSWADTDGGQYQIDNQ---DF-----V--------VSQSYTVNIMD   74 (167)
Q Consensus        11 ~~~~~~~~~~~v~~G~~~~l~C~a~~~~~~~~~~i~W~k~~~~~~~~~~~---~~-----v--------~~g~y~c~~~~   74 (167)
                      +++...++|+.+..|+.+.|+|.|.+.|.+   .++|+|++ .++.+...   ..     +        .+|.|+|.++|
T Consensus       332 P~w~~~~~d~~~~~gs~v~~eC~a~g~P~p---~v~WlkNg-~pl~~~~r~~~~~i~~g~L~is~v~~~dsg~YQC~A~N  407 (1051)
T KOG3513|consen  332 PYWLQKPQDTEADTGSNVTLECKASGKPNP---TVKWLKNG-EPLEPAERDPRYKIDDGTLIISNVQESDSGVYQCIAEN  407 (1051)
T ss_pred             chhhcccceeEecCCCCeEEEEEecCCCCC---ceEEeeCC-eecCccCCCcceEEeCCEEEEEecccccCeEEEeeeec
Confidence            347889999999999999999999988864   89999994 34443222   11     1        27999998855


Q ss_pred             ----------------------------eEEEeCCcEEEEeeeCCccCCcceeEEEEeCCCeeeEEeeeecCCceEEEcc
Q psy12724         75 ----------------------------EHVLKGNSAVLKCHIPSFVADYVAVESWISDQGEELFVDMTESTDGKYLVLP  126 (167)
Q Consensus        75 ----------------------------~~v~~G~~a~l~C~~~~~~~~p~p~i~W~k~~~~~l~~~~~~~~~~r~~~~~  126 (167)
                                                  ..+..|.++.+.|.+.+   .|.|.++|+|++. .+.      .++||.+++
T Consensus       408 k~G~i~anA~L~V~a~~P~f~~~p~~~~~~a~~g~~v~i~C~~~a---sP~p~~~W~k~~~-~~~------~~~r~~i~e  477 (1051)
T KOG3513|consen  408 KYGTIYANAELKVLASAPVFPLNPVERKVMAVVGGTVTIDCKPFA---SPKPKVSWLKGGE-KLL------QSGRIRILE  477 (1051)
T ss_pred             ccceEeeeeEEEEEccCCCCCCCccceEEEEEeCCeEEEeeccCC---CCcceEEEEcCCc-ccc------cCceEEECC
Confidence                                        24578999999999985   4999999999984 332      478999999


Q ss_pred             CCeEEEeecCcCCCCcceEEEeeecC---cceEEEeee
Q psy12724        127 SGELHIRDVGPEDGYKSYQCRTKHRL---TGETRLSAT  161 (167)
Q Consensus       127 ~g~L~I~~v~~~D~~G~Y~C~a~n~~---~~~~~l~~~  161 (167)
                      ||+|.|+|++.+|+ |.|+|.|+|.+   ..++.|.+.
T Consensus       478 dGtL~I~n~t~~Da-G~YtC~A~N~~G~a~~~~~L~Vk  514 (1051)
T KOG3513|consen  478 DGTLEISNVTRSDA-GKYTCVAENKLGKAESTGNLIVK  514 (1051)
T ss_pred             CCcEEecccCcccC-cEEEEEEEcccCccceEEEEEEe
Confidence            99999999999999 99999999988   445566653



>KOG3513|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>KOG1480|consensus Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>smart00407 IGc1 Immunoglobulin C-Type Back     alignment and domain information
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain Back     alignment and domain information
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd07699 IgC_L Immunoglobulin Constant domain Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins Back     alignment and domain information
>PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] Back     alignment and domain information
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>PHA02982 hypothetical protein; Provisional Back     alignment and domain information
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain Back     alignment and domain information
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin Back     alignment and domain information
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>PHA03042 CD47-like protein; Provisional Back     alignment and domain information
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>smart00407 IGc1 Immunoglobulin C-Type Back     alignment and domain information
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain Back     alignment and domain information
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>PF06328 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) [] Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>PHA02865 MHC-like TNF binding protein; Provisional Back     alignment and domain information
>PHA02914 Immunoglobulin-like domain protein; Provisional Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) Back     alignment and domain information
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain Back     alignment and domain information
>cd07699 IgC_L Immunoglobulin Constant domain Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>PHA02865 MHC-like TNF binding protein; Provisional Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
2v5m_A 388 Structural Basis For Dscam Isoform Specificity Leng 8e-39
2v5s_A 394 Structural Basis For Dscam Isoform Specificity Leng 8e-39
3dmk_A 816 Crystal Structure Of Down Syndrome Cell Adhesion Mo 8e-39
2v5r_A 391 Structural Basis For Dscam Isoform Specificity Leng 1e-38
>pdb|2V5M|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 388 Back     alignment and structure

Iteration: 1

Score = 155 bits (393), Expect = 8e-39, Method: Compositional matrix adjust. Identities = 76/105 (72%), Positives = 86/105 (81%), Gaps = 2/105 (1%) Query: 63 VVSQSYTVNIMDEHVLKGNSAVLKCHIPSFVADYVAVESWISDQGEELFVDMTESTDGKY 122 VV+Q Y ++ EHV++GNSAV+KC IPSFVAD+V V SW +D+ E F DGKY Sbjct: 101 VVAQYYEADVNKEHVIRGNSAVIKCLIPSFVADFVEVVSWHTDEEENYFPGA--EYDGKY 158 Query: 123 LVLPSGELHIRDVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI 167 LVLPSGELHIR+VGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI Sbjct: 159 LVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI 203
>pdb|2V5S|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 394 Back     alignment and structure
>pdb|3DMK|A Chain A, Crystal Structure Of Down Syndrome Cell Adhesion Molecule (Dscam) Isoform 1.30.30, N-Terminal Eight Ig Domains Length = 816 Back     alignment and structure
>pdb|2V5R|A Chain A, Structural Basis For Dscam Isoform Specificity Length = 391 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
2v5m_A 388 Dscam; neurobiology SPL immunoglobulin domain, cel 6e-25
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 1e-22
3kld_A 384 Contactin 4, axcam, BIG-2; cell adhesion, protein 2e-12
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 7e-04
1cs6_A 382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 8e-10
3p3y_A 404 Neurofascin; IG domains, cell adhesion; HET: NAG; 7e-09
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 8e-04
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 2e-08
1bih_A 395 Hemolin; insect immunity, LPS-binding, homophilic 3e-08
3laf_A 403 Deleted in colorectal cancer; netrin-1 receptor, i 3e-08
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 5e-04
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 2e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-06
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 4e-06
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 1e-05
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 2e-05
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 2e-05
4dkd_C 292 Macrophage colony-stimulating factor 1 receptor; d 3e-05
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 4e-05
3ejj_X 289 Macrophage colony-stimulating factor 1 receptor; g 5e-05
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 5e-05
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 6e-05
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 7e-05
1qz1_A 291 Neural cell adhesion molecule 1, 140 kDa isoform; 3e-04
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 1e-04
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 1e-04
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 1e-04
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 2e-04
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 5e-04
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 5e-04
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 6e-04
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 6e-04
2o26_X 290 MAST/stem cell growth factor receptor; stem cell f 9e-04
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
 Score = 97.7 bits (243), Expect = 6e-25
 Identities = 76/106 (71%), Positives = 86/106 (81%), Gaps = 2/106 (1%)

Query: 62  FVVSQSYTVNIMDEHVLKGNSAVLKCHIPSFVADYVAVESWISDQGEELFVDMTESTDGK 121
            VV+Q Y  ++  EHV++GNSAV+KC IPSFVAD+V V SW +D+ E  F       DGK
Sbjct: 100 AVVAQYYEADVNKEHVIRGNSAVIKCLIPSFVADFVEVVSWHTDEEENYFPGAEY--DGK 157

Query: 122 YLVLPSGELHIRDVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI 167
           YLVLPSGELHIR+VGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI
Sbjct: 158 YLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVI 203


>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Length = 108 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Length = 202 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Length = 124 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 99.86
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 99.86
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 99.84
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 99.84
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 99.83
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 99.82
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 99.82
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 99.82
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 99.82
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 99.82
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 99.81
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 99.81
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 99.81
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 99.8
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 99.8
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 99.8
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 99.8
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 99.79
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 99.79
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 99.79
2v5m_A 388 Dscam; neurobiology SPL immunoglobulin domain, cel 99.79
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 99.79
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 99.79
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 99.78
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 99.78
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 99.77
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 99.77
3kld_A 384 Contactin 4, axcam, BIG-2; cell adhesion, protein 99.77
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 99.77
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 99.77
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 99.77
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 99.77
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 99.77
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 99.77
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 99.76
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 99.76
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 99.76
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 99.76
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 99.76
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 99.76
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 99.76
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 99.76
2yd9_A 304 Receptor-type tyrosine-protein phosphatase S; hydr 99.76
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 99.75
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 99.75
2nzi_A 305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.75
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 99.75
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 99.75
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 99.75
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 99.75
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 99.74
3laf_A 403 Deleted in colorectal cancer; netrin-1 receptor, i 99.74
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 99.74
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 99.74
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 99.74
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 99.74
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 99.73
2jll_A 389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.73
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 99.73
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 99.73
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 99.73
2fbo_J250 V1V2;, variable region-containing chitin-binding p 99.73
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 99.73
