Psyllid ID: psy12726

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------56
MDSLVVTPISQMAEFPLEPNLSKMLIMSVHLQCSDEVLTIVSMLSVQNVFYRPKDKQALADQKKAKFNQMEGDHITLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPLQRTNRISFPPGLLKQAVKKRPEIKLIVTSATLDAVKFSSYFFEAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDVLLFLTGKLDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPLYNKYEEPNAWRISREEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIFYVVDPFDIEVRQAKYHRCAVV
cccccccccccccccccccccHHHHHHccccccHHHHHHHHHHHccccEEEccccHHHHHHHHHcccccccccHHHHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHHcccccccEEEcccccEEEEEcccccccccccEEEEEHHHHccHHHHcccccccccHHHHHccccccccccccHHHHHHccccccccccccccccccHHHHHHHHcccccEEEEEEcccHHHHHcccccccEEEcccccccEEEEEcccccHHHHHHHHHHHHHHHHccccccHHHHcccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccccccEEEcccccEEEEEcccccccccccEEEEEHHHHccHHHHcccccccHHHHHHHccccccccccccHHHHHHccccccccccccccHHHHHcHHHHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHccccccccccEEEEEEcccccEEEEccEEEEEcccccccccccccccccc
ccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHcccccEEccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcccccHHHHHHHHHHHHHHHHHHccccccEEEEEcccEEEEcccHHHccccccEEEEEEEEEEcHHHHHHHccccHHHHHHHHHHHHHHcccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHccEEEEEEEEEcHHHHHHHHccccEEEcccccccEEEEEccccHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHccccEEEccccHHHHHHHHHHHHHHHHHHcccccccEEEEcccEEEEcccHHHccccccEEEEEEEEEcHHHHHHHHccccHHHHHHHcHHHcccccccHHHHHHHHHHHcccccccccHHHHHccHHHHHHHHHHHHHHHHHHccccccEEEEEEHccccHHHHHHHcccccccccEEEEEEEEEEEEEEEccEEEEEcccccEEccccccccEEc
mdslvvtpisqmaefplepnlsKMLIMSVHLQCSDEVLTIVSMLSVqnvfyrpkdkqALADQKKAKFNQMEGDHITLLAVYNSwrnnkfsnaWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAVCSGFfrnaakkdpqegyrtlVDSQVVyihpssalfnrqpeWVIYHELVQTTKEYMREVTsidpkwlvefapaffkfsdptklskfkknqrleplqrtnrisfppgllkqavkkrpeikLIVTSATldavkfssyffeapiftipgrtfpvevlytkepetdyldASLITVMQIhlreppgdvLLFLTGKLDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAVCSGFfrnaakkdpqegyrtlVDSQVVyihpssalfnrqpeWVIYHELVQTTKEYMREVTsidpkwlvefapaffkfsdptklskfkknqrleplynkyeepnawrisREEIDTACEILYERMKslgpdvpeliilpvysalpsemqtrifeaappgsrkvVIATNiaetsltidgifyvvdpfdiEVRQAkyhrcavv
mdslvvtpisqmaefplePNLSKMLIMSVHLQCSDEVLTIVSMLSVQNVFYRPKDKQALADQKKAKFNQMEGDHITLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLgimdrhkldvvsagkntvRVQKAVCSGffrnaakkdpqegYRTLVDSQVVYIHPssalfnrqpeWVIYHELVQTTKEYMREVTSIDPKWLVEFAPAFfkfsdptklskfkknqrleplqrtnrisfppgllkqavkkrpeiKLIVTSATLDAVKFSSYFFEAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDVLLFLTGKLDVRKQLLGImdrhkldvvsagkntvRVQKAVCSGffrnaakkdpqegYRTLVDSQVVYIHPssalfnrqpeWVIYHELVQTTKEYMREVTSIDPKWLVEFAPAFfkfsdptklskfkknqrleplynkyeepnawrisrEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFeaappgsrkVVIATNIAetsltidgifyvVDPFDIEVRQAkyhrcavv
MDSLVVTPISQMAEFPLEPNLSKMLIMSVHLQCSDEVLTIVSMLSVQNVFYRPkdkqaladqkkakFNQMEGDHITLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPLQRTNRISFPPGLLKQAVKKRPEIKLIVTSATLDAVKFSSYFFEAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDVLLFLTGKLDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPLYNKYEEPNAWRISREEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIFYVVDPFDIEVRQAKYHRCAVV
**************FPLEPNLSKMLIMSVHLQCSDEVLTIVSMLSVQNVFYRPK************FNQMEGDHITLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTSIDPKWLVEFAPAFFKFSD***********************FPPGLLKQAVKKRPEIKLIVTSATLDAVKFSSYFFEAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDVLLFLTGKLDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPLYNKYEEPNAWRISREEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIFYVVDPFDIEVRQAKYHRCA**
*DSLVVTPISQMAEFPLEPNLSKMLIMSVHLQCSDEVLTIVSMLSVQNVFYR*KD***********FNQMEGDHITLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTSIDPKWLVEFAPAFFKFSD***********************FPPGLLKQAVKKRPEIKLIVTSATLDAVKFSSYFFEAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDVLLFLTGKLDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTSIDPKWLVEFAPAFF***************************************ACE************V*ELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIFYVVDPFDIEVRQAKYHRCAV*
MDSLVVTPISQMAEFPLEPNLSKMLIMSVHLQCSDEVLTIVSMLSVQNVFYRPKDKQALADQKKAKFNQMEGDHITLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPLQRTNRISFPPGLLKQAVKKRPEIKLIVTSATLDAVKFSSYFFEAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDVLLFLTGKLDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPLYNKYEEPNAWRISREEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIFYVVDPFDIEVRQAKYHRCAVV
****VVTPISQMAEFPLEPNLSKMLIMSVHLQCSDEVLTIVSMLSVQNVFYRPKDKQALADQKKAKFNQMEGDHITLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPLQRTNRISFPPGLLKQAVKKRPEIKLIVTSATLDAVKFSSYFFEAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDVLLFLTGKLDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPLYNKYEEPNAWRISREEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIFYVVDPFDIEVRQAKYHRCAVV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSLVVTPISQMAEFPLEPNLSKMLIMSVHLQCSDEVLTIVSMLSVQNVFYRPKDKQALADQKKAKFNQMEGDHITLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPLQRTNRISFPPGLLKQAVKKRPEIKLIVTSATLDAVKFSSYFFEAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDVLLFLTGKLDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPLYNKYEEPNAWRISREEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIFYVVDPFDIEVRQAKYHRCAVV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query558 2.2.26 [Sep-21-2011]
A2A4P01244 ATP-dependent RNA helicas yes N/A 0.399 0.179 0.869 1e-117
Q145621220 ATP-dependent RNA helicas yes N/A 0.399 0.182 0.869 1e-117
Q095301200 Probable pre-mRNA-splicin yes N/A 0.415 0.193 0.741 1e-106
Q54F051160 ATP-dependent RNA helicas yes N/A 0.396 0.190 0.744 1e-101
Q389531168 Probable pre-mRNA-splicin yes N/A 0.392 0.187 0.695 2e-94
O426431168 Pre-mRNA-splicing factor yes N/A 0.415 0.198 0.521 5e-73
P243841145 Pre-mRNA-splicing factor yes N/A 0.397 0.193 0.486 5e-59
O602311041 Putative pre-mRNA-splicin no N/A 0.381 0.204 0.467 6e-57
Q7YR391044 Putative pre-mRNA-splicin no N/A 0.381 0.204 0.467 7e-57
Q767K61045 Putative pre-mRNA-splicin no N/A 0.381 0.203 0.467 7e-57
>sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 Back     alignment and function desciption
 Score =  424 bits (1089), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 194/223 (86%), Positives = 211/223 (94%)

Query: 11   QMAEFPLEPNLSKMLIMSVHLQCSDEVLTIVSMLSVQNVFYRPKDKQALADQKKAKFNQM 70
            +MAEFPLEP L KMLIMSVHL CS+E+LTIVSMLSVQNVFYRPKDKQALADQKKAKF+Q 
Sbjct: 1003 RMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQT 1062

Query: 71   EGDHITLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGK 130
            EGDH+TLLAVYNSW+NNKFSN WCYENF+Q R+L+RAQD+RKQ+LGIMDRHKLDVVS GK
Sbjct: 1063 EGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGK 1122

Query: 131  NTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTT 190
            +TVRVQKA+CSGFFRNAAKKDPQEGYRTL+D QVVYIHPSSALFNRQPEWV+YHELV TT
Sbjct: 1123 STVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTT 1182

Query: 191  KEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPL 233
            KEYMREVT+IDP+WLVEFAPAFFK SDPTKLSK KK QRLEPL
Sbjct: 1183 KEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPL 1225
Facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 Back     alignment and function description
>sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 Back     alignment and function description
>sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 Back     alignment and function description
>sp|Q38953|DHX8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 Back     alignment and function description
>sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 Back     alignment and function description
>sp|P24384|PRP22_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP22 PE=1 SV=1 Back     alignment and function description
>sp|O60231|DHX16_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens GN=DHX16 PE=1 SV=2 Back     alignment and function description
>sp|Q7YR39|DHX16_PANTR Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Pan troglodytes GN=DHX16 PE=3 SV=1 Back     alignment and function description
>sp|Q767K6|DHX16_PIG Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Sus scrofa GN=DHX16 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query558
350402222 1197 PREDICTED: ATP-dependent RNA helicase DH 0.399 0.186 0.973 1e-128
340727152 1197 PREDICTED: ATP-dependent RNA helicase DH 0.399 0.186 0.973 1e-128
66558592 1192 PREDICTED: ATP-dependent RNA helicase DH 0.399 0.187 0.973 1e-128
380027917 1192 PREDICTED: LOW QUALITY PROTEIN: ATP-depe 0.399 0.187 0.973 1e-128
383854100 1200 PREDICTED: ATP-dependent RNA helicase DH 0.399 0.185 0.973 1e-128
345489444 1216 PREDICTED: ATP-dependent RNA helicase DH 0.399 0.183 0.968 1e-128
345489442 1203 PREDICTED: ATP-dependent RNA helicase DH 0.399 0.185 0.968 1e-128
242012890 1236 pre-mRNA-splicing factor ATP-dependent R 0.399 0.180 0.968 1e-127
307198400 1232 ATP-dependent RNA helicase DHX8 [Harpegn 0.399 0.181 0.964 1e-127
307169908 1204 ATP-dependent RNA helicase DHX8 [Campono 0.399 0.185 0.964 1e-127
>gi|350402222|ref|XP_003486410.1| PREDICTED: ATP-dependent RNA helicase DHX8-like [Bombus impatiens] Back     alignment and taxonomy information
 Score =  464 bits (1195), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 217/223 (97%), Positives = 222/223 (99%)

Query: 11   QMAEFPLEPNLSKMLIMSVHLQCSDEVLTIVSMLSVQNVFYRPKDKQALADQKKAKFNQM 70
            +MAEFPLEPNLSKMLIMSVHLQCSDE+LTIVSMLSVQNVFYRPKDKQALADQKKAKFNQ 
Sbjct: 955  RMAEFPLEPNLSKMLIMSVHLQCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFNQP 1014

Query: 71   EGDHITLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGK 130
            EGDH+TLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGK
Sbjct: 1015 EGDHLTLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGK 1074

Query: 131  NTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTT 190
            NTVR+QKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTT
Sbjct: 1075 NTVRIQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTT 1134

Query: 191  KEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPL 233
            KEYMREVT+IDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPL
Sbjct: 1135 KEYMREVTTIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPL 1177

Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340727152|ref|XP_003401914.1| PREDICTED: ATP-dependent RNA helicase DHX8-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|66558592|ref|XP_623289.1| PREDICTED: ATP-dependent RNA helicase DHX8-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380027917|ref|XP_003697661.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent RNA helicase DHX8-like [Apis florea] Back     alignment and taxonomy information
>gi|383854100|ref|XP_003702560.1| PREDICTED: ATP-dependent RNA helicase DHX8 [Megachile rotundata] Back     alignment and taxonomy information
>gi|345489444|ref|XP_001606022.2| PREDICTED: ATP-dependent RNA helicase DHX8-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345489442|ref|XP_003426140.1| PREDICTED: ATP-dependent RNA helicase DHX8-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242012890|ref|XP_002427158.1| pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22, putative [Pediculus humanus corporis] gi|212511441|gb|EEB14420.1| pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307198400|gb|EFN79342.1| ATP-dependent RNA helicase DHX8 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307169908|gb|EFN62417.1| ATP-dependent RNA helicase DHX8 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query558
FB|FBgn00868951242 pea "peanuts" [Drosophila mela 0.431 0.194 0.827 1e-109
UNIPROTKB|F1S1H31212 DHX8 "Uncharacterized protein" 0.431 0.198 0.762 7.5e-101
UNIPROTKB|E2R9R91216 DHX8 "Uncharacterized protein" 0.431 0.198 0.762 7.5e-101
UNIPROTKB|Q145621220 DHX8 "ATP-dependent RNA helica 0.431 0.197 0.762 7.5e-101
UNIPROTKB|F1MEM41230 DHX8 "Uncharacterized protein" 0.431 0.195 0.762 7.5e-101
UNIPROTKB|D4A8051242 Dhx8 "Protein Dhx8" [Rattus no 0.431 0.194 0.762 7.5e-101
MGI|MGI:13068231244 Dhx8 "DEAH (Asp-Glu-Ala-His) b 0.431 0.193 0.762 7.5e-101
UNIPROTKB|F1P3061168 LOC100858239 "Uncharacterized 0.431 0.206 0.762 1.6e-100
ZFIN|ZDB-GENE-050809-391210 dhx8 "DEAH (Asp-Glu-Ala-His) b 0.431 0.199 0.758 4.1e-100
RGD|13107231210 Dhx8 "DEAH (Asp-Glu-Ala-His) b 0.399 0.184 0.811 2e-100
FB|FBgn0086895 pea "peanuts" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1049 (374.3 bits), Expect = 1.0e-109, Sum P(2) = 1.0e-109
 Identities = 201/243 (82%), Positives = 215/243 (88%)

Query:    11 QMAEFPLEPNLSKMLIMSVHLQCSDEVLTIVSMLSVQNVFYRPXXXXXXXXXXXXXFNQM 70
             +MAEFPLEPNLSKMLIMSV LQCSDE+LTIVSMLSVQNVFYRP             FNQ 
Sbjct:  1000 RMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKFNQA 1059

Query:    71 EGDHITLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGK 130
             EGDH+TLLAVYNSW+NNKFSNAWCYENFVQIRTLKR+QDVRKQLLGIMDRHKLDVVSAGK
Sbjct:  1060 EGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRSQDVRKQLLGIMDRHKLDVVSAGK 1119

Query:   131 NTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTT 190
             N+VR+QKA+CSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTT
Sbjct:  1120 NSVRIQKAICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTT 1179

Query:   191 KEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPLQRTNRISFPPGLLKQAV 250
             KEYMREVT+IDPKWLVEFAP+FF+FSDPTKLSKFKKNQRLEPL   N+   P       V
Sbjct:  1180 KEYMREVTTIDPKWLVEFAPSFFRFSDPTKLSKFKKNQRLEPLY--NKYEEPNAWRISRV 1237

Query:   251 KKR 253
             ++R
Sbjct:  1238 RRR 1240
GO:0007286 "spermatid development" evidence=IMP
GO:0005681 "spliceosomal complex" evidence=ISS
GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC;ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=IC
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=IMP
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|F1S1H3 DHX8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9R9 DHX8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q14562 DHX8 "ATP-dependent RNA helicase DHX8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MEM4 DHX8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|D4A805 Dhx8 "Protein Dhx8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1306823 Dhx8 "DEAH (Asp-Glu-Ala-His) box polypeptide 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1P306 LOC100858239 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050809-39 dhx8 "DEAH (Asp-Glu-Ala-His) box polypeptide 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1310723 Dhx8 "DEAH (Asp-Glu-Ala-His) box polypeptide 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q09530MOG5_CAEEL3, ., 6, ., 4, ., 1, 30.74130.41570.1933yesN/A
O42643PRP22_SCHPO3, ., 6, ., 4, ., 1, 30.52130.41570.1986yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query558
COG1643845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 3e-40
pfam07717109 pfam07717, OB_NTP_bind, Oligonucleotide/oligosacch 6e-36
pfam07717109 pfam07717, OB_NTP_bind, Oligonucleotide/oligosacch 6e-36
pfam0440891 pfam04408, HA2, Helicase associated domain (HA2) 2e-30
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 5e-29
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 2e-28
smart0084782 smart00847, HA2, Helicase associated domain (HA2) 8e-24
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 2e-23
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 2e-22
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 1e-19
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 6e-17
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 5e-14
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 2e-13
COG1643845 COG1643, HrpA, HrpA-like helicases [DNA replicatio 2e-12
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 6e-11
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 1e-09
TIGR01967 1283 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H 2e-09
TIGR01970 819 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H 2e-09
smart0049082 smart00490, HELICc, helicase superfamily c-termina 4e-09
PRK11664 812 PRK11664, PRK11664, ATP-dependent RNA helicase Hrp 9e-08
PRK11131 1294 PRK11131, PRK11131, ATP-dependent RNA helicase Hrp 1e-06
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 3e-05
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  155 bits (395), Expect = 3e-40
 Identities = 71/313 (22%), Positives = 110/313 (35%), Gaps = 60/313 (19%)

Query: 7   TPIS-QMAEFPLEPNLSKMLIMSVHLQCSDEVLTIVSMLSVQNV---FYRP-KDKQALAD 61
           TP+  QM+  PL+P L++ML+ +    C  E  TI SMLS Q+    F R  K ++    
Sbjct: 455 TPLGKQMSLLPLDPRLARMLLTAPEGGCLGEAATIASMLSEQDRESDFSRDVKLRKQRTA 514

Query: 62  QKKAKFNQME------GDHITLLAVYNSWRNNK------FSNAWCYENFVQIRTLKRAQD 109
           Q   K  +        GDH+ LL  +      K           C       + L RA  
Sbjct: 515 QDLLKRLKRRNAADPRGDHLLLLEAFPDRIARKRAKGEYLRANGCRAMLFPTKALSRAPW 574

Query: 110 VRKQLLGIMDRHKLDVVSAGK-------------------NTVRVQKAVCSGFFRNAAKK 150
           +   LL         +++A +                       ++ A+ +G   N A+ 
Sbjct: 575 IIAALLVQTSALAGRILAAAEIDEDEWAAQHLPEHCYSEPIWDDIRGALAAGRKLNIAQL 634

Query: 151 DP-QEGYRTLVDSQVVYIHPSS-ALFNRQPEWVIYHELVQTTKEYMRE-----------V 197
                 Y TL D+  V+ HPSS  L     EW+ Y E ++T K Y+RE           +
Sbjct: 635 QLDGRPYVTLSDNTPVFAHPSSVRLGLVLLEWIKYAEFLRTRKGYLREGRGERWPDVQTL 694

Query: 198 TSIDPKWLVEFAP---AFFKFSDPT------KLSKFKKNQRLEPLQRTNRISFPPGL-LK 247
             +   WL E           +          L  +   Q L+       +  P G  ++
Sbjct: 695 IELLKLWLKEQVKGLRGLDGLTKAAMKQALPDLLPWDLTQLLDERA-PTELELPTGSQIR 753

Query: 248 QAVKKRPEIKLIV 260
               + P   L V
Sbjct: 754 LRYSREPGPTLAV 766

Length = 845
>gnl|CDD|219532 pfam07717, OB_NTP_bind, Oligonucleotide/oligosaccharide-binding (OB)-fold Back     alignment and domain information
>gnl|CDD|219532 pfam07717, OB_NTP_bind, Oligonucleotide/oligosaccharide-binding (OB)-fold Back     alignment and domain information
>gnl|CDD|218070 pfam04408, HA2, Helicase associated domain (HA2) Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|214852 smart00847, HA2, Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA Back     alignment and domain information
>gnl|CDD|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>gnl|CDD|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 558
KOG0922|consensus 674 100.0
KOG0923|consensus 902 100.0
KOG0924|consensus 1042 100.0
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
KOG0926|consensus 1172 100.0
KOG0925|consensus 699 100.0
KOG0920|consensus 924 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
KOG0924|consensus1042 100.0
KOG0921|consensus 1282 100.0
KOG0922|consensus674 100.0
KOG0925|consensus699 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
KOG0923|consensus902 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.97
KOG0926|consensus1172 99.89
KOG0920|consensus924 99.89
COG1643845 HrpA HrpA-like helicases [DNA replication, recombi 99.68
TIGR01970819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.62
PRK11664812 ATP-dependent RNA helicase HrpB; Provisional 99.57
PF04408102 HA2: Helicase associated domain (HA2); InterPro: I 99.55
KOG0921|consensus 1282 99.55
PF07717114 OB_NTP_bind: Oligonucleotide/oligosaccharide-bindi 99.47
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.44
PRK01172 674 ski2-like helicase; Provisional 99.43
smart0084792 HA2 Helicase associated domain (HA2) Add an annota 99.42
PTZ00110545 helicase; Provisional 99.27
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.27
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.25
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.22
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.19
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.12
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.12
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.11
PTZ00424401 helicase 45; Provisional 99.1
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.07
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.05
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.03
KOG0331|consensus519 98.95
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 98.94
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 98.9
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 98.89
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 98.86
PRK00254 720 ski2-like helicase; Provisional 98.85
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 98.84
PRK10689 1147 transcription-repair coupling factor; Provisional 98.84
TIGR00643630 recG ATP-dependent DNA helicase RecG. 98.82
PRK02362 737 ski2-like helicase; Provisional 98.82
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 98.8
PRK13767 876 ATP-dependent helicase; Provisional 98.75
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 98.71
KOG0336|consensus629 98.64
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 98.62
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 98.53
PRK09694 878 helicase Cas3; Provisional 98.5
KOG0330|consensus476 98.46
KOG0333|consensus673 98.46
KOG0339|consensus 731 98.18
PF07717114 OB_NTP_bind: Oligonucleotide/oligosaccharide-bindi 98.12
KOG0332|consensus477 98.09
PRK09401 1176 reverse gyrase; Reviewed 98.02
KOG0345|consensus 567 97.97
COG4098441 comFA Superfamily II DNA/RNA helicase required for 97.96
KOG0335|consensus482 97.96
KOG0340|consensus442 97.93
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 97.79
smart0049082 HELICc helicase superfamily c-terminal domain. 97.78
TIGR00595 505 priA primosomal protein N'. All proteins in this f 97.73
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 97.67
KOG0328|consensus400 97.66
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 97.65
KOG0338|consensus 691 97.6
PHA02558501 uvsW UvsW helicase; Provisional 97.59
PRK14701 1638 reverse gyrase; Provisional 97.59
KOG0347|consensus 731 97.49
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 97.43
PRK13766 773 Hef nuclease; Provisional 97.41
KOG0326|consensus459 97.27
KOG0342|consensus 543 97.23
PRK05580 679 primosome assembly protein PriA; Validated 97.22
KOG0343|consensus 758 97.15
COG1201 814 Lhr Lhr-like helicases [General function predictio 97.08
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 97.07
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 97.06
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 97.03
PRK09200 790 preprotein translocase subunit SecA; Reviewed 97.02
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 96.98
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 96.92
COG1202 830 Superfamily II helicase, archaea-specific [General 96.84
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 96.82
KOG0348|consensus 708 96.76
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 96.72
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 96.68
COG1205 851 Distinct helicase family with a unique C-terminal 96.37
KOG0341|consensus610 96.34
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 96.3
COG1204 766 Superfamily II helicase [General function predicti 96.28
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 96.02
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 95.46
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 95.46
PRK13107 908 preprotein translocase subunit SecA; Reviewed 94.48
KOG0346|consensus569 94.28
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 94.18
KOG0334|consensus 997 94.15
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 94.07
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 93.95
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 93.69
PRK12904 830 preprotein translocase subunit SecA; Reviewed 93.63
KOG0337|consensus 529 93.23
PRK05298 652 excinuclease ABC subunit B; Provisional 92.16
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 91.91
KOG0951|consensus 1674 91.78
KOG4284|consensus 980 91.31
smart00487201 DEXDc DEAD-like helicases superfamily. 91.05
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 90.92
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 90.39
PRK04914 956 ATP-dependent helicase HepA; Validated 89.75
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 89.38
KOG0354|consensus 746 88.48
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 87.44
KOG0947|consensus 1248 86.05
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 85.45
KOG0349|consensus 725 85.07
KOG0344|consensus 593 84.9
KOG0327|consensus397 83.27
KOG0352|consensus 641 80.3
>KOG0922|consensus Back     alignment and domain information 
Probab=100.00  E-value=6.3e-76  Score=605.88  Aligned_cols=286  Identities=48%  Similarity=0.692  Sum_probs=260.0

Q ss_pred             HHHHHHHHHHHHHHHhHhcCccee----cCCCchHHHHHHHHcCCc----------ceeE----eeCCCCCceeeeCCeE
Q psy12726        103 TLKRAQDVRKQLLGIMDRHKLDVV----SAGKNTVRVQKAVCSGFF----------RNAA----KKDPQEGYRTLVDSQV  164 (558)
Q Consensus       103 ~l~~i~~~r~qL~~~l~~~~~~~~----gsgkst~i~~~lL~~g~~----------~~~A----~~r~~~~~~~~~~~~v  164 (558)
                      .-+||++.|+||+..++++++.++    ||||+||+||+|+.+||.          |++|    ++|++.++++..|+.|
T Consensus        48 ~~LPI~~~r~~il~~ve~nqvlIviGeTGsGKSTQipQyL~eaG~~~~g~I~~TQPRRVAavslA~RVAeE~~~~lG~~V  127 (674)
T KOG0922|consen   48 ESLPIYKYRDQILYAVEDNQVLIVIGETGSGKSTQIPQYLAEAGFASSGKIACTQPRRVAAVSLAKRVAEEMGCQLGEEV  127 (674)
T ss_pred             ccCCHHHHHHHHHHHHHHCCEEEEEcCCCCCccccHhHHHHhcccccCCcEEeecCchHHHHHHHHHHHHHhCCCcCcee
Confidence            347999999999999999999877    999999999999999997          4444    6788999999999999


Q ss_pred             EEEecCCCCCCCCCCEEEEEeeeeccccccccccccChHHHHHhcCcccccCCcccccccccceecccccccccCCCchh
Q psy12726        165 VYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPLQRTNRISFPPG  244 (558)
Q Consensus       165 ~~ihp~s~l~~~~~~~ii~~~l~~T~~~~lr~~~~i~~~wL~~~~~~~~~~~~~~~l~~~~~vi~De~her~~~~D~ll~  244 (558)
                      ||..|++..  +++.+.|.   |+|+|.++|+ ...||.                 |++|++||+||+|||+++||+|||
T Consensus       128 GY~IRFed~--ts~~Trik---ymTDG~LLRE-~l~Dp~-----------------LskYsvIIlDEAHERsl~TDiLlG  184 (674)
T KOG0922|consen  128 GYTIRFEDS--TSKDTRIK---YMTDGMLLRE-ILKDPL-----------------LSKYSVIILDEAHERSLHTDILLG  184 (674)
T ss_pred             eeEEEeccc--CCCceeEE---EecchHHHHH-HhcCCc-----------------cccccEEEEechhhhhhHHHHHHH
Confidence            999999999  88899999   9999999999 778999                 999999999999999999999999


Q ss_pred             hhHHHhhcCCCeeEEEEecccchHHHhhhcCCCCEEEecCCCCcceeeccCCCCcchHHHHHHHHHHHHhcCCCCCEEEE
Q psy12726        245 LLKQAVKKRPEIKLIVTSATLDAVKFSSYFFEAPIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDVLLF  324 (558)
Q Consensus       245 ~lk~~l~~r~~lKlIlMSATl~~~~F~~yF~~~pvi~Ipgr~fpV~~~yl~~~~~d~~~~~~~~~~~i~~~~~~g~iLvf  324 (558)
                      +||+++++|++|||||||||||+++|++||++||++.||||+|||+++|++.+..||+++++.++++||..+++||||||
T Consensus       185 lLKki~~~R~~LklIimSATlda~kfS~yF~~a~i~~i~GR~fPVei~y~~~p~~dYv~a~~~tv~~Ih~~E~~GDILvF  264 (674)
T KOG0922|consen  185 LLKKILKKRPDLKLIIMSATLDAEKFSEYFNNAPILTIPGRTFPVEILYLKEPTADYVDAALITVIQIHLTEPPGDILVF  264 (674)
T ss_pred             HHHHHHhcCCCceEEEEeeeecHHHHHHHhcCCceEeecCCCCceeEEeccCCchhhHHHHHHHHHHHHccCCCCCEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecChHHHHHHHHhhhhhcccceecCCCchHHHHHHhhhhhhhcccccCCCCCccccccccceecCCCcccccCCCcchhh
Q psy12726        325 LTGKLDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIY  404 (558)
Q Consensus       325 l~g~~ei~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  404 (558)
                      |||++||+..+                                                                     
T Consensus       265 LtGqeEIe~~~---------------------------------------------------------------------  275 (674)
T KOG0922|consen  265 LTGQEEIEAAC---------------------------------------------------------------------  275 (674)
T ss_pred             eCCHHHHHHHH---------------------------------------------------------------------
Confidence            99999886543                                                                     


Q ss_pred             hhhhhhHHHHHHHhhcCCchhhhhhccccccCCCcchhhhhhhhccccccccccCCCccccccchhhhhHHHHHHHhhhc
Q psy12726        405 HELVQTTKEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPLYNKYEEPNAWRISREEIDTACEILYERMKS  484 (558)
Q Consensus       405 ~~l~~~~~~~~~~~~~~~~~~~l~f~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ei~~~~~~l~~~~~~  484 (558)
                                                                                             +.|.+..+.
T Consensus       276 -----------------------------------------------------------------------~~l~e~~~~  284 (674)
T KOG0922|consen  276 -----------------------------------------------------------------------ELLRERAKS  284 (674)
T ss_pred             -----------------------------------------------------------------------HHHHHHhhh
Confidence                                                                                   333333333


Q ss_pred             CCCCCCceEEEeccCCCChHHHHhhcccCCCCCeEEEEeeccccceeeeCCeEEEEcCChhhHHhhcccc
Q psy12726        485 LGPDVPELIILPVYSALPSEMQTRIFEAAPPGSRKVVIATNIAETSLTIDGIFYVVDPFDIEVRQAKYHR  554 (558)
Q Consensus       485 ~~~~~~~~~vlpLhs~l~~~~Q~~vf~~~~~g~rkVIlaTNIAETSiTIpdV~~VID~g~~~~~~~~~~~  554 (558)
                      ...+.+. .++||||+||+++|.+||.++|+|.|||||||||||||||||||+||||+|..  |+..|++
T Consensus       285 ~~~~~~~-~~lply~aL~~e~Q~rvF~p~p~g~RKvIlsTNIAETSlTI~GI~YVVDsG~v--K~~~y~p  351 (674)
T KOG0922|consen  285 LPEDCPE-LILPLYGALPSEEQSRVFDPAPPGKRKVILSTNIAETSLTIDGIRYVVDSGFV--KQKKYNP  351 (674)
T ss_pred             ccccCcc-eeeeecccCCHHHhhccccCCCCCcceEEEEcceeeeeEEecceEEEEcCCce--EEEeecc
Confidence            3333344 89999999999999999999999999999999999999999999999999955  5555554

>KOG0923|consensus Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>PF07717 OB_NTP_bind: Oligonucleotide/oligosaccharide-binding (OB)-fold; InterPro: IPR011709 This domain is found towards the C terminus of the DEAD-box helicases (IPR011545 from INTERPRO) Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>smart00847 HA2 Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PF07717 OB_NTP_bind: Oligonucleotide/oligosaccharide-binding (OB)-fold; InterPro: IPR011709 This domain is found towards the C terminus of the DEAD-box helicases (IPR011545 from INTERPRO) Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query558
3i4u_A270 Crystal Structure Analysis Of A Helicase Associated 1e-100
3i4u_A270 Crystal Structure Analysis Of A Helicase Associated 3e-55
3kx2_B767 Crystal Structure Of Prp43p In Complex With Adp Len 4e-44
3kx2_B 767 Crystal Structure Of Prp43p In Complex With Adp Len 1e-25
3kx2_B767 Crystal Structure Of Prp43p In Complex With Adp Len 3e-19
3kx2_B 767 Crystal Structure Of Prp43p In Complex With Adp Len 3e-12
2xau_A773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 4e-44
2xau_A 773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 1e-25
2xau_A773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 3e-19
2xau_A 773 Crystal Structure Of The Prp43p Deah-Box Rna Helica 3e-12
>pdb|3I4U|A Chain A, Crystal Structure Analysis Of A Helicase Associated Domain Length = 270 Back     alignment and structure 
Iteration: 1

 Score =  362 bits (929), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 166/213 (77%), Positives = 185/213 (86%)
Query: 2   DSLVVTPISQMAEFPLEPNLSKMLIMSVHLQCSDEVLTIVSMLSVQNVFYRPXXXXXXXX 61
           + L+     +MAEFPLEP L KMLIMSVHL CS+E+LTIVSMLSVQNVFYRP        
Sbjct: 36  EGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALAD 95
Query: 62  XXXXXFNQMEGDHITLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRH 121
                F+Q EGDH+TLLAVYNSW+NNKFSN WCYENF+Q R+L+RAQD+RKQ+LGIMDRH
Sbjct: 96  QKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRH 155
Query: 122 KLDVVSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWV 181
           KLDVVS GK+TVRVQKA+CSGFFRNAAKKDPQEGYRTL+D QVVYIHPSSALFNRQPEWV
Sbjct: 156 KLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWV 215
Query: 182 IYHELVQTTKEYMREVTSIDPKWLVEFAPAFFK 214
           +YHELV TTKEYMREVT+IDP+WLVEFAPAFFK
Sbjct: 216 VYHELVLTTKEYMREVTTIDPRWLVEFAPAFFK 248
>pdb|3I4U|A Chain A, Crystal Structure Analysis Of A Helicase Associated Domain Length = 270 Back     alignment and structure
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure
>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767 Back     alignment and structure
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure
>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query558
3i4u_A270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 1e-137
3i4u_A270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 3e-69
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 1e-115
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 7e-56
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 2e-45
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 8e-34
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 3e-16
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 1e-09
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 2e-15
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 3e-07
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 6e-05
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 5e-15
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 2e-06
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 2e-14
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 2e-06
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 2e-14
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 4e-08
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 4e-06
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 2e-14
1yks_A 440 Genome polyprotein [contains: flavivirin protease 7e-14
1yks_A440 Genome polyprotein [contains: flavivirin protease 7e-06
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 1e-13
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Length = 270 Back     alignment and structure
 Score =  398 bits (1025), Expect = e-137
 Identities = 180/228 (78%), Positives = 200/228 (87%), Gaps = 1/228 (0%)

Query: 7   TPI-SQMAEFPLEPNLSKMLIMSVHLQCSDEVLTIVSMLSVQNVFYRPKDKQALADQKKA 65
           T +  +MAEFPLEP L KMLIMSVHL CS+E+LTIVSMLSVQNVFYRPKDKQALADQKKA
Sbjct: 40  TRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKA 99

Query: 66  KFNQMEGDHITLLAVYNSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDV 125
           KF+Q EGDH+TLLAVYNSW+NNKFSN WCYENF+Q R+L+RAQD+RKQ+LGIMDRHKLDV
Sbjct: 100 KFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDV 159

Query: 126 VSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHE 185
           VS GK+TVRVQKA+CSGFFRNAAKKDPQEGYRTL+D QVVYIHPSSALFNRQPEWV+YHE
Sbjct: 160 VSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHE 219

Query: 186 LVQTTKEYMREVTSIDPKWLVEFAPAFFKFSDPTKLSKFKKNQRLEPL 233
           LV TTKEYMREVT+IDP+WLVEFAPAFFK  +         +    P 
Sbjct: 220 LVLTTKEYMREVTTIDPRWLVEFAPAFFKVLEVDLQGDHGLSAWSHPQ 267
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Length = 270 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query558
3i4u_A270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 100.0
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.97
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.82
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.81
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.73
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.66
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.64
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.58
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.54
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.53
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.53
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.49
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.48
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.39
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.36
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.35
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.34
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.33
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.3
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.3
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.29
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.28
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.27
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.26
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.26
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.23
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.21
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.2
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.2
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.2
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.17
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.17
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.14
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.08
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.08
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.05
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 98.99
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 98.98
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 98.9
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 98.89
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.86
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 98.86
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 98.86
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 98.76
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 98.75
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 98.74
3i4u_A270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 98.73
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.6
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 98.59
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 98.59
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 98.41
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 98.31
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 98.24
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 98.18
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 98.14
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 98.14
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 98.12
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 98.11
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 98.05
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 98.02
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 97.94
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 96.97
3h1t_A590 Type I site-specific restriction-modification syst 97.65
3jux_A 822 Protein translocase subunit SECA; protein transloc 97.62
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 97.38
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 97.33
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 97.17
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 96.93
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 96.83
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 96.62
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 96.61
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 96.43
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 96.39
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 96.34
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 96.32
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 96.2
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 96.06
3bor_A237 Human initiation factor 4A-II; translation initiat 96.01
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 95.93
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 95.92
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 95.88
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 95.66
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 95.27
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 95.24
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 94.53
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 94.26
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 93.3
3b6e_A216 Interferon-induced helicase C domain-containing P; 92.91
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 92.18
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 87.77
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 86.51
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 80.03
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.7e-42  Score=339.14  Aligned_cols=216  Identities=83%  Similarity=1.310  Sum_probs=203.3

Q ss_pred             CCCCCcc-cccccCccchhhHHHHHHhhccCChHHHHHHHhHhcCCCCccCChhHHHHHHHHHhhhcCCCCCHHHHHHHH
Q psy12726          3 SLVVTPI-SQMAEFPLEPNLSKMLIMSVHLQCSDEVLTIVSMLSVQNVFYRPKDKQALADQKKAKFNQMEGDHITLLAVY   81 (558)
Q Consensus         3 ~~~lT~l-~~ma~lPl~PrlakmLl~~~~~~c~~~~~~iaA~Ls~~~~f~~~~~~~~~~~~~~~~~~~~~sD~l~~l~~~   81 (558)
                      +|+||++ ++|++||+|||+||||+.|..++|++++++|||+||+++||.+|.+++++++..|.+|....|||++++|+|
T Consensus        36 ~g~lT~lG~~ma~lPl~P~lakmLl~a~~~~c~~~~l~iaA~Ls~~~~f~~p~~~~~~a~~~~~~f~~~~sD~ltlLn~~  115 (270)
T 3i4u_A           36 EGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLTLLAVY  115 (270)
T ss_dssp             TSCBCHHHHHHTTSCSCHHHHHHHHHHHHTTCHHHHHHHHHHHTSSCCBCCCGGGHHHHHHHHHTTCBTTBHHHHHHHHH
T ss_pred             CCCccHHHHHHHhCCCCHHHHHHHHHhhhcCCHHHHHHHHHHHCCCccccCCchhHHHHHHHHHHccCCCChHHHHHHHH
Confidence            4899999 899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcCCchHHHHHccCCHHHHHHHHHHHHHHHHHhHhcCcceecCCCchHHHHHHHHcCCcceeEeeCCCCCceeeeC
Q psy12726         82 NSWRNNKFSNAWCYENFVQIRTLKRAQDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAVCSGFFRNAAKKDPQEGYRTLVD  161 (558)
Q Consensus        82 ~~~~~~~~~~~~c~~~~L~~~~l~~i~~~r~qL~~~l~~~~~~~~gsgkst~i~~~lL~~g~~~~~A~~r~~~~~~~~~~  161 (558)
                      ++|.+.+..++||++|||+.++|+++.++|+||.+++++.++....++.+...++.+|++||++|+|.++..+.|.+..+
T Consensus       116 ~~~~~~~~~~~wC~~~fL~~~~l~~~~~ir~QL~~~l~~~~~~~~s~~~~~~~i~~~L~aG~~~nvA~~~~~~~Y~~~~~  195 (270)
T 3i4u_A          116 NSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLID  195 (270)
T ss_dssp             HHHHHTTTCHHHHHHTTBCHHHHHHHHHHHHHHHHHHHHTTCCCCCCTTCTHHHHHHHHHHHGGGEEEECSSSSEEETTT
T ss_pred             HHHHHcCchhhHHHHhcCCHHHHHHHHHHHHHHHHHHHHcCCCcCCCcchHHHHHHHHHHHhHHHHheeCCCCceEEccC
Confidence            99998888889999999999999999999999999999988876677778888999999999999998887778988899


Q ss_pred             CeEEEEecCCCCCCCCCCEEEEEeeeeccccccccccccChHHHHHhcCcccccCCc
Q psy12726        162 SQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTSIDPKWLVEFAPAFFKFSDP  218 (558)
Q Consensus       162 ~~v~~ihp~s~l~~~~~~~ii~~~l~~T~~~~lr~~~~i~~~wL~~~~~~~~~~~~~  218 (558)
                      +..+++||+|++++..|+|+||+|++.|++.|+|.++.|+|+||.+++|+++...+-
T Consensus       196 ~~~v~iHPsS~L~~~~p~wvvy~Elv~Tsk~y~r~vt~I~p~wL~~~ap~~~~~~~~  252 (270)
T 3i4u_A          196 QQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVLEV  252 (270)
T ss_dssp             CCEEEECTTSTTTTSCCSEEEEEEEEESSSEEEEEEEECCHHHHHHHCTTTEECC--
T ss_pred             CCEEEECchhhhcCCCCCEEEEEehhhhhHhHHHhccccCHHHHHHHhHHHhccccc
Confidence            999999999999888899999999999999999999999999999999999876653
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 558
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 7e-14
d1yksa2 299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 3e-07
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

 Score = 70.0 bits (171), Expect = 7e-14
 Identities = 13/98 (13%), Positives = 28/98 (28%), Gaps = 18/98 (18%)

Query: 11  QMAEFPLEPNLSKMLIMSVHLQCSDEVLTIVSMLS-VQNVFYRPKDKQALAD-QKKAKFN 68
           +  + P+                S +V       +  +  F  P++ + L D  +  K  
Sbjct: 218 RNCDLPVW--------------LSWQVAKAGLKTNDRKWCFEGPEEHEILNDSGETVKCR 263

Query: 69  QMEGDHITLLAVYNSWRNNKFSNAWCYENFVQIRTLKR 106
              G    L   +        S+      F++    +R
Sbjct: 264 APGGAKKPLRPRW--CDERVSSDQSALSEFIKFAEGRR 299
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query558
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.29
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.25
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 98.05
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.96
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 97.96
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 97.9
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 97.89
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 97.89
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 97.86
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 97.83
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 97.81
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 97.78
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.56
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 97.43
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 97.39
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 97.38
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 97.26
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 96.86
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 95.43
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 94.5
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 94.22
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 92.73
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 92.45
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 92.45
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 92.34
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 92.24
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 92.22
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 91.83
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 91.75
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 90.96
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 89.97
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 89.63
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 86.12
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 80.85
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]

Probab=99.29  E-value=1.3e-13  Score=135.69  Aligned_cols=96  Identities=14%  Similarity=0.036  Sum_probs=59.9

Q ss_pred             ccccccceecccccccccCCCchhhhHHHhhcCCCeeEEEEecccchHHHhhhcCCCCEEEecCCCCcceeeccCCCCcc
Q psy12726        221 LSKFKKNQRLEPLQRTNRISFPPGLLKQAVKKRPEIKLIVTSATLDAVKFSSYFFEAPIFTIPGRTFPVEVLYTKEPETD  300 (558)
Q Consensus       221 l~~~~~vi~De~her~~~~D~ll~~lk~~l~~r~~lKlIlMSATl~~~~F~~yF~~~pvi~Ipgr~fpV~~~yl~~~~~d  300 (558)
                      +.+++.+++||+|.-.-..+.+.++++.+. .++++++++||||.......-....+|+...+.. .|....      ..
T Consensus        98 ~~~~~~vViDE~H~~~~~~~~~~~~l~~~~-~~~~~~~v~~SAT~~~~~~~~~~~~~~~~~~~~~-~~~~~~------~~  169 (305)
T d2bmfa2          98 VPNYNLIIMDEAHFTDPASIAARGYISTRV-EMGEAAGIFMTATPPGSRDPFPQSNAPIMDEERE-IPERSW------NS  169 (305)
T ss_dssp             CCCCSEEEEESTTCCSHHHHHHHHHHHHHH-HHTSCEEEEECSSCTTCCCSSCCCSSCEEEEECC-CCCSCC------SS
T ss_pred             ccceeEEEeeeeeecchhhHHHHHHHHHhh-ccccceEEEeecCCCcceeeecccCCcceEEEEe-ccHHHH------HH
Confidence            678899999999988777777777777654 5678999999999965433222223444333211 111110      11


Q ss_pred             hHHHHHHHHHHHHhcCCCCCEEEEecChHHHHH
Q psy12726        301 YLDASLITVMQIHLREPPGDVLLFLTGKLDVRK  333 (558)
Q Consensus       301 ~~~~~~~~~~~i~~~~~~g~iLvfl~g~~ei~~  333 (558)
                      ..         .......+.+|+|++..+++++
T Consensus       170 ~~---------~~~~~~~~~~lvf~~~~~~~~~  193 (305)
T d2bmfa2         170 GH---------EWVTDFKGKTVWFVPSIKAGND  193 (305)
T ss_dssp             CC---------HHHHSSCSCEEEECSCHHHHHH
T ss_pred             HH---------HHHHhhCCCEEEEeccHHHHHH
Confidence            11         1123456889999998887754
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure