Psyllid ID: psy12726
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 558 | ||||||
| 350402222 | 1197 | PREDICTED: ATP-dependent RNA helicase DH | 0.399 | 0.186 | 0.973 | 1e-128 | |
| 340727152 | 1197 | PREDICTED: ATP-dependent RNA helicase DH | 0.399 | 0.186 | 0.973 | 1e-128 | |
| 66558592 | 1192 | PREDICTED: ATP-dependent RNA helicase DH | 0.399 | 0.187 | 0.973 | 1e-128 | |
| 380027917 | 1192 | PREDICTED: LOW QUALITY PROTEIN: ATP-depe | 0.399 | 0.187 | 0.973 | 1e-128 | |
| 383854100 | 1200 | PREDICTED: ATP-dependent RNA helicase DH | 0.399 | 0.185 | 0.973 | 1e-128 | |
| 345489444 | 1216 | PREDICTED: ATP-dependent RNA helicase DH | 0.399 | 0.183 | 0.968 | 1e-128 | |
| 345489442 | 1203 | PREDICTED: ATP-dependent RNA helicase DH | 0.399 | 0.185 | 0.968 | 1e-128 | |
| 242012890 | 1236 | pre-mRNA-splicing factor ATP-dependent R | 0.399 | 0.180 | 0.968 | 1e-127 | |
| 307198400 | 1232 | ATP-dependent RNA helicase DHX8 [Harpegn | 0.399 | 0.181 | 0.964 | 1e-127 | |
| 307169908 | 1204 | ATP-dependent RNA helicase DHX8 [Campono | 0.399 | 0.185 | 0.964 | 1e-127 |
| >gi|350402222|ref|XP_003486410.1| PREDICTED: ATP-dependent RNA helicase DHX8-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Score = 464 bits (1195), Expect = e-128, Method: Compositional matrix adjust.
Identities = 217/223 (97%), Positives = 222/223 (99%)
Query: 11 QMAEFPLEPNLSKMLIMSVHLQCSDEVLTIVSMLSVQNVFYRPKDKQALADQKKAKFNQM 70
+MAEFPLEPNLSKMLIMSVHLQCSDE+LTIVSMLSVQNVFYRPKDKQALADQKKAKFNQ
Sbjct: 955 RMAEFPLEPNLSKMLIMSVHLQCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFNQP 1014
Query: 71 EGDHITLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGK 130
EGDH+TLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGK
Sbjct: 1015 EGDHLTLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGK 1074
Query: 131 NTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTT 190
NTVR+QKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTT
Sbjct: 1075 NTVRIQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTT 1134
Query: 191 KEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPL 233
KEYMREVT+IDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPL
Sbjct: 1135 KEYMREVTTIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPL 1177
|
Source: Bombus impatiens Species: Bombus impatiens Genus: Bombus Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|340727152|ref|XP_003401914.1| PREDICTED: ATP-dependent RNA helicase DHX8-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|66558592|ref|XP_623289.1| PREDICTED: ATP-dependent RNA helicase DHX8-like isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380027917|ref|XP_003697661.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent RNA helicase DHX8-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|383854100|ref|XP_003702560.1| PREDICTED: ATP-dependent RNA helicase DHX8 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|345489444|ref|XP_001606022.2| PREDICTED: ATP-dependent RNA helicase DHX8-like isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|345489442|ref|XP_003426140.1| PREDICTED: ATP-dependent RNA helicase DHX8-like isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|242012890|ref|XP_002427158.1| pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22, putative [Pediculus humanus corporis] gi|212511441|gb|EEB14420.1| pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|307198400|gb|EFN79342.1| ATP-dependent RNA helicase DHX8 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|307169908|gb|EFN62417.1| ATP-dependent RNA helicase DHX8 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 558 | ||||||
| FB|FBgn0086895 | 1242 | pea "peanuts" [Drosophila mela | 0.431 | 0.194 | 0.827 | 1e-109 | |
| UNIPROTKB|F1S1H3 | 1212 | DHX8 "Uncharacterized protein" | 0.431 | 0.198 | 0.762 | 7.5e-101 | |
| UNIPROTKB|E2R9R9 | 1216 | DHX8 "Uncharacterized protein" | 0.431 | 0.198 | 0.762 | 7.5e-101 | |
| UNIPROTKB|Q14562 | 1220 | DHX8 "ATP-dependent RNA helica | 0.431 | 0.197 | 0.762 | 7.5e-101 | |
| UNIPROTKB|F1MEM4 | 1230 | DHX8 "Uncharacterized protein" | 0.431 | 0.195 | 0.762 | 7.5e-101 | |
| UNIPROTKB|D4A805 | 1242 | Dhx8 "Protein Dhx8" [Rattus no | 0.431 | 0.194 | 0.762 | 7.5e-101 | |
| MGI|MGI:1306823 | 1244 | Dhx8 "DEAH (Asp-Glu-Ala-His) b | 0.431 | 0.193 | 0.762 | 7.5e-101 | |
| UNIPROTKB|F1P306 | 1168 | LOC100858239 "Uncharacterized | 0.431 | 0.206 | 0.762 | 1.6e-100 | |
| ZFIN|ZDB-GENE-050809-39 | 1210 | dhx8 "DEAH (Asp-Glu-Ala-His) b | 0.431 | 0.199 | 0.758 | 4.1e-100 | |
| RGD|1310723 | 1210 | Dhx8 "DEAH (Asp-Glu-Ala-His) b | 0.399 | 0.184 | 0.811 | 2e-100 |
| FB|FBgn0086895 pea "peanuts" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 1049 (374.3 bits), Expect = 1.0e-109, Sum P(2) = 1.0e-109
Identities = 201/243 (82%), Positives = 215/243 (88%)
Query: 11 QMAEFPLEPNLSKMLIMSVHLQCSDEVLTIVSMLSVQNVFYRPXXXXXXXXXXXXXFNQM 70
+MAEFPLEPNLSKMLIMSV LQCSDE+LTIVSMLSVQNVFYRP FNQ
Sbjct: 1000 RMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFNQA 1059
Query: 71 EGDHITLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGK 130
EGDH+TLLAVYNSW+NNKFSNAWCYENFVQIRTLKR+QDVRKQLLGIMDRHKLDVVSAGK
Sbjct: 1060 EGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRSQDVRKQLLGIMDRHKLDVVSAGK 1119
Query: 131 NTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTT 190
N+VR+QKA+CSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTT
Sbjct: 1120 NSVRIQKAICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTT 1179
Query: 191 KEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPLQRTNRISFPPGLLKQAV 250
KEYMREVT+IDPKWLVEFAP+FF+FSDPTKLSKFKKNQRLEPL N+ P V
Sbjct: 1180 KEYMREVTTIDPKWLVEFAPSFFRFSDPTKLSKFKKNQRLEPLY--NKYEEPNAWRISRV 1237
Query: 251 KKR 253
++R
Sbjct: 1238 RRR 1240
|
|
| UNIPROTKB|F1S1H3 DHX8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R9R9 DHX8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q14562 DHX8 "ATP-dependent RNA helicase DHX8" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MEM4 DHX8 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A805 Dhx8 "Protein Dhx8" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1306823 Dhx8 "DEAH (Asp-Glu-Ala-His) box polypeptide 8" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P306 LOC100858239 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050809-39 dhx8 "DEAH (Asp-Glu-Ala-His) box polypeptide 8" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1310723 Dhx8 "DEAH (Asp-Glu-Ala-His) box polypeptide 8" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 558 | |||
| COG1643 | 845 | COG1643, HrpA, HrpA-like helicases [DNA replicatio | 3e-40 | |
| pfam07717 | 109 | pfam07717, OB_NTP_bind, Oligonucleotide/oligosacch | 6e-36 | |
| pfam07717 | 109 | pfam07717, OB_NTP_bind, Oligonucleotide/oligosacch | 6e-36 | |
| pfam04408 | 91 | pfam04408, HA2, Helicase associated domain (HA2) | 2e-30 | |
| TIGR01967 | 1283 | TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H | 5e-29 | |
| COG1643 | 845 | COG1643, HrpA, HrpA-like helicases [DNA replicatio | 2e-28 | |
| smart00847 | 82 | smart00847, HA2, Helicase associated domain (HA2) | 8e-24 | |
| COG1643 | 845 | COG1643, HrpA, HrpA-like helicases [DNA replicatio | 2e-23 | |
| PRK11131 | 1294 | PRK11131, PRK11131, ATP-dependent RNA helicase Hrp | 2e-22 | |
| TIGR01967 | 1283 | TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H | 1e-19 | |
| PRK11131 | 1294 | PRK11131, PRK11131, ATP-dependent RNA helicase Hrp | 6e-17 | |
| PRK11664 | 812 | PRK11664, PRK11664, ATP-dependent RNA helicase Hrp | 5e-14 | |
| TIGR01970 | 819 | TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H | 2e-13 | |
| COG1643 | 845 | COG1643, HrpA, HrpA-like helicases [DNA replicatio | 2e-12 | |
| PRK11131 | 1294 | PRK11131, PRK11131, ATP-dependent RNA helicase Hrp | 6e-11 | |
| TIGR01967 | 1283 | TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H | 1e-09 | |
| TIGR01967 | 1283 | TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H | 2e-09 | |
| TIGR01970 | 819 | TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H | 2e-09 | |
| smart00490 | 82 | smart00490, HELICc, helicase superfamily c-termina | 4e-09 | |
| PRK11664 | 812 | PRK11664, PRK11664, ATP-dependent RNA helicase Hrp | 9e-08 | |
| PRK11131 | 1294 | PRK11131, PRK11131, ATP-dependent RNA helicase Hrp | 1e-06 | |
| pfam00271 | 78 | pfam00271, Helicase_C, Helicase conserved C-termin | 3e-05 |
| >gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Score = 155 bits (395), Expect = 3e-40
Identities = 71/313 (22%), Positives = 110/313 (35%), Gaps = 60/313 (19%)
Query: 7 TPIS-QMAEFPLEPNLSKMLIMSVHLQCSDEVLTIVSMLSVQNV---FYRP-KDKQALAD 61
TP+ QM+ PL+P L++ML+ + C E TI SMLS Q+ F R K ++
Sbjct: 455 TPLGKQMSLLPLDPRLARMLLTAPEGGCLGEAATIASMLSEQDRESDFSRDVKLRKQRTA 514
Query: 62 QKKAKFNQME------GDHITLLAVYNSWRNNK------FSNAWCYENFVQIRTLKRAQD 109
Q K + GDH+ LL + K C + L RA
Sbjct: 515 QDLLKRLKRRNAADPRGDHLLLLEAFPDRIARKRAKGEYLRANGCRAMLFPTKALSRAPW 574
Query: 110 VRKQLLGIMDRHKLDVVSAGK-------------------NTVRVQKAVCSGFFRNAAKK 150
+ LL +++A + ++ A+ +G N A+
Sbjct: 575 IIAALLVQTSALAGRILAAAEIDEDEWAAQHLPEHCYSEPIWDDIRGALAAGRKLNIAQL 634
Query: 151 DP-QEGYRTLVDSQVVYIHPSS-ALFNRQPEWVIYHELVQTTKEYMRE-----------V 197
Y TL D+ V+ HPSS L EW+ Y E ++T K Y+RE +
Sbjct: 635 QLDGRPYVTLSDNTPVFAHPSSVRLGLVLLEWIKYAEFLRTRKGYLREGRGERWPDVQTL 694
Query: 198 TSIDPKWLVEFAP---AFFKFSDPT------KLSKFKKNQRLEPLQRTNRISFPPGL-LK 247
+ WL E + L + Q L+ + P G ++
Sbjct: 695 IELLKLWLKEQVKGLRGLDGLTKAAMKQALPDLLPWDLTQLLDERA-PTELELPTGSQIR 753
Query: 248 QAVKKRPEIKLIV 260
+ P L V
Sbjct: 754 LRYSREPGPTLAV 766
|
Length = 845 |
| >gnl|CDD|219532 pfam07717, OB_NTP_bind, Oligonucleotide/oligosaccharide-binding (OB)-fold | Back alignment and domain information |
|---|
| >gnl|CDD|219532 pfam07717, OB_NTP_bind, Oligonucleotide/oligosaccharide-binding (OB)-fold | Back alignment and domain information |
|---|
| >gnl|CDD|218070 pfam04408, HA2, Helicase associated domain (HA2) | Back alignment and domain information |
|---|
| >gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|214852 smart00847, HA2, Helicase associated domain (HA2) Add an annotation | Back alignment and domain information |
|---|
| >gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 558 | |||
| KOG0922|consensus | 674 | 100.0 | ||
| KOG0923|consensus | 902 | 100.0 | ||
| KOG0924|consensus | 1042 | 100.0 | ||
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 100.0 | |
| KOG0926|consensus | 1172 | 100.0 | ||
| KOG0925|consensus | 699 | 100.0 | ||
| KOG0920|consensus | 924 | 100.0 | ||
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 100.0 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 100.0 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 100.0 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 100.0 | |
| KOG0924|consensus | 1042 | 100.0 | ||
| KOG0921|consensus | 1282 | 100.0 | ||
| KOG0922|consensus | 674 | 100.0 | ||
| KOG0925|consensus | 699 | 100.0 | ||
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 100.0 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 100.0 | |
| KOG0923|consensus | 902 | 100.0 | ||
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 99.97 | |
| KOG0926|consensus | 1172 | 99.89 | ||
| KOG0920|consensus | 924 | 99.89 | ||
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 99.68 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 99.62 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 99.57 | |
| PF04408 | 102 | HA2: Helicase associated domain (HA2); InterPro: I | 99.55 | |
| KOG0921|consensus | 1282 | 99.55 | ||
| PF07717 | 114 | OB_NTP_bind: Oligonucleotide/oligosaccharide-bindi | 99.47 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 99.44 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 99.43 | |
| smart00847 | 92 | HA2 Helicase associated domain (HA2) Add an annota | 99.42 | |
| PTZ00110 | 545 | helicase; Provisional | 99.27 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 99.27 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 99.25 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 99.22 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 99.19 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 99.12 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 99.12 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 99.11 | |
| PTZ00424 | 401 | helicase 45; Provisional | 99.1 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 99.07 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 99.05 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 99.03 | |
| KOG0331|consensus | 519 | 98.95 | ||
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 98.94 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 98.9 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 98.89 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 98.86 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 98.85 | |
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 98.84 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 98.84 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 98.82 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 98.82 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 98.8 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 98.75 | |
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 98.71 | |
| KOG0336|consensus | 629 | 98.64 | ||
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 98.62 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 98.53 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 98.5 | |
| KOG0330|consensus | 476 | 98.46 | ||
| KOG0333|consensus | 673 | 98.46 | ||
| KOG0339|consensus | 731 | 98.18 | ||
| PF07717 | 114 | OB_NTP_bind: Oligonucleotide/oligosaccharide-bindi | 98.12 | |
| KOG0332|consensus | 477 | 98.09 | ||
| PRK09401 | 1176 | reverse gyrase; Reviewed | 98.02 | |
| KOG0345|consensus | 567 | 97.97 | ||
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 97.96 | |
| KOG0335|consensus | 482 | 97.96 | ||
| KOG0340|consensus | 442 | 97.93 | ||
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 97.79 | |
| smart00490 | 82 | HELICc helicase superfamily c-terminal domain. | 97.78 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 97.73 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 97.67 | |
| KOG0328|consensus | 400 | 97.66 | ||
| PF00271 | 78 | Helicase_C: Helicase conserved C-terminal domain; | 97.65 | |
| KOG0338|consensus | 691 | 97.6 | ||
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 97.59 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 97.59 | |
| KOG0347|consensus | 731 | 97.49 | ||
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 97.43 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 97.41 | |
| KOG0326|consensus | 459 | 97.27 | ||
| KOG0342|consensus | 543 | 97.23 | ||
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 97.22 | |
| KOG0343|consensus | 758 | 97.15 | ||
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 97.08 | |
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 97.07 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 97.06 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 97.03 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 97.02 | |
| cd00079 | 131 | HELICc Helicase superfamily c-terminal domain; ass | 96.98 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 96.92 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 96.84 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 96.82 | |
| KOG0348|consensus | 708 | 96.76 | ||
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 96.72 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 96.68 | |
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 96.37 | |
| KOG0341|consensus | 610 | 96.34 | ||
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 96.3 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 96.28 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 96.02 | |
| TIGR02562 | 1110 | cas3_yersinia CRISPR-associated helicase Cas3. The | 95.46 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 95.46 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 94.48 | |
| KOG0346|consensus | 569 | 94.28 | ||
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 94.18 | |
| KOG0334|consensus | 997 | 94.15 | ||
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 94.07 | |
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 93.95 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 93.69 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 93.63 | |
| KOG0337|consensus | 529 | 93.23 | ||
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 92.16 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 91.91 | |
| KOG0951|consensus | 1674 | 91.78 | ||
| KOG4284|consensus | 980 | 91.31 | ||
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 91.05 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 90.92 | |
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 90.39 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 89.75 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 89.38 | |
| KOG0354|consensus | 746 | 88.48 | ||
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 87.44 | |
| KOG0947|consensus | 1248 | 86.05 | ||
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 85.45 | |
| KOG0349|consensus | 725 | 85.07 | ||
| KOG0344|consensus | 593 | 84.9 | ||
| KOG0327|consensus | 397 | 83.27 | ||
| KOG0352|consensus | 641 | 80.3 |
| >KOG0922|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.3e-76 Score=605.88 Aligned_cols=286 Identities=48% Similarity=0.692 Sum_probs=260.0
Q ss_pred HHHHHHHHHHHHHHHhHhcCccee----cCCCchHHHHHHHHcCCc----------ceeE----eeCCCCCceeeeCCeE
Q psy12726 103 TLKRAQDVRKQLLGIMDRHKLDVV----SAGKNTVRVQKAVCSGFF----------RNAA----KKDPQEGYRTLVDSQV 164 (558)
Q Consensus 103 ~l~~i~~~r~qL~~~l~~~~~~~~----gsgkst~i~~~lL~~g~~----------~~~A----~~r~~~~~~~~~~~~v 164 (558)
.-+||++.|+||+..++++++.++ ||||+||+||+|+.+||. |++| ++|++.++++..|+.|
T Consensus 48 ~~LPI~~~r~~il~~ve~nqvlIviGeTGsGKSTQipQyL~eaG~~~~g~I~~TQPRRVAavslA~RVAeE~~~~lG~~V 127 (674)
T KOG0922|consen 48 ESLPIYKYRDQILYAVEDNQVLIVIGETGSGKSTQIPQYLAEAGFASSGKIACTQPRRVAAVSLAKRVAEEMGCQLGEEV 127 (674)
T ss_pred ccCCHHHHHHHHHHHHHHCCEEEEEcCCCCCccccHhHHHHhcccccCCcEEeecCchHHHHHHHHHHHHHhCCCcCcee
Confidence 347999999999999999999877 999999999999999997 4444 6788999999999999
Q ss_pred EEEecCCCCCCCCCCEEEEEeeeeccccccccccccChHHHHHhcCcccccCCcccccccccceecccccccccCCCchh
Q psy12726 165 VYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPLQRTNRISFPPG 244 (558)
Q Consensus 165 ~~ihp~s~l~~~~~~~ii~~~l~~T~~~~lr~~~~i~~~wL~~~~~~~~~~~~~~~l~~~~~vi~De~her~~~~D~ll~ 244 (558)
||..|++.. +++.+.|. |+|+|.++|+ ...||. |++|++||+||+|||+++||+|||
T Consensus 128 GY~IRFed~--ts~~Trik---ymTDG~LLRE-~l~Dp~-----------------LskYsvIIlDEAHERsl~TDiLlG 184 (674)
T KOG0922|consen 128 GYTIRFEDS--TSKDTRIK---YMTDGMLLRE-ILKDPL-----------------LSKYSVIILDEAHERSLHTDILLG 184 (674)
T ss_pred eeEEEeccc--CCCceeEE---EecchHHHHH-HhcCCc-----------------cccccEEEEechhhhhhHHHHHHH
Confidence 999999999 88899999 9999999999 778999 999999999999999999999999
Q ss_pred hhHHHhhcCCCeeEEEEecccchHHHhhhcCCCCEEEecCCCCcceeeccCCCCcchHHHHHHHHHHHHhcCCCCCEEEE
Q psy12726 245 LLKQAVKKRPEIKLIVTSATLDAVKFSSYFFEAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDVLLF 324 (558)
Q Consensus 245 ~lk~~l~~r~~lKlIlMSATl~~~~F~~yF~~~pvi~Ipgr~fpV~~~yl~~~~~d~~~~~~~~~~~i~~~~~~g~iLvf 324 (558)
+||+++++|++|||||||||||+++|++||++||++.||||+|||+++|++.+..||+++++.++++||..+++||||||
T Consensus 185 lLKki~~~R~~LklIimSATlda~kfS~yF~~a~i~~i~GR~fPVei~y~~~p~~dYv~a~~~tv~~Ih~~E~~GDILvF 264 (674)
T KOG0922|consen 185 LLKKILKKRPDLKLIIMSATLDAEKFSEYFNNAPILTIPGRTFPVEILYLKEPTADYVDAALITVIQIHLTEPPGDILVF 264 (674)
T ss_pred HHHHHHhcCCCceEEEEeeeecHHHHHHHhcCCceEeecCCCCceeEEeccCCchhhHHHHHHHHHHHHccCCCCCEEEE
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ecChHHHHHHHHhhhhhcccceecCCCchHHHHHHhhhhhhhcccccCCCCCccccccccceecCCCcccccCCCcchhh
Q psy12726 325 LTGKLDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIY 404 (558)
Q Consensus 325 l~g~~ei~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 404 (558)
|||++||+..+
T Consensus 265 LtGqeEIe~~~--------------------------------------------------------------------- 275 (674)
T KOG0922|consen 265 LTGQEEIEAAC--------------------------------------------------------------------- 275 (674)
T ss_pred eCCHHHHHHHH---------------------------------------------------------------------
Confidence 99999886543
Q ss_pred hhhhhhHHHHHHHhhcCCchhhhhhccccccCCCcchhhhhhhhccccccccccCCCccccccchhhhhHHHHHHHhhhc
Q psy12726 405 HELVQTTKEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPLYNKYEEPNAWRISREEIDTACEILYERMKS 484 (558)
Q Consensus 405 ~~l~~~~~~~~~~~~~~~~~~~l~f~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ei~~~~~~l~~~~~~ 484 (558)
+.|.+..+.
T Consensus 276 -----------------------------------------------------------------------~~l~e~~~~ 284 (674)
T KOG0922|consen 276 -----------------------------------------------------------------------ELLRERAKS 284 (674)
T ss_pred -----------------------------------------------------------------------HHHHHHhhh
Confidence 333333333
Q ss_pred CCCCCCceEEEeccCCCChHHHHhhcccCCCCCeEEEEeeccccceeeeCCeEEEEcCChhhHHhhcccc
Q psy12726 485 LGPDVPELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIFYVVDPFDIEVRQAKYHR 554 (558)
Q Consensus 485 ~~~~~~~~~vlpLhs~l~~~~Q~~vf~~~~~g~rkVIlaTNIAETSiTIpdV~~VID~g~~~~~~~~~~~ 554 (558)
...+.+. .++||||+||+++|.+||.++|+|.|||||||||||||||||||+||||+|.. |+..|++
T Consensus 285 ~~~~~~~-~~lply~aL~~e~Q~rvF~p~p~g~RKvIlsTNIAETSlTI~GI~YVVDsG~v--K~~~y~p 351 (674)
T KOG0922|consen 285 LPEDCPE-LILPLYGALPSEEQSRVFDPAPPGKRKVILSTNIAETSLTIDGIRYVVDSGFV--KQKKYNP 351 (674)
T ss_pred ccccCcc-eeeeecccCCHHHhhccccCCCCCcceEEEEcceeeeeEEecceEEEEcCCce--EEEeecc
Confidence 3333344 89999999999999999999999999999999999999999999999999955 5555554
|
|
| >KOG0923|consensus | Back alignment and domain information |
|---|
| >KOG0924|consensus | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0926|consensus | Back alignment and domain information |
|---|
| >KOG0925|consensus | Back alignment and domain information |
|---|
| >KOG0920|consensus | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >KOG0924|consensus | Back alignment and domain information |
|---|
| >KOG0921|consensus | Back alignment and domain information |
|---|
| >KOG0922|consensus | Back alignment and domain information |
|---|
| >KOG0925|consensus | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >KOG0923|consensus | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >KOG0926|consensus | Back alignment and domain information |
|---|
| >KOG0920|consensus | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length | Back alignment and domain information |
|---|
| >KOG0921|consensus | Back alignment and domain information |
|---|
| >PF07717 OB_NTP_bind: Oligonucleotide/oligosaccharide-binding (OB)-fold; InterPro: IPR011709 This domain is found towards the C terminus of the DEAD-box helicases (IPR011545 from INTERPRO) | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >smart00847 HA2 Helicase associated domain (HA2) Add an annotation | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >KOG0331|consensus | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >KOG0336|consensus | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >KOG0330|consensus | Back alignment and domain information |
|---|
| >KOG0333|consensus | Back alignment and domain information |
|---|
| >KOG0339|consensus | Back alignment and domain information |
|---|
| >PF07717 OB_NTP_bind: Oligonucleotide/oligosaccharide-binding (OB)-fold; InterPro: IPR011709 This domain is found towards the C terminus of the DEAD-box helicases (IPR011545 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG0332|consensus | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >KOG0345|consensus | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0335|consensus | Back alignment and domain information |
|---|
| >KOG0340|consensus | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >smart00490 HELICc helicase superfamily c-terminal domain | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0328|consensus | Back alignment and domain information |
|---|
| >PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins | Back alignment and domain information |
|---|
| >KOG0338|consensus | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >KOG0326|consensus | Back alignment and domain information |
|---|
| >KOG0342|consensus | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >KOG0343|consensus | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >KOG0348|consensus | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0341|consensus | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0346|consensus | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >KOG0334|consensus | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0337|consensus | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >KOG4284|consensus | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >KOG0354|consensus | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0947|consensus | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >KOG0349|consensus | Back alignment and domain information |
|---|
| >KOG0344|consensus | Back alignment and domain information |
|---|
| >KOG0327|consensus | Back alignment and domain information |
|---|
| >KOG0352|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 558 | ||||
| 3i4u_A | 270 | Crystal Structure Analysis Of A Helicase Associated | 1e-100 | ||
| 3i4u_A | 270 | Crystal Structure Analysis Of A Helicase Associated | 3e-55 | ||
| 3kx2_B | 767 | Crystal Structure Of Prp43p In Complex With Adp Len | 4e-44 | ||
| 3kx2_B | 767 | Crystal Structure Of Prp43p In Complex With Adp Len | 1e-25 | ||
| 3kx2_B | 767 | Crystal Structure Of Prp43p In Complex With Adp Len | 3e-19 | ||
| 3kx2_B | 767 | Crystal Structure Of Prp43p In Complex With Adp Len | 3e-12 | ||
| 2xau_A | 773 | Crystal Structure Of The Prp43p Deah-Box Rna Helica | 4e-44 | ||
| 2xau_A | 773 | Crystal Structure Of The Prp43p Deah-Box Rna Helica | 1e-25 | ||
| 2xau_A | 773 | Crystal Structure Of The Prp43p Deah-Box Rna Helica | 3e-19 | ||
| 2xau_A | 773 | Crystal Structure Of The Prp43p Deah-Box Rna Helica | 3e-12 |
| >pdb|3I4U|A Chain A, Crystal Structure Analysis Of A Helicase Associated Domain Length = 270 | Back alignment and structure |
|
| >pdb|3I4U|A Chain A, Crystal Structure Analysis Of A Helicase Associated Domain Length = 270 | Back alignment and structure |
| >pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 | Back alignment and structure |
| >pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 | Back alignment and structure |
| >pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 | Back alignment and structure |
| >pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 | Back alignment and structure |
| >pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 | Back alignment and structure |
| >pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 | Back alignment and structure |
| >pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 | Back alignment and structure |
| >pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 558 | |||
| 3i4u_A | 270 | ATP-dependent RNA helicase DHX8; splicing, ATP-bin | 1e-137 | |
| 3i4u_A | 270 | ATP-dependent RNA helicase DHX8; splicing, ATP-bin | 3e-69 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 1e-115 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 7e-56 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 2e-45 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 8e-34 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 3e-16 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 1e-09 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 2e-15 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 3e-07 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 6e-05 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 5e-15 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 2e-06 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 2e-14 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 2e-06 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 2e-14 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 4e-08 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 4e-06 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 2e-14 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 7e-14 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 7e-06 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 1e-13 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 5e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-10 |
| >3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Length = 270 | Back alignment and structure |
|---|
Score = 398 bits (1025), Expect = e-137
Identities = 180/228 (78%), Positives = 200/228 (87%), Gaps = 1/228 (0%)
Query: 7 TPI-SQMAEFPLEPNLSKMLIMSVHLQCSDEVLTIVSMLSVQNVFYRPKDKQALADQKKA 65
T + +MAEFPLEP L KMLIMSVHL CS+E+LTIVSMLSVQNVFYRPKDKQALADQKKA
Sbjct: 40 TRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKA 99
Query: 66 KFNQMEGDHITLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDV 125
KF+Q EGDH+TLLAVYNSW+NNKFSN WCYENF+Q R+L+RAQD+RKQ+LGIMDRHKLDV
Sbjct: 100 KFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDV 159
Query: 126 VSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHE 185
VS GK+TVRVQKA+CSGFFRNAAKKDPQEGYRTL+D QVVYIHPSSALFNRQPEWV+YHE
Sbjct: 160 VSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHE 219
Query: 186 LVQTTKEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPL 233
LV TTKEYMREVT+IDP+WLVEFAPAFFK + + P
Sbjct: 220 LVLTTKEYMREVTTIDPRWLVEFAPAFFKVLEVDLQGDHGLSAWSHPQ 267
|
| >3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Length = 270 | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 558 | |||
| 3i4u_A | 270 | ATP-dependent RNA helicase DHX8; splicing, ATP-bin | 100.0 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 100.0 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 99.97 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 99.82 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 99.81 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 99.73 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 99.66 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 99.64 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 99.58 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 99.54 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 99.53 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 99.53 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 99.49 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 99.48 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 99.39 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 99.36 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 99.35 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 99.34 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 99.33 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 99.3 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 99.3 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 99.29 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 99.28 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 99.27 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 99.26 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 99.26 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 99.23 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 99.21 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 99.2 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 99.2 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 99.2 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 99.17 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 99.17 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.14 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 99.08 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 99.08 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 99.05 | |
| 3eaq_A | 212 | Heat resistant RNA dependent ATPase; DEAD box RNA | 98.99 | |
| 3i32_A | 300 | Heat resistant RNA dependent ATPase; RNA helicase, | 98.98 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 98.9 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 98.89 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 98.86 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 98.86 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 98.86 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 98.76 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 98.75 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 98.74 | |
| 3i4u_A | 270 | ATP-dependent RNA helicase DHX8; splicing, ATP-bin | 98.73 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 98.6 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 98.59 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 98.59 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 98.41 | |
| 1fuk_A | 165 | Eukaryotic initiation factor 4A; helicase, DEAD-bo | 98.31 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 98.24 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 98.18 | |
| 2rb4_A | 175 | ATP-dependent RNA helicase DDX25; rossmann fold, s | 98.14 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 98.14 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 98.12 | |
| 2p6n_A | 191 | ATP-dependent RNA helicase DDX41; DEAD, structural | 98.11 | |
| 2hjv_A | 163 | ATP-dependent RNA helicase DBPA; parallel alpha-be | 98.05 | |
| 1t5i_A | 172 | C_terminal domain of A probable ATP-dependent RNA | 98.02 | |
| 2jgn_A | 185 | DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp | 97.94 | |
| 2yjt_D | 170 | ATP-dependent RNA helicase SRMB, regulator of ribo | 96.97 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 97.65 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 97.62 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 97.38 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 97.33 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 97.17 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 96.93 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 96.83 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 96.62 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 96.61 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 96.43 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 96.39 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 96.34 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 96.32 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 96.2 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 96.06 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 96.01 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 95.93 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 95.92 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 95.88 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 95.66 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 95.27 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 95.24 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 94.53 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 94.26 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 93.3 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 92.91 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 92.18 | |
| 1z5z_A | 271 | Helicase of the SNF2/RAD54 family; hydrolase, reco | 87.77 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 86.51 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 80.03 |
| >3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.7e-42 Score=339.14 Aligned_cols=216 Identities=83% Similarity=1.310 Sum_probs=203.3
Q ss_pred CCCCCcc-cccccCccchhhHHHHHHhhccCChHHHHHHHhHhcCCCCccCChhHHHHHHHHHhhhcCCCCCHHHHHHHH
Q psy12726 3 SLVVTPI-SQMAEFPLEPNLSKMLIMSVHLQCSDEVLTIVSMLSVQNVFYRPKDKQALADQKKAKFNQMEGDHITLLAVY 81 (558)
Q Consensus 3 ~~~lT~l-~~ma~lPl~PrlakmLl~~~~~~c~~~~~~iaA~Ls~~~~f~~~~~~~~~~~~~~~~~~~~~sD~l~~l~~~ 81 (558)
+|+||++ ++|++||+|||+||||+.|..++|++++++|||+||+++||.+|.+++++++..|.+|....|||++++|+|
T Consensus 36 ~g~lT~lG~~ma~lPl~P~lakmLl~a~~~~c~~~~l~iaA~Ls~~~~f~~p~~~~~~a~~~~~~f~~~~sD~ltlLn~~ 115 (270)
T 3i4u_A 36 EGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVY 115 (270)
T ss_dssp TSCBCHHHHHHTTSCSCHHHHHHHHHHHHTTCHHHHHHHHHHHTSSCCBCCCGGGHHHHHHHHHTTCBTTBHHHHHHHHH
T ss_pred CCCccHHHHHHHhCCCCHHHHHHHHHhhhcCCHHHHHHHHHHHCCCccccCCchhHHHHHHHHHHccCCCChHHHHHHHH
Confidence 4899999 899999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHhcCCchHHHHHccCCHHHHHHHHHHHHHHHHHhHhcCcceecCCCchHHHHHHHHcCCcceeEeeCCCCCceeeeC
Q psy12726 82 NSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVD 161 (558)
Q Consensus 82 ~~~~~~~~~~~~c~~~~L~~~~l~~i~~~r~qL~~~l~~~~~~~~gsgkst~i~~~lL~~g~~~~~A~~r~~~~~~~~~~ 161 (558)
++|.+.+..++||++|||+.++|+++.++|+||.+++++.++....++.+...++.+|++||++|+|.++..+.|.+..+
T Consensus 116 ~~~~~~~~~~~wC~~~fL~~~~l~~~~~ir~QL~~~l~~~~~~~~s~~~~~~~i~~~L~aG~~~nvA~~~~~~~Y~~~~~ 195 (270)
T 3i4u_A 116 NSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLID 195 (270)
T ss_dssp HHHHHTTTCHHHHHHTTBCHHHHHHHHHHHHHHHHHHHHTTCCCCCCTTCTHHHHHHHHHHHGGGEEEECSSSSEEETTT
T ss_pred HHHHHcCchhhHHHHhcCCHHHHHHHHHHHHHHHHHHHHcCCCcCCCcchHHHHHHHHHHHhHHHHheeCCCCceEEccC
Confidence 99998888889999999999999999999999999999988876677778888999999999999998887778988899
Q ss_pred CeEEEEecCCCCCCCCCCEEEEEeeeeccccccccccccChHHHHHhcCcccccCCc
Q psy12726 162 SQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTSIDPKWLVEFAPAFFKFSDP 218 (558)
Q Consensus 162 ~~v~~ihp~s~l~~~~~~~ii~~~l~~T~~~~lr~~~~i~~~wL~~~~~~~~~~~~~ 218 (558)
+..+++||+|++++..|+|+||+|++.|++.|+|.++.|+|+||.+++|+++...+-
T Consensus 196 ~~~v~iHPsS~L~~~~p~wvvy~Elv~Tsk~y~r~vt~I~p~wL~~~ap~~~~~~~~ 252 (270)
T 3i4u_A 196 QQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVLEV 252 (270)
T ss_dssp CCEEEECTTSTTTTSCCSEEEEEEEEESSSEEEEEEEECCHHHHHHHCTTTEECC--
T ss_pred CCEEEECchhhhcCCCCCEEEEEehhhhhHhHHHhccccCHHHHHHHhHHHhccccc
Confidence 999999999999888899999999999999999999999999999999999876653
|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A | Back alignment and structure |
|---|
| >3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 558 | ||||
| d1yksa2 | 299 | c.37.1.14 (A:325-623) YFV helicase domain {Yellow | 7e-14 | |
| d1yksa2 | 299 | c.37.1.14 (A:325-623) YFV helicase domain {Yellow | 3e-07 |
| >d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RNA helicase domain: YFV helicase domain species: Yellow fever virus [TaxId: 11089]
Score = 70.0 bits (171), Expect = 7e-14
Identities = 13/98 (13%), Positives = 28/98 (28%), Gaps = 18/98 (18%)
Query: 11 QMAEFPLEPNLSKMLIMSVHLQCSDEVLTIVSMLS-VQNVFYRPKDKQALAD-QKKAKFN 68
+ + P+ S +V + + F P++ + L D + K
Sbjct: 218 RNCDLPVW--------------LSWQVAKAGLKTNDRKWCFEGPEEHEILNDSGETVKCR 263
Query: 69 QMEGDHITLLAVYNSWRNNKFSNAWCYENFVQIRTLKR 106
G L + S+ F++ +R
Sbjct: 264 APGGAKKPLRPRW--CDERVSSDQSALSEFIKFAEGRR 299
|
| >d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 558 | |||
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 99.29 | |
| d1yksa2 | 299 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 99.25 | |
| d1t5ia_ | 168 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 98.05 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 97.96 | |
| d2rb4a1 | 168 | ATP-dependent RNA helicase DDX25 {Human (Homo sapi | 97.96 | |
| d1t5la2 | 181 | Nucleotide excision repair enzyme UvrB {Bacillus c | 97.9 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 97.89 | |
| d1fuka_ | 162 | Initiation factor 4a {Baker's yeast (Saccharomyces | 97.89 | |
| d1oywa3 | 200 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 97.86 | |
| d1hv8a2 | 155 | Putative DEAD box RNA helicase {Archaeon Methanoco | 97.83 | |
| d1s2ma2 | 171 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 97.81 | |
| d2j0sa2 | 168 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 97.78 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 97.56 | |
| d1gm5a4 | 206 | RecG helicase domain {Thermotoga maritima [TaxId: | 97.43 | |
| d1jr6a_ | 138 | HCV helicase domain {Human hepatitis C virus (HCV) | 97.39 | |
| d2eyqa5 | 211 | Transcription-repair coupling factor, TRCF {Escher | 97.38 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 97.26 | |
| d1wp9a2 | 286 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 96.86 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 95.43 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 94.5 | |
| d1gkub2 | 248 | Helicase-like "domain" of reverse gyrase {Archaeon | 94.22 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 92.73 | |
| d1a1va2 | 299 | HCV helicase domain {Human hepatitis C virus (HCV) | 92.45 | |
| d2p6ra4 | 201 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 92.45 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 92.34 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 92.24 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 92.22 | |
| d2fwra1 | 200 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 91.83 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 91.75 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 90.96 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 89.97 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 89.63 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 86.12 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 80.85 |
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RNA helicase domain: Dengue virus helicase species: Dengue virus type 2 [TaxId: 11060]
Probab=99.29 E-value=1.3e-13 Score=135.69 Aligned_cols=96 Identities=14% Similarity=0.036 Sum_probs=59.9
Q ss_pred ccccccceecccccccccCCCchhhhHHHhhcCCCeeEEEEecccchHHHhhhcCCCCEEEecCCCCcceeeccCCCCcc
Q psy12726 221 LSKFKKNQRLEPLQRTNRISFPPGLLKQAVKKRPEIKLIVTSATLDAVKFSSYFFEAPIFTIPGRTFPVEVLYTKEPETD 300 (558)
Q Consensus 221 l~~~~~vi~De~her~~~~D~ll~~lk~~l~~r~~lKlIlMSATl~~~~F~~yF~~~pvi~Ipgr~fpV~~~yl~~~~~d 300 (558)
+.+++.+++||+|.-.-..+.+.++++.+. .++++++++||||.......-....+|+...+.. .|.... ..
T Consensus 98 ~~~~~~vViDE~H~~~~~~~~~~~~l~~~~-~~~~~~~v~~SAT~~~~~~~~~~~~~~~~~~~~~-~~~~~~------~~ 169 (305)
T d2bmfa2 98 VPNYNLIIMDEAHFTDPASIAARGYISTRV-EMGEAAGIFMTATPPGSRDPFPQSNAPIMDEERE-IPERSW------NS 169 (305)
T ss_dssp CCCCSEEEEESTTCCSHHHHHHHHHHHHHH-HHTSCEEEEECSSCTTCCCSSCCCSSCEEEEECC-CCCSCC------SS
T ss_pred ccceeEEEeeeeeecchhhHHHHHHHHHhh-ccccceEEEeecCCCcceeeecccCCcceEEEEe-ccHHHH------HH
Confidence 678899999999988777777777777654 5678999999999965433222223444333211 111110 11
Q ss_pred hHHHHHHHHHHHHhcCCCCCEEEEecChHHHHH
Q psy12726 301 YLDASLITVMQIHLREPPGDVLLFLTGKLDVRK 333 (558)
Q Consensus 301 ~~~~~~~~~~~i~~~~~~g~iLvfl~g~~ei~~ 333 (558)
.. .......+.+|+|++..+++++
T Consensus 170 ~~---------~~~~~~~~~~lvf~~~~~~~~~ 193 (305)
T d2bmfa2 170 GH---------EWVTDFKGKTVWFVPSIKAGND 193 (305)
T ss_dssp CC---------HHHHSSCSCEEEECSCHHHHHH
T ss_pred HH---------HHHHhhCCCEEEEeccHHHHHH
Confidence 11 1123456889999998887754
|
| >d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|