3o4o_C 339 Interleukin-1 receptor type 2; cytokine-receptor c 99.73
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 99.72
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 99.72
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 99.72
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 99.72
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 99.71
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 99.71
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.71
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 99.7
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 99.7
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 99.7
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 99.7
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 99.69
2o26_X 290 MAST/stem cell growth factor receptor; stem cell f 99.69
3oq3_B 329 IFN-alpha/beta binding protein C12R; mousepox viru 99.69
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 99.69
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 99.69
1cs6_A 382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 99.69
3ux9_B256 SCFV antibody; five helices, long loop connecting 99.69
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 99.69
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 99.69
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 99.69
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 99.68
2y25_A 317 Myomesin; structural protein, sarcomere, M-BAND, i 99.67
3qs9_E 527 FL cytokine receptor; immunoglobulin-like domain, 99.67
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 99.67
4dep_C 349 Interleukin-1 receptor accessory protein; B-trefoi 99.67
2ocw_A 585 Polymeric-immunoglobulin receptor; SC, secretory, 99.67
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 99.67
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 99.66
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 99.66
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 99.66
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 99.66
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 99.66
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 99.66
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 99.66
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 99.66
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 99.66
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 99.66
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 99.66
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 99.66
4dkd_C 292 Macrophage colony-stimulating factor 1 receptor; d 99.66
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 99.66
1itb_B 315 Type 1 interleukin-1 receptor; immunoglobulin fold 99.66
1wio_A 363 CD4, T-cell surface glycoprotein CD4; immunoglobul 99.65
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 99.65
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 99.65
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 99.65
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 99.65
3vh8_G 316 Killer cell immunoglobulin-like receptor 3DL1; imm 99.64
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 99.64
3mjg_X289 Beta-type platelet-derived growth factor receptor; 99.64
3ejj_X 289 Macrophage colony-stimulating factor 1 receptor; g 99.64
1ry7_B 334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 99.64
3juy_B256 3B3 single chain variant HIV-1 antibody; envelope 99.64
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 99.64
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 99.64
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 99.64
1svz_A247 Immunoglobulin;, single-chain FV fragment 1696; an 99.63
1bih_A 395 Hemolin; insect immunity, LPS-binding, homophilic 99.63
1qok_A282 MFE-23 recombinant antibody fragment; immunoglobul 99.63
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 99.63
3umt_A256 SCFV heavy chain and light chain; stability engine 99.63
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 99.62
1waa_A93 Titin; metal binding protein, calmodulin-binding, 99.62
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 99.62
1nqb_A256 Single-chain antibody fragment; multivalent antibo 99.62
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 99.62
3bkj_L252 WO2 IGG2A FAB fragment light chain kappa; abeta, F 99.62
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 99.61
3sob_L237 Antibody light chain; beta propeller, protein bind 99.61
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 99.61
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 99.61
3gkz_A257 Anti-methamphetamine single chain FV; therapeutic 99.61
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 99.61
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 99.6
2y23_A 312 Myomesin; structural protein, sarcomere, M-BAND, i 99.6
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 99.6
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 99.6
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 99.6
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 99.6
3omz_A259 Human vdelta1 gamma delta T cell receptor delta1A; 99.6
1z7z_I 450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 99.6
2c1o_A254 IGK-C protein; FAB fragment, enantioselective, fin 99.6
3r06_A213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 99.59
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 99.59
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 99.59
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 99.59
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 99.59
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 99.59
2lu7_A84 Obscurin-like protein 1; structural genomics, nort 99.58
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 99.58
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 99.58
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 99.58
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 99.57
3qs9_E 527 FL cytokine receptor; immunoglobulin-like domain, 99.57
2gki_A291 Nuclease; anti-DNA antibody, catalytic antibody, i 99.57
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 99.57
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 99.57
1qgc_4 438 Protein (immunoglobulin); virus-antibody complex, 99.57
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 99.57
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 99.57
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 99.56
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 99.56
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 99.55
3bqu_C233 3H6 FAB light chain; beta sheet, immune system; 3. 99.55
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 99.55
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 99.55
1nfd_E212 H57 FAB; complex (immunoreceptor-immunoglobulin), 99.55
2lvc_A91 Obscurin-like protein 1; structural genomics, nort 99.55
1b6u_A257 KIR2DL3, P58 killer cell inhibitory receptor; natu 99.55
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 99.55
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 99.55
2wng_A 327 Tyrosine-protein phosphatase non-receptor type sub 99.54
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 99.54
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 99.54
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 99.54
2gjj_A264 A21 single-chain antibody fragment against ERBB2; 99.54
2rcj_C 523 Light chain; immunoglobulin M, polymeric antibodie 99.54
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 99.53
2rcj_C 523 Light chain; immunoglobulin M, polymeric antibodie 99.53
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 99.53
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 99.53
1x9q_A268 SCFV, 4M5.3 anti-fluorescein single chain antibody 99.52
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 99.52
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 99.52
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 99.52
1c1e_H219 Catalytic antibody 1E9 (heavy chain); diels-alder, 99.52
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 99.52
3s96_B218 3B5H10 FAB light chain; huntingtin, immune system; 99.52
3eow_R221 Poliovirus receptor; immunoglobulin super family, 99.51
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 99.51
4dzb_B246 Vbeta2 (MAIT T cell receptor); immune system; 1.70 99.51
1qgc_4 438 Protein (immunoglobulin); virus-antibody complex, 99.5
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 99.5
2j6e_L234 IGM, FAB light chain; autoimmune complex human IGM 99.5
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 99.5
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 99.5
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 99.49
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 99.49
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 99.49
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 99.49
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 99.48
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 99.48
3nfj_J245 T cell receptor beta chain; immunoglobulin family, 99.47
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 99.47
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 99.47
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 99.47
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 99.47
3fku_X280 Neutralizing antibody F10; influenza, hemagglutini 99.47
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 99.47
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 99.47
2e6q_A112 Obscurin-like protein 1; IG-like domain, structura 99.46
3m8o_H221 Immunoglobulin A1 heavy chain; immunoglobulin fold 99.46
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 99.46
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 99.46
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 99.46
2rgs_A218 I, IG gamma-2B heavy chain; FC-fragment, immunoglo 99.46
1z7z_I 450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 99.45
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 99.45
4hwu_A95 Fibroblast growth factor receptor 2; FGFR2, KGFR, 99.45
1gl4_B98 Basement membrane-specific heparan sulfate proteog 99.45
2wqr_A323 IG epsilon chain C region; immune system, immunogl 99.45
2wqr_A 323 IG epsilon chain C region; immune system, immunogl 99.45
4ei6_B245 Vbeta16 XV19 type II natural killer T cell recept 99.45
1pz5_B220 Heavy chain of FAB (SYA/J6); antibody-antigen stru 99.45
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 99.45
2vol_A207 Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, 99.45
3q5y_A240 TCR N15 beta; IG, T cell receptor, antigen peptide 99.44
1he7_A126 High affinity nerve growth factor receptor; transf 99.44
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 99.44
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 99.43
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 99.43
1q9r_B222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 99.43
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 99.43
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 99.43
3d9a_H210 Heavy chain of hyhel10 antibody fragment (FAB); ly 99.42
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 99.41
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 99.41
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 99.41
3pl6_D268 MBP peptide / T-cell receptor beta chain chimera; 99.4
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 99.4
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 99.4
1wwb_X103 Protein (brain derived neurotrophic factor recepto 99.4
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 99.4
2v9t_A117 Roundabout homolog 1; structural protein-receptor 99.39
3qib_D270 2B4 beta chain; IG domain, immune system; HET: NAG 99.39
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 99.39
3o3u_N581 Maltose-binding periplasmic protein, advanced Gly 99.39
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 99.38
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.38
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 99.37
2wbj_D279 OB TCR; transmembrane, immune response, T cell rec 99.37
2ens_A96 Advanced glycosylation END product-specific recept 99.37
2qsq_A111 Carcinoembryonic antigen-related cell adhesion MO; 99.36
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 99.36
1l6x_A207 Immunoglobulin gamma-1 heavy chain constant regio; 99.36
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 99.35
1za6_B 344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 99.35
1op3_H225 FAB 2G12, heavy chain; domain-swapped FAB 2G12, an 99.34
2fbj_H220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 99.34
3s35_X122 Vascular endothelial growth factor receptor 2; ant 99.34
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 99.33
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 99.33
1igt_B 444 IGG2A intact antibody - MAB231; intact immunoglobu 99.33
3nl4_H215 Antigen binding fragment,immunoglobulin IGG - HEA; 99.32
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 99.32
3r08_E82 T-cell surface glycoprotein CD3 epsilon chain; ant 99.32
2w59_A231 IGY FCU3-4; immunoglobulin, avian, immune system; 99.32
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.32
2c1o_A 254 IGK-C protein; FAB fragment, enantioselective, fin 99.31
3to4_D253 NKT vbeta2 (mouse variable domain, human constant; 99.31
3rbs_A 207 Myomesin-1; immunoglobulin C-SET domain, contractI 99.31
1mju_H227 Immunoglobulin MS6-12; catalytic antibody, ester h 99.31
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.3
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 99.29
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 99.29
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 99.28
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 99.28
1hzh_H457 IGG, immunoglobulin heavy chain; antibody, immune 99.27
1dee_B223 IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin 99.27
1i1c_A239 IGG2A, IG gamma-2A chain C region; FC, immune syst 99.27
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.27
2aty_A376 Complement receptor chimeric conjugate CR2-IG; imm 99.27
1h5b_A113 Murine T cell receptor (TCR) valpha domain; immune 99.26
3bae_H228 WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO 99.26
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 99.25
1igy_B434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 99.25
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 99.25
1jhl_L108 IGG1-kappa D11.15 FV (light chain); complex(antibo 99.25
1igt_B444 IGG2A intact antibody - MAB231; intact immunoglobu 99.24
1vca_A 202 VCAM-D1,2, human vascular cell adhesion molecule-1 99.24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.24
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 99.24
3mtr_A 215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 99.24
1hzh_H 457 IGG, immunoglobulin heavy chain; antibody, immune 99.24
3mjg_X 289 Beta-type platelet-derived growth factor receptor; 99.23
1dn0_B232 IGM-kappa cold agglutinin (heavy chain); FAB, anti 99.23
3liz_H253 4C3 monoclonal antibody heavy chain; hydrolase-imm 99.23
2ptt_A110 CD48 antigen; CD244, CD48, NK cell receptor, X-RAY 99.22
1hxm_B242 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 99.22
2jll_A 389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.22
3q0h_A117 T cell immunoreceptor with IG and ITIM domains; im 99.22
2nzi_A 305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 99.22
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 99.21
1iga_A475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 99.21
4gos_A125 V-SET domain-containing T-cell activation inhibit; 99.21
1iga_A 475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 99.21
1z9m_A145 GAPA225; nectin-like, IG-like domain, V domain, ce 99.21
2yd1_A 212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 99.2
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 99.2
1igy_B 434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 99.2
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 99.2
1ncn_A110 T lymphocyte activation antigen CD86; IG V, beta s 99.2
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 99.2
2yd6_A 212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 99.19
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 99.19
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 99.19
1oga_E252 TRBC1, T-cell receptor beta chain C region; immune 99.19
1bec_A238 14.3.D T cell antigen receptor; T cell receptor; 1 99.18
3khq_A133 B-cell antigen receptor complex-associated protei 99.18
2xqy_G261 A13-D6.3 monoclonal antibody, envelope glycoprotei 99.18
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.18
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 99.18
3udw_C118 Poliovirus receptor; PVR tigit IGSF signal transdu 99.17
3nl4_L 213 Antigen binding fragment, immunoglobulin IGG - LI; 99.17
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 99.17
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 99.16
1pko_A139 Myelin oligodendrocyte glycoprotein; IGV-domain, i 99.16
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 99.16
1iam_A185 ICAM-1, CD54, intercellular adhesion molecule-1; r 99.15
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 99.14
3ojm_B 231 Fibroblast growth factor receptor 2; beta trefoil 99.14
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 99.14
1xt5_A135 Variable region-containing chitin-binding protein 99.13
2oyp_A109 Hepatitis A virus cellular receptor 2; TIM-3, T-ce 99.13
3sgj_C 204 Human FCG3A receptor; receptor complex, FC recepto 99.12
1ow0_A214 IG alpha-1 chain C region; IGA1, fcari, CD89, anti 99.12
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 99.12
2q20_A109 VK1 O18/O8 germline light chain variable domain; A 99.12
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 99.12
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 99.12
2x1w_L 213 Vascular endothelial growth factor receptor 2; hor 99.11
1qfw_M108 FV, antibody (anti beta subunit) (light chain); gl 99.11
2coq_A108 NEW antigen receptor variable domain; IG VNAR, nat 99.11
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 99.11
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 99.1
1eaj_A126 Coxsackie virus and adenovirus receptor; virus/vir 99.1
3bn9_D257 E2 FAB heavy chain; antibody-protease complex, pro 99.1
2e27_L119 Anti-ciguatoxin antibody, light chain; immunoglobu 99.1
1c1e_H 219 Catalytic antibody 1E9 (heavy chain); diels-alder, 99.1
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 99.1
1c5d_H215 Monoclonal antibody against the main immunogenic t 99.1
4gjt_B123 Poliovirus receptor-related protein 4; six-bladed 99.1
3d9a_L 213 Light chain of hyhel10 antibody fragment (FAB); ly 99.09
2vr9_A 217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 99.09
3grw_A 241 Fibroblast growth factor receptor 3; FGFR3, protei 99.09
4fmk_A 225 Poliovirus receptor-related protein 2; immunoglobu 99.09
1f97_A 212 Junction adhesion molecule; immunoglobulin superfa 99.08
1ypz_E207 T cell receptor delta, beta-2-microglobulin; H2-T2 99.08
1mqk_L120 Antibody 7E2 FV fragment, light chain; membrane pr 99.08
1i8k_A107 Epidermal growth factor receptor antibody MR1SCFV 99.08
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 99.08
4f80_A 226 Butyrophilin subfamily 3 member A1; B7 superfamily 99.07
1zvo_C512 Myeloma immunoglobulin D delta; immunoglobulin fol 99.07
2or8_A116 Hepatitis A virus cellular receptor 1 homolog; bet 99.07
1moe_A 240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 99.07
2vsd_A105 CHIR AB1; immune system receptor, FC receptor; HET 99.07
3k0w_A 218 Mucosa-associated lymphoid tissue lymphoma translo 99.07
4acp_A240 IG gamma-1 chain C region; immune system, antibody 99.06
1lk3_L 210 9D7 light chain; antigen-antibody complex, immune 99.06
3r06_A213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 99.06
2pet_A 231 Lutheran blood group glycoprotein; immunoglobulin 99.06
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 99.06
1uct_A 218 Immunoglobulin alpha FC receptor; beta stands, imm 99.05
2jju_A127 Signal regulatory protein beta-1; immunoglobulin d 99.05
1gsm_A 210 Madcam-1, mucosal addressin cell adhesion molecule 99.05
2ywz_A111 NEW antigen receptor variable domain; IG VNAR, imm 99.05
2yz1_A120 Tyrosine-protein phosphatase non-receptor type sub 99.05
3s96_B 218 3B5H10 FAB light chain; huntingtin, immune system; 99.04
2fbo_J 250 V1V2;, variable region-containing chitin-binding p 99.04
2ghw_B 247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 99.04
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 99.04
3mj6_A 268 Junctional adhesion molecule-like; immunoglobulin 99.04
3mj8_L 213 Stimulatory hamster antibody HL4E10 FAB light CHA; 99.04
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 99.03
4dzb_B 246 Vbeta2 (MAIT T cell receptor); immune system; 1.70 99.03
2r15_A 212 Myomesin-1; sarcomeric protein, IG-like domains, h 99.03
3d9a_H210 Heavy chain of hyhel10 antibody fragment (FAB); ly 99.03
1sq2_N113 Novel antigen receptor; immunoglobulin fold, prote 99.02
1zvo_C 512 Myeloma immunoglobulin D delta; immunoglobulin fol 99.02
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 99.02
1jbj_A 186 CD3 epsilon and gamma ectodomain fragment complex; 99.02
3noi_A120 Natural cytotoxicity triggering receptor 3; immune 99.02
1j05_L111 T84.66 antibody, anti-CEA MAB T84.66, light chain; 99.02
1pew_A109 JTO2, A lambda-6 type immunoglobulin light chain, 99.02
3sob_L 237 Antibody light chain; beta propeller, protein bind 99.01
3esu_F 250 Antibody 14B7* light chain and antibody 14B7* heav 99.01
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 99.01
3auv_A 276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 99.01
1u3h_A110 T-cell receptor alpha-chain; complex, immune syste 98.57
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 99.01
1ypz_F230 T-cell receptor gamma chain, beta-2-microglobulin; 99.01
1svz_A 247 Immunoglobulin;, single-chain FV fragment 1696; an 99.01
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 99.0
3uzq_A 253 Anti-dengue MAB 4E11; dengue antibody neutralizati 99.0
1neu_A124 Myelin P0 protein; structural protein, glycoprotei 99.0
2znx_A 242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 99.0
3gkz_A 257 Anti-methamphetamine single chain FV; therapeutic 99.0
2d9c_A136 Signal-regulatory protein beta-1; beta-sandwich, S 99.0
2v9r_A 212 Roundabout homolog 1; proto-oncogene, differentiat 99.0
1eeq_A114 Kappa-4 immunoglobulin (light chain); protein stab 98.99
2edo_A121 CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte 98.99
4ffy_L126 DENV1-E111 single chain variable fragment (light; 98.99
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 98.99
1nqb_A 256 Single-chain antibody fragment; multivalent antibo 98.99
3sbw_C 222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 98.98
3tf7_C 256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 98.98
2wbj_D 279 OB TCR; transmembrane, immune response, T cell rec 98.98
3nl4_H215 Antigen binding fragment,immunoglobulin IGG - HEA; 98.98
3nfj_J 245 T cell receptor beta chain; immunoglobulin family, 98.98
1nfd_E 212 H57 FAB; complex (immunoreceptor-immunoglobulin), 98.98
1q9r_B 222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 98.98
3r0n_A128 Poliovirus receptor-related protein 2; IG-domain, 98.98
4ei6_B 245 Vbeta16 XV19 type II natural killer T cell recept 98.97
4frw_A 218 Poliovirus receptor-related protein 4; immunoglobu 98.97
1pz5_B220 Heavy chain of FAB (SYA/J6); antibody-antigen stru 98.97
1op3_H 225 FAB 2G12, heavy chain; domain-swapped FAB 2G12, an 98.97
1nbq_A 209 JAM, junctional adhesion molecule 1, PAM-1; reovir 98.97
1f3r_B 257 FV antibody fragment; IG-fold, immuno complex, ant 98.97
1xau_A122 B- and T-lymphocyte attenuator; IG domain, beta sa 98.97
2or7_A115 T-cell immunoglobulin and mucin domain- containing 98.97
4hwn_A108 FC receptor-like A; FCRLA, FCRL, IG-C2 domain, IG 98.96
3bkj_L 252 WO2 IGG2A FAB fragment light chain kappa; abeta, F 98.96
1zox_A113 CLM-1; IG-superfamily, IG-V, NKP44-like, myeloid I 98.96
1i3g_L111 Antibody FV fragment; antibiotic; 2.44A {Mus muscu 98.96
3qib_D 270 2B4 beta chain; IG domain, immune system; HET: NAG 98.96
3pl6_D 268 MBP peptide / T-cell receptor beta chain chimera; 98.96
1mq8_A 291 ICAM-1, intercellular adhesion molecule-1, CD54 an 98.96
1mju_H 227 Immunoglobulin MS6-12; catalytic antibody, ester h 98.96
1za6_B 344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 98.96
3umt_A 256 SCFV heavy chain and light chain; stability engine 98.96
2xzc_L 216 FAB A.17 light chain; immune system; HET: XOP; 1.3 98.96
3ux9_B 256 SCFV antibody; five helices, long loop connecting 98.95
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 98.95
2q87_A110 CMRF35-H antigen; all-beta, immunoglobulin, IG-sup 98.95
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 98.95
2p1y_A 238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 98.94
3q5y_A 240 TCR N15 beta; IG, T cell receptor, antigen peptide 98.94
2qhl_A111 Novel immune-type receptor 10; immunoglobulin vari 98.94
2i24_N121 NEW antigen receptor PBLA8; immunoglobulin fold, i 98.93
3juy_B 256 3B3 single chain variant HIV-1 antibody; envelope 98.93
1qok_A 282 MFE-23 recombinant antibody fragment; immunoglobul 98.93
1c5d_H215 Monoclonal antibody against the main immunogenic t 98.93
1sy6_A 204 T-cell surface glycoprotein CD3 gamma/epsilon chai 98.93
2fbj_H220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 98.92
1tvd_A116 T cell receptor, ES204 V delta; immunoreceptor, TC 98.92
3qhz_H232 Human monoclonal antibody DEL2D1, FAB heavy chain; 98.92
1fo0_B112 Protein (BM3.3 T cell receptor beta-chain); class 98.92
1p6f_A 242 NKP46, natural cytotoxicity triggering receptor 1; 98.91
1dlf_L113 Anti-dansyl immunoglobulin IGG2A(S); FV fragment; 98.91
3o3u_N 581 Maltose-binding periplasmic protein, advanced Gly 98.91
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 98.91
3bn3_B196 ICAM-5, intercellular adhesion molecule 5, telence 98.9
3tv3_H239 PGT128 heavy chain, IG gamma-1 chain C region; FAB 98.9
3to4_D 253 NKT vbeta2 (mouse variable domain, human constant; 98.89
4i0k_A 222 CD276 antigen; immunoglobulin domain, glycoprotein 98.89
3eow_R 221 Poliovirus receptor; immunoglobulin super family, 98.89
3bae_H 228 WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO 98.88
3bj9_1116 Immunoglobulin IOTA chain, immunoglobulin lambda- 98.88
1fo0_A116 Protein (BM3.3 T cell receptor alpha-chain); class 98.88
2z35_A112 T-cell receptor alpha-chain; immune receptor, immu 98.88
1oaq_L120 Light chain; antibody, allergy, IGE, conformationa 98.88
3omz_A 259 Human vdelta1 gamma delta T cell receptor delta1A; 98.88
2gjj_A 264 A21 single-chain antibody fragment against ERBB2; 98.88
1hxm_A229 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 98.88
3u2s_H248 PG9 heavy chain; greek KEY, immunoglobulin, immune 98.88
3m8o_H221 Immunoglobulin A1 heavy chain; immunoglobulin fold 98.88
1ypz_E207 T cell receptor delta, beta-2-microglobulin; H2-T2 98.87
1nko_A132 Sialic acid binding IG-like lectin 7; immunoglobul 98.87
1dee_B 223 IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin 98.87
1hxm_B 242 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 98.87
1bec_A 238 14.3.D T cell antigen receptor; T cell receptor; 1 98.87
3rrq_A129 Protein PD-1, programmed cell death protein 1; pro 98.86
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.86
2xqy_G 261 A13-D6.3 monoclonal antibody, envelope glycoprotei 98.86
2yc1_B146 Single chain antibody fragment 9004G; immune syste 98.85
3pv7_A 248 B7-H6, IG-like domain-containing protein DKFZP686O 98.85
3moq_A126 NEW antigen receptor variable domain, P3(40) PEPT 98.85
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 98.84
3kg5_A134 B-cell antigen receptor complex-associated protei 98.83
1x9q_A 268 SCFV, 4M5.3 anti-fluorescein single chain antibody 98.82
1b6u_A 257 KIR2DL3, P58 killer cell inhibitory receptor; natu 98.82
3fku_X 280 Neutralizing antibody F10; influenza, hemagglutini 98.82
3bqu_C 233 3H6 FAB light chain; beta sheet, immune system; 3. 98.81
2atp_B115 T-cell surface glycoprotein CD8 beta chain; CD8AB, 98.81
3sob_H256 Antibody heavy chain, low-density lipoprotein rece 98.8
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 Back     alignment and structure
>4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4hwu_A Fibroblast growth factor receptor 2; FGFR2, KGFR, CD332, IG-C2 type 1 domain, IG superfamily, IMM system, structural genomics, PSI-biology; 2.90A {Mus musculus} Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D Back     alignment and structure
>1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Back     alignment and structure
>3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Back     alignment and structure
>3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Back     alignment and structure
>2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qsq_A Carcinoembryonic antigen-related cell adhesion MO; glycoprotein, GPI-anchor, immunoglobulin DOMA lipoprotein, membrane; 1.95A {Homo sapiens} PDB: 2qst_A 2ver_N* 2gk2_A Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Back     alignment and structure
>1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>3r08_E T-cell surface glycoprotein CD3 epsilon chain; antibody, T-cell receptor, signalling, immune SY; 4.10A {Cricetulus migratorius} Back     alignment and structure
>2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>3to4_D NKT vbeta2 (mouse variable domain, human constant; mouse CD1D, mouse NKT, immune system; HET: AGH NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H Back     alignment and structure
>1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>1h5b_A Murine T cell receptor (TCR) valpha domain; immune response, immunoglobulin fold; 1.85A {Mus musculus} SCOP: b.1.1.1 PDB: 1h5b_C 1h5b_B Back     alignment and structure
>3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>1jhl_L IGG1-kappa D11.15 FV (light chain); complex(antibody-antigen); 2.40A {Mus musculus} SCOP: b.1.1.1 Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H Back     alignment and structure
>3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H Back     alignment and structure
>2ptt_A CD48 antigen; CD244, CD48, NK cell receptor, X-RAY, immune system; 1.63A {Mus musculus} PDB: 2ptv_A Back     alignment and structure
>1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>3q0h_A T cell immunoreceptor with IG and ITIM domains; immune receptor, adhesion, structural genomics, NEW YORK STR genomics research consortium, nysgrc; 1.70A {Homo sapiens} PDB: 3rq3_A 3udw_A* 3ucr_A Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>4gos_A V-SET domain-containing T-cell activation inhibit; immunoglobulin domain, glycoprotein, disulfide bond, immunit adaptive immunity; HET: NAG BMA MAN; 1.59A {Homo sapiens} Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>1ncn_A T lymphocyte activation antigen CD86; IG V, beta strands, immune system; 2.70A {Homo sapiens} SCOP: b.1.1.1 PDB: 1i85_A Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>1oga_E TRBC1, T-cell receptor beta chain C region; immune system/receptor, immune system/receptor/complex, TCR, MHC, immunodominance, FLU, complex; 1.40A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 2vlm_E 2vlk_E 2vlj_E 2vlr_E 2xna_B 2xn9_B 2axh_A 2axj_A 3scm_D* 3sda_D* 3sdc_D* 3sdd_D* 3qi9_D* 3mff_B* 2ak4_E 3he7_D* 2eyr_B 3pqy_E 3kxf_E 2cde_B ... Back     alignment and structure
>1bec_A 14.3.D T cell antigen receptor; T cell receptor; 1.70A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1jck_A 1l0x_A 1sbb_A 1l0y_A 3c6l_B 1mwa_B* 1g6r_B* 1tcr_B* 2ckb_B 2q86_B* 1lp9_F 2j8u_F 2jcc_F 2uwe_F 3mbe_D* 1d9k_B* 2aq3_A 3mc0_A 3byt_A 3bzd_A ... Back     alignment and structure
>3khq_A B-cell antigen receptor complex-associated protei chain; CD79B, CD79A, IG-beta, BCR, IG domain, V-SET, immunoglobulin protein binding; HET: FLC GSH; 1.70A {Mus musculus} PDB: 3kho_A* Back     alignment and structure
>2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>3udw_C Poliovirus receptor; PVR tigit IGSF signal transduction immunology, IGSF, cell SU receptor signalling, glycosylation, membrane protein; HET: NAG; 2.90A {Homo sapiens} Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>1pko_A Myelin oligodendrocyte glycoprotein; IGV-domain, immune system; 1.45A {Rattus norvegicus} SCOP: b.1.1.1 PDB: 1pkq_E 3csp_A 1py9_A Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1iam_A ICAM-1, CD54, intercellular adhesion molecule-1; rhinovirus receptor, cell adhesion, integrin ligand, glycopr LFA-1 ligand, immunoglobulin fold; HET: NAG; 2.10A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ic1_A* 1d3l_A 1d3e_I 1d3i_I 3tcx_A Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>1xt5_A Variable region-containing chitin-binding protein 3; innate immunity, VCBP, primordial antigen receptor, florida lancelet, amphioxus; 1.15A {Branchiostoma floridae} Back     alignment and structure
>2oyp_A Hepatitis A virus cellular receptor 2; TIM-3, T-cell immunoglobulin mucin, signaling protein; 1.95A {Mus musculus} PDB: 3kaa_A* Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>1ow0_A IG alpha-1 chain C region; IGA1, fcari, CD89, antibody, immunoglobulin-LIK immune system; HET: NAG FUL BMA GAL SIA FUC MAN NDG; 3.10A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2qej_A* Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>2q20_A VK1 O18/O8 germline light chain variable domain; Al, light chain amyloidosis, amyloid, immunoglobulin, protein fibril; 1.30A {Homo sapiens} PDB: 2kqm_A 3cdf_A 3cdc_A 2kqn_A 3cdy_A 2q1e_A 3dvi_A 1igm_L 1bww_A 1b0w_A 1bre_A 1qp1_A 3dvf_A 1rei_A 1wtl_A 1ar2_A 1fgv_L 2bx5_A 2uzi_L* 1bvk_A ... Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>1qfw_M FV, antibody (anti beta subunit) (light chain); glycoprotein hormone; HET: NAG; 3.50A {Mus musculus} SCOP: b.1.1.1 Back     alignment and structure
>2coq_A NEW antigen receptor variable domain; IG VNAR, natural TYPE2, immune system; 2.10A {Orectolobus maculatus} Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>1eaj_A Coxsackie virus and adenovirus receptor; virus/viral protein receptor, immunoglobulin V domain fold, symmetric dimer; 1.35A {Homo sapiens} SCOP: b.1.1.1 PDB: 1f5w_A 2j12_B 2j1k_A 2wbw_B* 2w9l_A* 1rsf_A 1jew_R 1kac_B 1p69_B 1p6a_B Back     alignment and structure
>3bn9_D E2 FAB heavy chain; antibody-protease complex, protein-protein complex, enzyme- inhibitor complex, disease mutation, glycoprotein, hydrolase; 2.17A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kr3_H 2xtj_E Back     alignment and structure
>2e27_L Anti-ciguatoxin antibody, light chain; immunoglobulin fold, immune system; HET: AB0; 1.70A {Mus musculus} PDB: 3iy1_A Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* Back     alignment and structure
>4gjt_B Poliovirus receptor-related protein 4; six-bladed -propeller, IGV-like fold, viral entry, MV-H, NEC BETA4/BETA5 groove; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>1ypz_E T cell receptor delta, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1mqk_L Antibody 7E2 FV fragment, light chain; membrane protein, cytochrome C oxidase, high- resolution structure, immune system; 1.28A {Mus musculus} SCOP: b.1.1.1 PDB: 1ar1_D 3ehb_D* 3hb3_D* 1qle_L* 1f6l_L 3iy2_A 1vfa_A 1dvf_A 1kir_A 1g7i_A 1g7j_A 1a2y_A 1kip_A 1kiq_A 1vfb_A 1g7h_A 1a7o_L 1g7l_A 1g7m_A 1a7n_L ... Back     alignment and structure
>1i8k_A Epidermal growth factor receptor antibody MR1SCFV light chain; antibody-peptide complex, immunoglobulin fold, type II' beta turn., immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 PDB: 1i8i_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>2or8_A Hepatitis A virus cellular receptor 1 homolog; beta barrel, immunoglobulin fold, IGV domain, TIM, immune system; 2.50A {Mus musculus} Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2vsd_A CHIR AB1; immune system receptor, FC receptor; HET: NAG NDG MAN; 1.82A {Gallus gallus} Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>4acp_A IG gamma-1 chain C region; immune system, antibody, kifunensine; HET: NAG; 2.49A {Homo sapiens} PDB: 2j6e_A* Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>2jju_A Signal regulatory protein beta-1; immunoglobulin domain, immunoglobulin superfamily, immune system, transmembrane, paired receptor; 1.19A {Homo sapiens} PDB: 2jjv_A 2uv3_A* 2jjt_A* 2jjs_A* 2jjw_A Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Back     alignment and structure
>2ywz_A NEW antigen receptor variable domain; IG VNAR, immune system; 2.21A {Orectolobus maculatus} PDB: 2ywy_A Back     alignment and structure
>2yz1_A Tyrosine-protein phosphatase non-receptor type substrate 1; beta-sandwich, structural genomics, NPPSFA; 1.40A {Mus musculus} Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>1sq2_N Novel antigen receptor; immunoglobulin fold, protein-protein complex, hydrolase/immune system complex; 1.45A {Ginglymostoma cirratum} SCOP: b.1.1.1 PDB: 1t6v_N Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>3noi_A Natural cytotoxicity triggering receptor 3; immune system, innate immunity, immunoglobulin-like I2 type natural killer cell activation; HET: 1PG; 1.84A {Homo sapiens} PDB: 3pv6_B* Back     alignment and structure
>1j05_L T84.66 antibody, anti-CEA MAB T84.66, light chain; immunoglobulin, immune system; 1.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1qfw_L* 1qnz_L 3iy3_A 3iy4_A Back     alignment and structure
>1pew_A JTO2, A lambda-6 type immunoglobulin light chain, domain; beta sheet, immune system; 1.60A {Homo sapiens} SCOP: b.1.1.1 PDB: 1cd0_A 1pw3_A 2cd0_A 2w0k_A 3b5g_A 3bdx_A* 2w0l_A Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>1u3h_A T-cell receptor alpha-chain; complex, immune system; 2.42A {Mus musculus} SCOP: b.1.1.1 PDB: 1b88_A 1kj2_A* 1kb5_A 1d9k_A* Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>1ypz_F T-cell receptor gamma chain, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>1neu_A Myelin P0 protein; structural protein, glycoprotein, transmembrane, phosphorylation, immunoglobulin fold, signal; 1.90A {Rattus norvegicus} SCOP: b.1.1.1 Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>2d9c_A Signal-regulatory protein beta-1; beta-sandwich, SIRP-beta-1, CD172B antigen, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>1eeq_A Kappa-4 immunoglobulin (light chain); protein stability, hydrogen bonds, immune system; 1.50A {Homo sapiens} SCOP: b.1.1.1 PDB: 1eeu_A 1lve_A 2lve_A 3lve_A 5lve_A 4lve_A 1efq_A 1qac_A 1ek3_A 2imm_A 1mvu_A 2ap2_A 1ap2_A 3bd3_A* 3bd4_A* 3bd5_A* 2imn_A 3dus_A* 3duu_A* 3dv4_A* ... Back     alignment and structure
>2edo_A CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte activation marker blast-1, BCM1 surface antigen, leukocyte antigen MEM-102, TCT.1; NMR {Homo sapiens} Back     alignment and structure
>4ffy_L DENV1-E111 single chain variable fragment (light; viral envelope proteins, structural genomics, antibody epito flavivirus, niaid; 2.50A {Mus musculus} Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>3r0n_A Poliovirus receptor-related protein 2; IG-domain, cell-adhesion molecule, virus entry receptor, STR genomics, PSI-biology; 1.30A {Homo sapiens} PDB: 4dfh_A 4dfi_A Back     alignment and structure
>4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* Back     alignment and structure
>1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1xau_A B- and T-lymphocyte attenuator; IG domain, beta sandwich, structural genomics, PSI, protein structure initiative; 1.80A {Mus musculus} SCOP: b.1.1.4 Back     alignment and structure
>2or7_A T-cell immunoglobulin and mucin domain- containing protein 2; beta barrel, immunoglobulin fold, IGV domain, TIM, immune system; 1.50A {Mus musculus} Back     alignment and structure
>4hwn_A FC receptor-like A; FCRLA, FCRL, IG-C2 domain, IG superfamily, immune system, ST genomics, PSI-biology; 2.01A {Homo sapiens} Back     alignment and structure
>3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L Back     alignment and structure
>1zox_A CLM-1; IG-superfamily, IG-V, NKP44-like, myeloid IG-like receptor, structural genomics, PSI, protein structure initiative; 2.10A {Mus musculus} Back     alignment and structure
>1i3g_L Antibody FV fragment; antibiotic; 2.44A {Mus musculus} SCOP: b.1.1.1 PDB: 3iy6_A Back     alignment and structure
>3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Back     alignment and structure
>1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>2q87_A CMRF35-H antigen; all-beta, immunoglobulin, IG-superfamily, IG-V, NKP44-like, natural killer cell IG-like receptor, inhibitory receptor; 1.70A {Homo sapiens} Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A Back     alignment and structure
>2qhl_A Novel immune-type receptor 10; immunoglobulin variable domain-like beta-sandwich, immune system; 1.56A {Ictalurus punctatus} PDB: 3b5t_A 2qjd_A 2qte_A 2qqq_A Back     alignment and structure
>2i24_N NEW antigen receptor PBLA8; immunoglobulin fold, immune system; 1.35A {Ginglymostoma cirratum} PDB: 2i25_N 2i27_N 2i26_N Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>1tvd_A T cell receptor, ES204 V delta; immunoreceptor, TCR, delta chain, variable domain; 1.90A {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>3qhz_H Human monoclonal antibody DEL2D1, FAB heavy chain; immunoglobulin, immune recognition, influenza A hemagglutini system; 1.55A {Homo sapiens} PDB: 3lzf_H* 3qrg_H* 3mod_H 3mob_H 3moa_H 3lev_H* 3idg_B 3d0l_B 3d0v_B 3idi_B 3idj_B 3idm_B* 3idn_B* 1tjg_H* 1tjh_H* 1tji_H* 2pr4_H 3drq_B 2p8m_B 2p8p_B ... Back     alignment and structure
>1fo0_B Protein (BM3.3 T cell receptor beta-chain); class I MHC, H-2KB, TCR-PMHC complex, immune system; 2.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1nam_B* 2ol3_B* 1kb5_B 1kj2_B* Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1dlf_L Anti-dansyl immunoglobulin IGG2A(S); FV fragment; 1.45A {Mus musculus} SCOP: b.1.1.1 PDB: 1wz1_L* 2dlf_L 1maj_A 1mak_A 1ktr_L 2cju_L* 2uud_K* 1dsf_L 3nn8_B 1n4x_L 1bfv_L* 1cfv_L* 2bfv_L* 1wt5_C Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>3bn3_B ICAM-5, intercellular adhesion molecule 5, telencephalin; I domain, integrin, allosteric mobility, cell adhesi immune system; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>3tv3_H PGT128 heavy chain, IG gamma-1 chain C region; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_H* 3twc_H* 3tje_H* 3thm_H* 4fqq_H 2xzc_H* 2xza_H* 3b2u_H* 3b2v_H* 3mly_H 3mlz_H 4fq2_H 2ykl_H* 3tnm_H 4fqc_H* 4fq1_H* 2yk1_H* 3mlx_H 2jix_D 2vxq_H ... Back     alignment and structure
>3to4_D NKT vbeta2 (mouse variable domain, human constant; mouse CD1D, mouse NKT, immune system; HET: AGH NAG; 3.10A {Homo sapiens} Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... Back     alignment and structure
>3bj9_1 Immunoglobulin IOTA chain, immunoglobulin lambda- like polypeptide 1; immunoglobulin domain, beta sheet, polymorphism, immune system; 2.00A {Homo sapiens} PDB: 2h3n_A Back     alignment and structure
>1fo0_A Protein (BM3.3 T cell receptor alpha-chain); class I MHC, H-2KB, TCR-PMHC complex, immune system; 2.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1nam_A* Back     alignment and structure
>2z35_A T-cell receptor alpha-chain; immune receptor, immune system; 2.20A {Mus musculus} PDB: 2pxy_A 2z31_A 1ac6_A Back     alignment and structure
>1oaq_L Light chain; antibody, allergy, IGE, conformational diversity, multispecificity; 1.50A {Rattus rattus} SCOP: b.1.1.1 PDB: 1ocw_L 2bjm_L* 1oau_L* 1oar_L* 1oaz_L 1mfa_L* 1a6v_L* 1oax_L* 1oay_L* 1a6w_L* 1a6u_L 1dl7_L* Back     alignment and structure
>3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} Back     alignment and structure
>2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C Back     alignment and structure
>1hxm_A Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>3u2s_H PG9 heavy chain; greek KEY, immunoglobulin, immune recognition, immune system; HET: PCA TYS BU3 NAG BMA MAN; 1.80A {Homo sapiens} PDB: 3u4e_H* 3u36_H 3mug_B* 3lrs_H* 3mme_H* 2qsc_H* Back     alignment and structure
>3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B Back     alignment and structure
>1ypz_E T cell receptor delta, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1nko_A Sialic acid binding IG-like lectin 7; immunoglobulin, siglec7, immune system; 1.45A {Homo sapiens} SCOP: b.1.1.1 PDB: 2g5r_A* 1o7v_A* 2df3_A* 1o7s_A* 2hrl_A* Back     alignment and structure
>1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H Back     alignment and structure
>1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1bec_A 14.3.D T cell antigen receptor; T cell receptor; 1.70A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1jck_A 1l0x_A 1sbb_A 1l0y_A 3c6l_B 1mwa_B* 1g6r_B* 1tcr_B* 2ckb_B 2q86_B* 1lp9_F 2j8u_F 2jcc_F 2uwe_F 3mbe_D* 1d9k_B* 2aq3_A 3mc0_A 3byt_A 3bzd_A ... Back     alignment and structure
>3rrq_A Protein PD-1, programmed cell death protein 1; programmed death-1, costimulatory, immune system; 2.10A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} Back     alignment and structure
>2yc1_B Single chain antibody fragment 9004G; immune system-toxin complex, scorpion toxin; 1.90A {Homo sapiens} PDB: 2ybr_B 3lh2_L 3h3p_L 3lhp_L Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>3moq_A NEW antigen receptor variable domain, P3(40) PEPT amyloid beta A4 protein; AB-ignar, AB-12Y-2, glycoprotein, membran protease inhibitor; 2.05A {Orectolobus maculatus} PDB: 2z8w_C 2z8v_C 1ves_A 1ver_A Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3kg5_A B-cell antigen receptor complex-associated protei chain; CD79B, IG-beta, BCR, immunoglobulin domain, protein binding; 3.20A {Homo sapiens} Back     alignment and structure
>1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>2atp_B T-cell surface glycoprotein CD8 beta chain; CD8AB, CD8AA, MHC, immune system; HET: NAG; 2.40A {Mus musculus} SCOP: b.1.1.1 PDB: 3b9k_B* Back     alignment and structure
>3sob_H Antibody heavy chain, low-density lipoprotein receptor-related protein; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_B 3uls_H 3ulu_D* 3ulv_D* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.68
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.66
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.64
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.63
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.63
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 99.63
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 99.63
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.62
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 99.62
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 99.61
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 99.6
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.58
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 99.58
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 99.57
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 99.57
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 99.57
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 99.56
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 99.55
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.55
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 99.55
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 99.55
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.54
d2ifga192 High affinity nerve growth factor receptor TrkA, d 99.53
d2avga1110 Cardiac myosin binding protein C, different domain 99.53
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.53
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.53
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 99.53
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.52
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.52
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.52
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 99.51
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 99.5
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 99.5
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 99.5
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 99.48
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 99.47
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.47
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 99.44
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 99.44
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.44
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 99.44
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 99.44
d1pd6a_94 Cardiac myosin binding protein C, different domain 99.43
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 99.42
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 99.42
d1gxea_130 Cardiac myosin binding protein C, different domain 99.41
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.4
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 99.39
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.35
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 99.35
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.32
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 99.3
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 99.29
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 99.29
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 99.28
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 99.28
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 99.27
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.25
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 99.23
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 99.22
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 99.16
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 99.14
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 98.93
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 98.81
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 98.81
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 98.78
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 98.74
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 98.73
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 98.71
d2esvd1110 T-cell antigen receptor {Human (Homo sapiens), alp 98.68
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 98.67
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 98.66
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 98.65
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 98.64
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 98.63
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 98.61
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 98.6
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 98.6
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 98.59
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 98.58
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 98.57
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 98.57
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 98.56
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 98.55
d2avga1110 Cardiac myosin binding protein C, different domain 98.55
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 98.54
d1ospl1107 Immunoglobulin light chain kappa variable domain, 98.53
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 98.53
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 98.52
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 98.51
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 98.51
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 98.51
d2g5ra1121 N-terminal domain of sialic acid binding Ig-like l 98.51
d1lgva1112 Immunoglobulin light chain lambda variable domain, 98.5
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.49
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 98.49
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 98.49
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.48
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 98.47
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 98.45
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 98.45
d1rzfl1111 Immunoglobulin light chain lambda variable domain, 98.45
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 98.45
d1u3ha1110 T-cell antigen receptor {Mouse (Mus musculus), alp 98.44
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 98.43
d1kgcd1112 T-cell antigen receptor {Human (Homo sapiens), alp 98.43
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 98.42
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 98.41
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 98.41
d1smoa_113 TREM-1 (triggering receptor expressed on myeloid c 98.4
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 98.4
d1fo0a_115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.4
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 98.4
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 98.4
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 98.4
d1oaql_110 Immunoglobulin light chain lambda variable domain, 98.39
d1h5ba_113 T-cell antigen receptor {Mouse (Mus musculus), alp 98.39
d1j8hd1115 T-cell antigen receptor {Human (Homo sapiens), alp 98.39
d1bd2d1111 T-cell antigen receptor {Human (Homo sapiens), alp 98.39
d1bwwa_109 Immunoglobulin light chain kappa variable domain, 98.39
d1ogad1115 T-cell antigen receptor {Human (Homo sapiens), alp 98.39
d1d5il1107 Immunoglobulin light chain kappa variable domain, 98.38
d1vesa_113 Novel antigen receptor 12Y-2 {Spotted wobbegong (O 98.38
d1mexl1107 Immunoglobulin light chain kappa variable domain, 98.38
d1op3k1106 Immunoglobulin light chain kappa variable domain, 98.38
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 98.38
d8faba1103 Immunoglobulin light chain lambda variable domain, 98.36
d2rhea_114 Immunoglobulin light chain lambda variable domain, 98.36
d2esve1111 T-cell antigen receptor {Human (Homo sapiens), bet 98.35
d1jhll_108 Immunoglobulin light chain kappa variable domain, 98.35
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.35
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 98.35
d1w72l1109 Immunoglobulin light chain lambda variable domain, 98.35
d1sq2n_112 Novel antigen receptor (against lysozyme) {Nurse s 98.34
d1mqkl_109 Immunoglobulin light chain kappa variable domain, 98.34
d1ac6a_110 T-cell antigen receptor {Mouse (Mus musculus), alp 98.33
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 98.33
d2fx7l1108 Immunoglobulin light chain kappa variable domain, 98.32
d1cd0a_111 Immunoglobulin light chain lambda variable domain, 98.31
d1olla293 Ligand binding domain of NK receptor NKp46 {Human 98.3
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 98.29
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.29
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 98.27
d1kgce1112 T-cell antigen receptor {Human (Homo sapiens), bet 98.27
d2gsia1111 Immunoglobulin light chain kappa variable domain, 98.26
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 98.25
d1nfde1108 Immunoglobulin light chain lambda variable domain, 98.25
d1ypzf1120 T-cell antigen receptor {Human (Homo sapiens), gam 98.23
d2ij0c1118 T-cell antigen receptor {Human (Homo sapiens), bet 98.23
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.23
d1q9ra1113 Immunoglobulin light chain kappa variable domain, 98.22
d1ogae1114 T-cell antigen receptor {Human (Homo sapiens), bet 98.22
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 98.22
d1j05a_111 Immunoglobulin light chain kappa variable domain, 98.2
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 98.2
d3cx5k1107 Immunoglobulin light chain kappa variable domain, 98.19
d2ntsp1113 T-cell antigen receptor {Human (Homo sapiens), bet 98.19
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 98.18
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 98.18
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 98.16
d1yqvl1104 Immunoglobulin light chain kappa variable domain, 98.16
d2aq2a1110 T-cell antigen receptor {Mouse (Mus musculus), bet 98.16
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 98.15
d1mjul1112 Immunoglobulin light chain kappa variable domain, 98.14
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 98.14
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 98.13
d1ncwl1112 Immunoglobulin light chain kappa variable domain, 98.12
d1n4xl_113 Immunoglobulin light chain kappa variable domain, 98.12
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 98.12
d2ifga192 High affinity nerve growth factor receptor TrkA, d 98.12
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 98.1
d1hxma1120 T-cell antigen receptor {Human (Homo sapiens), gam 98.09
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 98.08
d1u9ka_110 TREM-1 (triggering receptor expressed on myeloid c 98.07
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 98.06
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 98.05
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 98.05
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 98.05
d1j8he1113 T-cell antigen receptor {Human (Homo sapiens), bet 98.03
d1dqta_117 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 98.03
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 98.01
d1hxmb1123 T-cell antigen receptor {Human (Homo sapiens), del 98.0
d1nkra299 Killer cell inhibitory receptor {Human (Homo sapie 98.0
d2bnub1112 T-cell antigen receptor {Human (Homo sapiens), bet 98.0
d1yjdc1118 CD28 {Human (Homo sapiens) [TaxId: 9606]} 98.0
d1ugna196 Ligand binding domain of lir-1 (ilt2) {Human (Homo 97.97
d1ymmd196 T-cell antigen receptor {Human (Homo sapiens), alp 97.95
d1pd6a_94 Cardiac myosin binding protein C, different domain 97.95
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 97.94
d1nfdb1113 T-cell antigen receptor {Mouse (Mus musculus), bet 97.93
d1i8lc_118 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 97.92
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 97.91
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 97.89
d2cdeb1112 T-cell antigen receptor {Human (Homo sapiens), bet 97.89
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 97.88
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 97.87
d1fo0b_112 T-cell antigen receptor {Mouse (Mus musculus), bet 97.86
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 97.82
d2agjh1120 Immunoglobulin heavy chain variable domain, VH {En 97.79
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 97.74
d1nkra196 Killer cell inhibitory receptor {Human (Homo sapie 97.7
d1gxea_130 Cardiac myosin binding protein C, different domain 97.69
d1nlbh1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.69
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 97.69
d1ugna298 Ligand binding domain of lir-1 (ilt2) {Human (Homo 97.69
d3b5ha280 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 97.67
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 97.67
d1dr9a295 CD80, second domain {Human (Homo sapiens) [TaxId: 97.66
d1dn0b1120 Immunoglobulin heavy chain variable domain, VH {Hu 97.64
d1k5nb_100 beta2-microglobulin {Human (Homo sapiens) [TaxId: 97.62
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 97.6
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 97.6
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 97.57
d1iqdb1117 Immunoglobulin heavy chain variable domain, VH {Hu 97.56
d1f3dh1115 Immunoglobulin heavy chain variable domain, VH {Mo 97.53
d1fltx_95 Second domain of the Flt-1 receptor {Human (Homo s 97.52
d1muja1100 Class II MHC alpha chain, C-terminal domain {Mouse 97.52
d1pg7x1120 Immunoglobulin heavy chain variable domain, VH {Mo 97.52
d1de4a194 Hemochromatosis protein Hfe, alpha-3 domain {Human 97.51
d1kxvc_119 Camelid IG heavy chain variable domain, VHh {Camel 97.51
d1indh1114 Immunoglobulin heavy chain variable domain, VH {Mo 97.5
d1hdmb198 Class II MHC beta chain, C-terminal domain {Human 97.5
d1c5db1117 Immunoglobulin heavy chain variable domain, VH {Ra 97.44
d1um5h1117 Immunoglobulin heavy chain variable domain, VH {Mo 97.44
d1jpth1117 Immunoglobulin heavy chain variable domain, VH {En 97.44
d2fbjh1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.44
d1qnzh_119 Immunoglobulin heavy chain variable domain, VH {Mo 97.43
d1rz7h1119 Immunoglobulin heavy chain variable domain, VH {Hu 97.42
d1lk2b_99 beta2-microglobulin {Mouse (Mus musculus) [TaxId: 97.4
d1etzb1126 Immunoglobulin heavy chain variable domain, VH {Mo 97.39
d2ck0h1109 Immunoglobulin heavy chain variable domain, VH {Mo 97.36
d1tjgh1132 Immunoglobulin heavy chain variable domain, VH {En 97.36
d1mqkh_123 Immunoglobulin heavy chain variable domain, VH {Mo 97.35
d1j05b_121 Immunoglobulin heavy chain variable domain, VH {Mo 97.35
d1fnga1101 Class II MHC alpha chain, C-terminal domain {Mouse 97.35
d7fabh1116 Immunoglobulin heavy chain variable domain, VH {Hu 97.35
d1a2yb_116 Immunoglobulin heavy chain variable domain, VH {Mo 97.34
d1op3h1125 Immunoglobulin heavy chain variable domain, VH {En 97.33
d1sjva_107 Camelid IG heavy chain variable domain, VHh {Llama 97.33
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 97.3
d1ieha_135 Camelid IG heavy chain variable domain, VHh {Llama 97.29
d1ol0a_121 Immunoglobulin heavy chain variable domain, VH {En 97.29
d1nfdf1121 Immunoglobulin heavy chain variable domain, VH {Ha 97.28
d1d5mb198 Class II MHC beta chain, C-terminal domain {Human 97.28
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 97.26
d1oari_103 Immunoglobulin heavy chain variable domain, VH {Ra 97.26
d1xiwa_91 CD3 epsilon chain ectodomain fragment {Human (Homo 97.25
d1ai1h1120 Immunoglobulin heavy chain variable domain, VH {Mo 97.24
d1vgeh1122 Immunoglobulin heavy chain variable domain, VH {Hu 97.24
d2p49b1121 Camelid IG heavy chain variable domain, VHh {Camel 97.23
d1uvqa199 Class II MHC alpha chain, C-terminal domain {Human 97.22
d1t7va194 Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Hu 97.22
d1jnhb1117 Immunoglobulin heavy chain variable domain, VH {Mo 97.2
d1mfah1117 Immunoglobulin heavy chain variable domain, VH {Mo 97.19
d1lo4h1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.19
d1jbja2100 CD3 epsilon chain ectodomain fragment {Mouse (Mus 97.19
d1zvya1124 Camelid IG heavy chain variable domain, VHh {Camel 97.17
d1r0ah1123 Immunoglobulin heavy chain variable domain, VH {Mo 97.16
d1mjuh1116 Immunoglobulin heavy chain variable domain, VH {Mo 97.13
d1eapb1119 Immunoglobulin heavy chain variable domain, VH {Mo 97.13
d1ad9b1120 Immunoglobulin heavy chain variable domain, VH {En 97.13
d1q9rb1122 Immunoglobulin heavy chain variable domain, VH {Mo 97.13
d1ncwh1119 Immunoglobulin heavy chain variable domain, VH {Mo 97.13
d1bz7b1122 Immunoglobulin heavy chain variable domain, VH {Mo 97.12
d1dlfh_120 Immunoglobulin heavy chain variable domain, VH {Mo 97.12
d1hdma1103 Class II MHC alpha chain, C-terminal domain {Human 97.11
d3frua191 Fc (IgG) receptor, alpha-3 domain {Rat (Rattus nor 97.1
d1lmka1126 Immunoglobulin heavy chain variable domain, VH {Mo 97.1
d1i3ua_127 Camelid IG heavy chain variable domain, VHh {Llama 97.1
d2jelh1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.09
d1dfbh1126 Immunoglobulin heavy chain variable domain, VH {Hu 97.06
d2fb4h1127 Immunoglobulin heavy chain variable domain, VH {Hu 97.06
d1rhhb1130 Immunoglobulin heavy chain variable domain, VH {Hu 97.05
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 97.04
d1rjca1126 Camelid IG heavy chain variable domain, VHh {Camel 97.02
d2mhaa189 Class I MHC, alpha-3 domain {Mouse (Mus musculus) 96.99
d1rihh1125 Immunoglobulin heavy chain variable domain, VH {Mo 96.97
d1rzga1130 Immunoglobulin heavy chain variable domain, VH {Hu 96.97
d1fp5a2105 Immunoglobulin heavy chain epsilon constant domain 96.96
d2fx7h1127 Immunoglobulin heavy chain variable domain, VH {Hu 96.96
d2h26a196 CD1, alpha-3 domain {Human (Homo sapiens), CD1a [T 96.95
d2nxyd1128 Immunoglobulin heavy chain variable domain, VH {Hu 96.95
d1ct8b1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.92
d1hnfa1101 CD2, first domain {Human (Homo sapiens) [TaxId: 96 96.9
d1rzfh1133 Immunoglobulin heavy chain variable domain, VH {Hu 96.9
d2b1hh1124 Immunoglobulin heavy chain variable domain, VH {En 96.89
d1q0xl2102 Immunoglobulin light chain lambda constant domain, 96.87
d1n0xh1127 Immunoglobulin heavy chain variable domain, VH {Hu 96.85
d1uvqb197 Class II MHC beta chain, C-terminal domain {Human 96.84
d3c2ah1131 Immunoglobulin heavy chain variable domain, VH {Hu 96.83
d1xaua_104 B and T lymphocyte attenuator, Btla {Mouse (Mus mu 96.77
d1ow0a2108 Immunoglobulin heavy chain alpha constant domain 3 96.76
d1o0va1104 Immunoglobulin heavy chain epsilon constant domain 96.75
d1u58a198 Immunomodulatory protein m144, alpha-3 domain {Mur 96.74
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 96.73
d1rzfl2102 Immunoglobulin light chain lambda constant domain, 96.72
d1yedb1124 Immunoglobulin heavy chain variable domain, VH {Mo 96.7
d1i1ca2102 Immunoglobulin heavy chain gamma constant domain 3 96.7
d1ogae2127 T-cell antigen receptor {Human (Homo sapiens), bet 96.66
d3cx5j1127 Immunoglobulin heavy chain variable domain, VH {Mo 96.65
d1igtb4102 Immunoglobulin heavy chain gamma constant domain 3 96.64
d2fbjh2102 Immunoglobulin heavy chain alpha constant domain 1 96.63
d1mjuh2102 Immunoglobulin heavy chain gamma constant domain 1 96.59
d1i1ca1103 Immunoglobulin heavy chain gamma constant domain 2 96.53
d1k5na195 Class I MHC, alpha-3 domain {Human (Homo sapiens) 96.5
d1l6xa2102 Immunoglobulin heavy chain gamma constant domain 3 96.5
d1nfde2104 Immunoglobulin light chain lambda constant domain, 96.5
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 96.49
d1b2wh1117 Immunoglobulin heavy chain variable domain, VH {En 96.48
d1hxma286 T-cell antigen receptor {Human (Homo sapiens), gam 96.46
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 96.44
d1kcvh2101 Immunoglobulin heavy chain gamma constant domain 1 96.42
d3d85d187 The p40 domain of interleukin-12 (IL-12 beta chain 96.41
d1mjul2107 Immunoglobulin light chain kappa constant domain, 96.39
d1hyrc194 Class I MHC homolog, alpha-3 domain {Human (Homo s 96.36
d1cqka_101 Immunoglobulin heavy chain gamma constant domain 3 96.31
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 96.23
d1c5cl2107 Immunoglobulin light chain kappa constant domain, 96.21
d1dn0b2105 Immunoglobulin heavy chain mu constant domain 1, C 96.13
d1hxmb2107 T-cell antigen receptor {Human (Homo sapiens), del 96.11
d1k5nb_100 beta2-microglobulin {Human (Homo sapiens) [TaxId: 96.1
d1sy6a181 CD3 gamma chain ectodomain fragment {Human (Homo s 96.09
d1l6xa1105 Immunoglobulin heavy chain gamma constant domain 2 96.02
d1fn4b1116 Immunoglobulin heavy chain variable domain, VH {Ra 95.93
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 95.8
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 95.78
d1fp5a1103 Immunoglobulin heavy chain epsilon constant domain 95.75
d1igtb3119 Immunoglobulin heavy chain gamma constant domain 2 95.74
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 95.48
d1c5ch2103 Immunoglobulin heavy chain gamma constant domain 1 95.44
d1hdmb198 Class II MHC beta chain, C-terminal domain {Human 95.36
d1dr9a295 CD80, second domain {Human (Homo sapiens) [TaxId: 95.11
d1lk2b_99 beta2-microglobulin {Mouse (Mus musculus) [TaxId: 94.84
d1pfca_111 Immunoglobulin heavy chain gamma constant domain 3 94.66
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 94.65
d1ow0a1101 Immunoglobulin heavy chain alpha constant domain 2 94.53
d1fnga1101 Class II MHC alpha chain, C-terminal domain {Mouse 94.32
d1jbja186 CD3 gamma chain ectodomain fragment {Mouse (Mus mu 94.24
d1muja1100 Class II MHC alpha chain, C-terminal domain {Mouse 94.23
d1k5na195 Class I MHC, alpha-3 domain {Human (Homo sapiens) 94.05
d1bd2d1111 T-cell antigen receptor {Human (Homo sapiens), alp 94.03
d2mhaa189 Class I MHC, alpha-3 domain {Mouse (Mus musculus) 93.91
d1kgcd1112 T-cell antigen receptor {Human (Homo sapiens), alp 93.88
d1t7va194 Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Hu 93.83
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 93.81
d1hdma1103 Class II MHC alpha chain, C-terminal domain {Human 93.8
d2esvd1110 T-cell antigen receptor {Human (Homo sapiens), alp 93.63
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 93.59
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 93.55
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 93.53
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 93.45
d2h26a196 CD1, alpha-3 domain {Human (Homo sapiens), CD1a [T 93.3
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 93.28
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 93.26
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 93.1
d1ospl1107 Immunoglobulin light chain kappa variable domain, 93.09
d1d5il1107 Immunoglobulin light chain kappa variable domain, 93.06
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 93.0
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 92.88
d1uvqa199 Class II MHC alpha chain, C-terminal domain {Human 92.84
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 92.83
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 92.82
d1d5mb198 Class II MHC beta chain, C-terminal domain {Human 92.76
d1de4a194 Hemochromatosis protein Hfe, alpha-3 domain {Human 92.68
d1jhll_108 Immunoglobulin light chain kappa variable domain, 92.66
d8faba1103 Immunoglobulin light chain lambda variable domain, 92.63
d1mqkl_109 Immunoglobulin light chain kappa variable domain, 92.61
d2ij0c1118 T-cell antigen receptor {Human (Homo sapiens), bet 92.5
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 92.47
d1op3k1106 Immunoglobulin light chain kappa variable domain, 92.4
d1u58a198 Immunomodulatory protein m144, alpha-3 domain {Mur 92.28
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 92.23
d1bwwa_109 Immunoglobulin light chain kappa variable domain, 92.2
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 92.19
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 92.04
d1j8hd1115 T-cell antigen receptor {Human (Homo sapiens), alp 92.04
d3frua191 Fc (IgG) receptor, alpha-3 domain {Rat (Rattus nor 92.0
d1h5ba_113 T-cell antigen receptor {Mouse (Mus musculus), alp 91.88
d1nkra299 Killer cell inhibitory receptor {Human (Homo sapie 91.83
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 91.83
d1mexl1107 Immunoglobulin light chain kappa variable domain, 91.71
d1uvqb197 Class II MHC beta chain, C-terminal domain {Human 91.63
d1lgva1112 Immunoglobulin light chain lambda variable domain, 91.57
d1olla293 Ligand binding domain of NK receptor NKp46 {Human 91.48
d1fo0a_115 T-cell antigen receptor {Mouse (Mus musculus), alp 91.22
d2esve1111 T-cell antigen receptor {Human (Homo sapiens), bet 91.2
d2fx7l1108 Immunoglobulin light chain kappa variable domain, 91.12
d2ntsp1113 T-cell antigen receptor {Human (Homo sapiens), bet 91.04
d1fo0b_112 T-cell antigen receptor {Mouse (Mus musculus), bet 90.83
d1w72l1109 Immunoglobulin light chain lambda variable domain, 90.76
d1igyb3116 Immunoglobulin heavy chain gamma constant domain 2 90.75
d1u3ha1110 T-cell antigen receptor {Mouse (Mus musculus), alp 90.66
d1yqvl1104 Immunoglobulin light chain kappa variable domain, 90.59
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 90.58
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 90.57
d1mjul1112 Immunoglobulin light chain kappa variable domain, 90.52
d1kgce1112 T-cell antigen receptor {Human (Homo sapiens), bet 90.49
d2aq2a1110 T-cell antigen receptor {Mouse (Mus musculus), bet 90.39
d1jbja2100 CD3 epsilon chain ectodomain fragment {Mouse (Mus 90.35
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 90.16
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 90.11
d3cx5k1107 Immunoglobulin light chain kappa variable domain, 89.84
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 89.71
d2gsia1111 Immunoglobulin light chain kappa variable domain, 89.68
d1nfde1108 Immunoglobulin light chain lambda variable domain, 89.54
d1vesa_113 Novel antigen receptor 12Y-2 {Spotted wobbegong (O 89.42
d1rzfl1111 Immunoglobulin light chain lambda variable domain, 89.29
d1sq2n_112 Novel antigen receptor (against lysozyme) {Nurse s 89.26
d3d85d187 The p40 domain of interleukin-12 (IL-12 beta chain 89.25
d1oaql_110 Immunoglobulin light chain lambda variable domain, 89.23
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 88.93
d3b5ha280 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 88.79
d2rhea_114 Immunoglobulin light chain lambda variable domain, 88.79
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 88.48
d1nfdb1113 T-cell antigen receptor {Mouse (Mus musculus), bet 88.47
d1ac6a_110 T-cell antigen receptor {Mouse (Mus musculus), alp 88.35
d1j05a_111 Immunoglobulin light chain kappa variable domain, 88.22
d1ow0a1101 Immunoglobulin heavy chain alpha constant domain 2 88.22
d1q9ra1113 Immunoglobulin light chain kappa variable domain, 88.08
d2bnub1112 T-cell antigen receptor {Human (Homo sapiens), bet 88.01
d1hxma1120 T-cell antigen receptor {Human (Homo sapiens), gam 87.99
d1nkra196 Killer cell inhibitory receptor {Human (Homo sapie 87.84
d1hxmb1123 T-cell antigen receptor {Human (Homo sapiens), del 87.74
d1cd0a_111 Immunoglobulin light chain lambda variable domain, 87.68
d1xiwb_74 CD3 delta chain ectodomain fragment {Human (Homo s 87.53
d1ncwl1112 Immunoglobulin light chain kappa variable domain, 87.23
d1ugna298 Ligand binding domain of lir-1 (ilt2) {Human (Homo 86.9
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 86.8
d1ugna196 Ligand binding domain of lir-1 (ilt2) {Human (Homo 86.41
d1ogae1114 T-cell antigen receptor {Human (Homo sapiens), bet 85.15
d1fltx_95 Second domain of the Flt-1 receptor {Human (Homo s 84.83
d2cdeb1112 T-cell antigen receptor {Human (Homo sapiens), bet 84.32
d1n4xl_113 Immunoglobulin light chain kappa variable domain, 84.04
d2g5ra1121 N-terminal domain of sialic acid binding Ig-like l 83.6
d1ypzf1120 T-cell antigen receptor {Human (Homo sapiens), gam 82.8
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 82.76
d1ow0a2108 Immunoglobulin heavy chain alpha constant domain 3 82.68
d1dqta_117 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 82.16
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 81.99
d1j8he1113 T-cell antigen receptor {Human (Homo sapiens), bet 81.83
d1jbja186 CD3 gamma chain ectodomain fragment {Mouse (Mus mu 81.57
d1c5cl2107 Immunoglobulin light chain kappa constant domain, 81.38
d2fbjh2102 Immunoglobulin heavy chain alpha constant domain 1 81.16
d1xiwa_91 CD3 epsilon chain ectodomain fragment {Human (Homo 80.36
d1rzfl2102 Immunoglobulin light chain lambda constant domain, 80.34
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 80.1
d1sy6a181 CD3 gamma chain ectodomain fragment {Human (Homo s 80.1
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Immunoglobulin
family: I set domains
domain: Axonin-1
species: Chicken (Gallus gallus) [TaxId: 9031]
Probab=99.68  E-value=8.2e-17  Score=105.86  Aligned_cols=75  Identities=21%  Similarity=0.356  Sum_probs=63.0

Q ss_pred             eeeEEEecCeEEEeCCcEEEEeeeCCccCCcceeEEEEeCCCeeeEEeeeecCCceEEEccCCeEEEeecCcCCCCcceE
Q psy12724         66 QSYTVNIMDEHVLKGNSAVLKCHIPSFVADYVAVESWISDQGEELFVDMTESTDGKYLVLPSGELHIRDVGPEDGYKSYQ  145 (167)
Q Consensus        66 g~y~c~~~~~~v~~G~~a~l~C~~~~~~~~p~p~i~W~k~~~~~l~~~~~~~~~~r~~~~~~g~L~I~~v~~~D~~G~Y~  145 (167)
                      +.|.-.+.|..+..|+++.|.|.+.   |.|.|.++|+||+ ..+.      .+.++.+ .++.|.|.+++.+|+ |.|+
T Consensus         2 P~f~~~~~~~~v~~G~~~~l~C~~~---g~P~p~v~W~k~g-~~i~------~~~~~~~-~~~~L~i~~v~~~D~-G~Y~   69 (89)
T d1cs6a4           2 PDWLDVITDTEADIGSDLRWSCVAS---GKPRPAVRWLRDG-QPLA------SQNRIEV-SGGELRFSKLVLEDS-GMYQ   69 (89)
T ss_dssp             EEEEECCCCEEEETTCCEEEECEEE---EESCCEEEEEETT-EECC------CCSSEEE-ETTEEEESSCCGGGC-EEEE
T ss_pred             CCeEEECCCEEECCCCcEEEEEEEE---EEcCCEEEEEEee-cccc------ccceeee-eeeeEEEEeecccCC-EEEE
Confidence            3456667888999999999999997   4599999999997 5663      3456655 578999999999999 9999


Q ss_pred             EEeeecC
Q psy12724        146 CRTKHRL  152 (167)
Q Consensus       146 C~a~n~~  152 (167)
                      |.|.|..
T Consensus        70 C~a~N~~   76 (89)
T d1cs6a4          70 CVAENKH   76 (89)
T ss_dssp             EEEEETT
T ss_pred             EEEEeCC
Confidence            9999987



>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} Back     information, alignment and structure
>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1fltx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} Back     information, alignment and structure
>d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1de4a1 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kxvc_ b.1.1.1 (C:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1indh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1rz7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1lk2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1tjgh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1mqkh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1j05b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1fnga1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} Back     information, alignment and structure
>d7fabh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1a2yb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]} Back     information, alignment and structure
>d1op3h1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1sjva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ieha_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1ol0a_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1nfdf1 b.1.1.1 (F:1-114) Immunoglobulin heavy chain variable domain, VH {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1d5mb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xiwa_ b.1.1.4 (A:) CD3 epsilon chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]} Back     information, alignment and structure
>d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d2p49b1 b.1.1.1 (B:1-121) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1uvqa1 b.1.1.2 (A:85-183) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1t7va1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1mfah1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1lo4h1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]} Back     information, alignment and structure
>d1jbja2 b.1.1.4 (A:1-100) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zvya1 b.1.1.1 (A:2-125) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1r0ah1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1mjuh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1eapb1 b.1.1.1 (B:1-124) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ad9b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1q9rb1 b.1.1.1 (B:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1ncwh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d1bz7b1 b.1.1.1 (B:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1dlfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1hdma1 b.1.1.2 (A:94-196) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d3frua1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lmka1 b.1.1.1 (A:2-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1i3ua_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d2jelh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1dfbh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} Back     information, alignment and structure
>d2fb4h1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} Back     information, alignment and structure
>d1rhhb1 b.1.1.1 (B:3-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjca1 b.1.1.1 (A:2-127) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d2mhaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rihh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1rzga1 b.1.1.1 (A:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fx7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d2h26a1 b.1.1.2 (A:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} Back     information, alignment and structure
>d2nxyd1 b.1.1.1 (D:3001-3128) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1ct8b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.3 [TaxId: 10090]} Back     information, alignment and structure
>d1hnfa1 b.1.1.1 (A:4-104) CD2, first domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzfh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d2b1hh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1q0xl2 b.1.1.2 (L:108-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0xh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1uvqb1 b.1.1.2 (B:95-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d3c2ah1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ow0a2 b.1.1.2 (A:343-450) Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0va1 b.1.1.2 (A:228-330) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u58a1 b.1.1.2 (A:145-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus [TaxId: 10366]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzfl2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yedb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1i1ca2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ogae2 b.1.1.2 (E:119-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d3cx5j1 b.1.1.1 (J:1-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d1igtb4 b.1.1.2 (B:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} Back     information, alignment and structure
>d2fbjh2 b.1.1.2 (H:119-220) Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mjuh2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i1ca1 b.1.1.2 (A:239-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k5na1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6xa2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nfde2 b.1.1.2 (E:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b2wh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1hxma2 b.1.1.2 (A:121-206) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kcvh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3d85d1 b.1.1.4 (D:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjul2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hyrc1 b.1.1.2 (C:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-a [TaxId: 9606]} Back     information, alignment and structure
>d1cqka_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c5cl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxmb2 b.1.1.2 (B:124-230) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sy6a1 b.1.1.4 (A:1-81) CD3 gamma chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6xa1 b.1.1.2 (A:237-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fn4b1 b.1.1.1 (B:1-106) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fp5a1 b.1.1.2 (A:336-438) Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igtb3 b.1.1.2 (B:236-361) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c5ch2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lk2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pfca_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ow0a1 b.1.1.2 (A:242-342) Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnga1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} Back     information, alignment and structure
>d1jbja1 b.1.1.4 (A:101-186) CD3 gamma chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} Back     information, alignment and structure
>d1k5na1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2mhaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1t7va1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1hdma1 b.1.1.2 (A:94-196) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2h26a1 b.1.1.2 (A:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1uvqa1 b.1.1.2 (A:85-183) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1d5mb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} Back     information, alignment and structure
>d1de4a1 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1u58a1 b.1.1.2 (A:145-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus [TaxId: 10366]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d3frua1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1uvqb1 b.1.1.2 (B:95-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} Back     information, alignment and structure
>d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1igyb3 b.1.1.2 (B:236-361) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1jbja2 b.1.1.4 (A:1-100) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} Back     information, alignment and structure
>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} Back     information, alignment and structure
>d3d85d1 b.1.1.4 (D:1-87) The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1ow0a1 b.1.1.2 (A:242-342) Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} Back     information, alignment and structure
>d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1xiwb_ b.1.1.4 (B:) CD3 delta chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1fltx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ow0a2 b.1.1.2 (A:343-450) Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1jbja1 b.1.1.4 (A:101-186) CD3 gamma chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c5cl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbjh2 b.1.1.2 (H:119-220) Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xiwa_ b.1.1.4 (A:) CD3 epsilon chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzfl2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sy6a1 b.1.1.4 (A:1-81) CD3 gamma chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure