Psyllid ID: psy12789

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510----
MPIIIDQPHIMCLASNDPVEVLLRKQPPSVTASFYQRVKFLVEENSVQSYAHMDEYSERYFNSISNVTAGVSSSGPIGVTDFSQVPDSFEEAPSVVELKDFNSLISATIPSFQFWNSDFNIEQSAFFRFNFDLPRGSNFAVYGRRNVAPSITNYDFSEFIKDNTRTSAFFRFNFDLPRGSNFAVYGRRNVAPSITNYDFSEFIKGGKINQKRSVDSILGHDDGVSFTSHISNQHHTLSKRSDQTTETNFVEVQILKFLMSGKWFLSVYNDDVKTHEIKLLIKEAEGVSSTCPNGCSGHGSCYLGKCDCIDGYEGTDCSKSVCPVLCSNHGKYGGGICHCENGWKGPECDIPASDCQYSDCSGHGSCVEGTCHCQSGWKGIGCQEAGCPNACNRHGTCAFENEEYQCVCAEGWAGVDCNIKLEMSCNDDTDNDKDGVTDCSDSDCCSQPVCSDQPHIMCLASNDPVEVLLRKQPPSVTASFYQRVKFLVEENSVQSYAHMDEYSESEFWNSFTPR
ccEEEccccccccccccHHHHHHccccccccHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccEEEEccccccccccccccEEEEEcccccccccccccEEEEEEEEEccccEEEEEEccccccccEEEccccccccccccccEEEEEccccEEEEEEEEEEcccccEEEEEccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccEEEEEEEEcccccccccccccccccEEEccEEEcccccccccccccccccccccccEEEccEEEccccccccccccccccccccccccccEEEccEEEcccccccccccccccccccccccEEEEccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccEEEEccccccccccccccccccccccccccccc
ccEEEccccEEEEEccccHHEHHccccccHHHHHHHHEEEEEccccHHHHccccHccHHHHHEEEccccccccccccccEccccccccccccccEEcHHHHcHHEEEEccccEEEEEEEEEcccEEEEEEEEcccccEEEEEEcccccccEEEEcHHHHHcccccEEEEEEEEEEcccccEEEEEEccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccHccccccEEEEEEEEEcccccEEEEEEccccccEEEccccccccccccccccccccccEEEccEEEEccccccccccccccccccccccEEcccEEEEcccccccccccccccccccccccccEEcccEEEEccccccccccccccccccccccEEEccccccEEEEccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccHccccccccccccHHHHHHHEccccccEEcccccccccccEEEccccc
mpiiidqphimclasndpvevllrkqppsvtaSFYQRVKFLVEensvqsyaHMDEYSERYFNSisnvtagvsssgpigvtdfsqvpdsfeeapsvvelkdfnslisatipsfqfwnsdfniEQSAFfrfnfdlprgsnfavygrrnvapsitnydfsefikdntrtsaffrfnfdlprgsnfavygrrnvapsitnydfsefikggkinqkrsvdsilghddgvsftshisnqhhtlskrsdqtteTNFVEVQILKFLMSGKWFLSVYNDDVKTHEIKLLIKEAegvsstcpngcsghgscylgkcdcidgyegtdcsksvcpvlcsnhgkygggichcengwkgpecdipasdcqysdcsghgscvegtchcqsgwkgigcqeagcpnacnrhgtcafeneeyqcvcaegwagvdcniklemscnddtdndkdgvtdcsdsdccsqpvcsdqphimclasndpvevllrkqppsvtaSFYQRVKFLVEensvqsyahmdeysesefwnsftpr
mpiiidqphimcLASNDPVEVLLRKQPPSVTASFYQRVKFLVEENSVQSYAHMDEYSERYFNSISNVTAGVSSSGPIGVTDFSQVPDSFEEAPSVVELKDFNSLISATIPSFQFWNSDFNIEQSAFFRFNFDLPRGSNFAVYGRRNVAPSITNYDFSEFIKDNTRTSAFFRFNFDLPRGSNFAVYGRRNVAPSITNYDFSEFIKGGKINQKRSVDSILGHDDGVSFTSHISNQHhtlskrsdqtteTNFVEVQILKFLMSGKWFLSVYNDDVKTHEIKLLIKEAEGVSSTCPNGCSGHGSCYLGKCDCIDGYEGTDCSKSVCPVLCSNHGKYGGGICHCENGWKGPECDIPASDCQYSDCSGHGSCVEGTCHCQSGWKGIGCQEAGCPNACNRHGTCAFENEEYQCVCAEGWAGVDCNIKLEMSCNDDTDNDKDGVTDCSDSDCCSQPVCSDQPHIMCLASNDPVEVLLRKQPPSVTASFYQRVKFLVEENSVQSyahmdeysesefwnsftpr
MPIIIDQPHIMCLASNDPVEVLLRKQPPSVTASFYQRVKFLVEENSVQSYAHMDEYSERYFNSISNVTAGVSSSGPIGVTDFSQVPDSFEEAPSVVELKDFNSLISATIPSFQFWNSDFNIEQSAFFRFNFDLPRGSNFAVYGRRNVAPSITNYDFSEFIKDNTRTSAFFRFNFDLPRGSNFAVYGRRNVAPSITNYDFSEFIKGGKINQKRSVDSILGHDDGVSFTSHISNQHHTLSKRSDQTTETNFVEVQILKFLMSGKWFLSVYNDDVKTHEIKLLIKEAEGVSSTCPNGCSGHGSCYLGKCDCIDGYEGTDCSKSVCPVLCSNHGKYGGGICHCENGWKGPECDIPASDCQYSDCSGHGSCVEGTCHCQSGWKGIGCQEAGCPNACNRHGTCAFENEEYQCVCAEGWAGVDCNIKLEMSCnddtdndkdgvtdCSDSDCCSQPVCSDQPHIMCLASNDPVEVLLRKQPPSVTASFYQRVKFLVEENSVQSYAHMDEYSESEFWNSFTPR
**IIIDQPHIMCLASNDPVEVLLRKQPPSVTASFYQRVKFLVEENSVQSYAHMDEYSERYFNSISNVTAGVS***PIGVTDF**********PSVVELKDFNSLISATIPSFQFWNSDFNIEQSAFFRFNFDLPRGSNFAVYGRRNVAPSITNYDFSEFIKDNTRTSAFFRFNFDLPRGSNFAVYGRRNVAPSITNYDFSEFIKGGKINQKRSVDSILGHDDGV**********************TNFVEVQILKFLMSGKWFLSVYNDDVKTHEIKLLIKEAEGVSSTCPNGCSGHGSCYLGKCDCIDGYEGTDCSKSVCPVLCSNHGKYGGGICHCENGWKGPECDIPASDCQYSDCSGHGSCVEGTCHCQSGWKGIGCQEAGCPNACNRHGTCAFENEEYQCVCAEGWAGVDCNIKLEMSCN************C*DSDCCSQPVCSDQPHIMCLASNDPVEVLLRKQPPSVTASFYQRVKFLVEENSVQSYA*****************
*PIIIDQPHIMCLASNDPVEVLLRKQPPSVTASFYQRVKFLVEENSVQSYA*******************************************VVELKDFNSLISATIPSFQFWNSDFNIEQSAFFRFNFDLPRGSNFAVYGRRNVAPSITNYDFSEFIKDNTRTSAFFRFNFDLPRGSNFAVYGRRNVAPSITNYDFSEFIKGGKINQKRSVDSILGHDDGVSFTSHISNQHHTLSKRSDQTTETNFVEVQILKFLMSGKWFLSVYNDDVKTHEIKLLIKEAEGVSSTCPNGCSGHGSCYLGKCDCIDGYEGTDCSKSVCPVLCSNHGKYGGGICHCENGWKGPECDIPASDCQYSDCSGHGSCVEGTCHCQSGWKGIGCQEAGCPNACNRHGTCAFENEEYQCVCAEGWAGVDCNIKLEMSCNDDTDNDKDGVTDCSDSDCCSQPVCSDQPHIMCLASNDPVEVLLRKQPPSVTASFYQRVKFLVEENSVQSYAHMDEYSESEFWNSF***
MPIIIDQPHIMCLASNDPVEVLLRKQPPSVTASFYQRVKFLVEENSVQSYAHMDEYSERYFNSISNVTAGVSSSGPIGVTDFSQVPDSFEEAPSVVELKDFNSLISATIPSFQFWNSDFNIEQSAFFRFNFDLPRGSNFAVYGRRNVAPSITNYDFSEFIKDNTRTSAFFRFNFDLPRGSNFAVYGRRNVAPSITNYDFSEFIKGGKINQKRSVDSILGHDDGVSFTSHI**************TETNFVEVQILKFLMSGKWFLSVYNDDVKTHEIKLLIKEAEGVSSTCPNGCSGHGSCYLGKCDCIDGYEGTDCSKSVCPVLCSNHGKYGGGICHCENGWKGPECDIPASDCQYSDCSGHGSCVEGTCHCQSGWKGIGCQEAGCPNACNRHGTCAFENEEYQCVCAEGWAGVDCNIKLEMSCNDDTDND*************SQPVCSDQPHIMCLASNDPVEVLLRKQPPSVTASFYQRVKFLVEENSVQSYAHMDEYS***********
MPIIIDQPHIMCLASNDPVEVLLRKQPPSVTASFYQRVKFLVEENSVQSYAHMDEYSERYFNSISNV********PI**TDFSQVPDSFEEAPSVVELKDFNSLISATIPSFQFWNSDFNIEQSAFFRFNFDLPRGSNFAVYGRRNVAPSITNYDFSEFIKDNTRTSAFFRFNFDLPRGSNFAVYGRRNVAPSITNYDFSEFIKGG**********************************S*QTTETNFVEVQILKFLMSGKWFLSVYNDDVKTHEIKLLIKEAEGVSSTCPNGCSGHGSCYLGKCDCIDGYEGTDCSKSVCPVLCSNHGKYGGGICHCENGWKGPECDIPASDCQYSDCSGHGSCVEGTCHCQSGWKGIGCQEAGCPNACNRHGTCAFENEEYQCVCAEGWAGVDCNIKLEMSCNDDTDNDKDGVTDCSDSDCCSQPVCSDQPHIMCLASNDPVEVLLRKQPPSVTASFYQRVKFLVEENSVQSYAHMDEYSESEFWNSFTPR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPIIIDQPHIMCLASNDPVEVLLRKQPPSVTASFYQRVKFLVEENSVQSYAHMDEYSERYFNSISNVTAGVSSSGPIGVTDFSQVPDSFEEAPSVVELKDFNSLISATIPSFQFWNSDFNIEQSAFFRFNFDLPRGSNFAVYGRRNVAPSITNYDFSEFIKDNTRTSAFFRFNFDLPRGSNFAVYGRRNVAPSITNYDFSEFIKGGKINQKRSVDSILGHDDGVSFTSHISNQHHTLSKRSDQTTETNFVEVQILKFLMSGKWFLSVYNDDVKTHEIKLLIKEAEGVSSTCPNGCSGHGSCYLGKCDCIDGYEGTDCSKSVCPVLCSNHGKYGGGICHCENGWKGPECDIPASDCQYSDCSGHGSCVEGTCHCQSGWKGIGCQEAGCPNACNRHGTCAFENEEYQCVCAEGWAGVDCNIKLEMSCNDDTDNDKDGVTDCSDSDCCSQPVCSDQPHIMCLASNDPVEVLLRKQPPSVTASFYQRVKFLVEENSVQSYAHMDEYSESEFWNSFTPR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query514 2.2.26 [Sep-21-2011]
Q9VYN8 3004 Teneurin-a OS=Drosophila yes N/A 0.603 0.103 0.405 4e-79
O61307 2731 Teneurin-m OS=Drosophila no N/A 0.420 0.079 0.394 1e-52
Q9W7R4 2590 Teneurin-3 OS=Danio rerio yes N/A 0.538 0.106 0.337 3e-44
Q9W6V6 2705 Teneurin-1 OS=Gallus gall no N/A 0.387 0.073 0.416 1e-43
Q9WTS4 2731 Teneurin-1 OS=Mus musculu yes N/A 0.451 0.084 0.359 1e-43
Q9UKZ4 2725 Teneurin-1 OS=Homo sapien no N/A 0.447 0.084 0.358 2e-43
Q9P273 2699 Teneurin-3 OS=Homo sapien no N/A 0.453 0.086 0.362 3e-43
Q9DER5 2802 Teneurin-2 OS=Gallus gall no N/A 0.433 0.079 0.376 4e-43
Q9WTS6 2715 Teneurin-3 OS=Mus musculu no N/A 0.457 0.086 0.353 1e-42
Q9W7R3 2824 Teneurin-4 OS=Danio rerio no N/A 0.494 0.089 0.313 1e-42
>sp|Q9VYN8|TENA_DROME Teneurin-a OS=Drosophila melanogaster GN=Ten-a PE=1 SV=2 Back     alignment and function desciption
 Score =  296 bits (757), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 171/422 (40%), Positives = 211/422 (50%), Gaps = 112/422 (26%)

Query: 95  VVELKDFNSLISATIPSFQFWNSDFNIEQSAFFRFNFDLPRGSNFAVYGRRNVAPSITNY 154
           VVELK+FN    ATIP++QFW  +F                         RN  P     
Sbjct: 353 VVELKEFNEAYHATIPAYQFWTLEF-------------------------RNKHP----- 382

Query: 155 DFSEFIKDNTRTSAFFRFNFDLPRGSNFAVYGRRNVAPSITNYDFSEFIKGGKIN----- 209
                        AF RFNF LP G++FAVY RRNVAPS+T +DF EFIKGG+++     
Sbjct: 383 -------------AFIRFNFTLPWGAHFAVYSRRNVAPSVTQHDFVEFIKGGRLDSHLRH 429

Query: 210 ------------------------------------QKRSVDSILGHDDGVSFTS---HI 230
                                               + RS DS   +D      +   H+
Sbjct: 430 RRSSANATTTGQDMELYRQDKDQSAESAQDQDSEQDESRSFDSSESYDVETPLDTAKQHL 489

Query: 231 SN----QHHTLSKRSD------QTTETNFVEVQILKFLMSGKWFLSVYNDDVKTHEIKLL 280
                 Q H ++KRS          +   V V +L++L +G WF+SVYND++  H + LL
Sbjct: 490 QRIGKPQSHWVNKRSAGDGLPALDVDAMTVNVSLLQYLDTGLWFISVYNDELVAHSVSLL 549

Query: 281 IKEAEGVSSTCPNGCSGHGSCYLGKCDCIDGYEGTDCSKSVCPVLCSNHGKYGGGICHCE 340
            +EAEGVS+TCPN CSG GSCYLGKCDCIDGY+G DCSKSVCPVLCS HG YGGG+CHCE
Sbjct: 550 AEEAEGVSTTCPNDCSGRGSCYLGKCDCIDGYQGVDCSKSVCPVLCSAHGHYGGGVCHCE 609

Query: 341 NGWKGPECDIPASDCQYSDCSGHGSCVEGTCHCQSGWKGIGCQEAGCPN-ACNRHGTCAF 399
            GWKG ECDIP  +C+  +CS HG C+EG CHC+ GWKG  C +  C +  C+ HGTC  
Sbjct: 610 EGWKGAECDIPVGECEVPNCSSHGRCIEGECHCERGWKGPYCDQHDCLDPLCSGHGTCVA 669

Query: 400 ENEEYQCVCAEGWAGVDCNIKLEMSCNDDTDNDKDGVTDCSDSDC----------CSQPV 449
                QC C  GW G DC    +          + G  D     C          CSQ V
Sbjct: 670 G----QCYCKAGWQGEDCGTIDQQVYQCLPGCSEHGTYDLETGQCVCERHWTGPDCSQAV 725

Query: 450 CS 451
           CS
Sbjct: 726 CS 727
Involved in neural development, regulating the establishment of proper connectivity within the nervous system. Acts as a homophilic and heterophilic synaptic cell adhesion molecule that drives synapse assembly. Promotes bi-directional trans-synaptic signaling with ten-m to organize neuromuscular synapses.
Drosophila melanogaster (taxid: 7227)
>sp|O61307|TENM_DROME Teneurin-m OS=Drosophila melanogaster GN=Ten-m PE=1 SV=2 Back     alignment and function description
>sp|Q9W7R4|TEN3_DANRE Teneurin-3 OS=Danio rerio GN=tenm3 PE=2 SV=1 Back     alignment and function description
>sp|Q9W6V6|TEN1_CHICK Teneurin-1 OS=Gallus gallus GN=TENM1 PE=1 SV=1 Back     alignment and function description
>sp|Q9WTS4|TEN1_MOUSE Teneurin-1 OS=Mus musculus GN=Tenm1 PE=1 SV=1 Back     alignment and function description
>sp|Q9UKZ4|TEN1_HUMAN Teneurin-1 OS=Homo sapiens GN=TENM1 PE=1 SV=2 Back     alignment and function description
>sp|Q9P273|TEN3_HUMAN Teneurin-3 OS=Homo sapiens GN=TENM3 PE=2 SV=3 Back     alignment and function description
>sp|Q9DER5|TEN2_CHICK Teneurin-2 OS=Gallus gallus GN=TENM2 PE=1 SV=1 Back     alignment and function description
>sp|Q9WTS6|TEN3_MOUSE Teneurin-3 OS=Mus musculus GN=Tenm3 PE=1 SV=1 Back     alignment and function description
>sp|Q9W7R3|TEN4_DANRE Teneurin-4 OS=Danio rerio GN=tenm4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query514
195162604 2840 GL25136 [Drosophila persimilis] gi|19410 0.795 0.144 0.416 1e-103
328790868 2646 PREDICTED: teneurin-3-like isoform 1 [Ap 0.568 0.110 0.482 4e-85
383855590 2641 PREDICTED: teneurin-3-like [Megachile ro 0.548 0.106 0.469 2e-84
242025636 2523 type II transmembrane protein, putative 0.671 0.136 0.485 7e-84
170051033 2792 type II transmembrane protein [Culex qui 0.601 0.110 0.429 1e-83
340714986 2646 PREDICTED: teneurin-3-like isoform 2 [Bo 0.566 0.109 0.477 2e-83
350397567 2628 PREDICTED: teneurin-3-like [Bombus impat 0.566 0.110 0.477 2e-83
340714984 2628 PREDICTED: teneurin-3-like isoform 1 [Bo 0.566 0.110 0.477 2e-83
307167252 2600 Teneurin-3 [Camponotus floridanus] 0.546 0.108 0.463 4e-83
195469828 3017 GE16501 [Drosophila yakuba] gi|194187362 0.657 0.112 0.442 4e-83
>gi|195162604|ref|XP_002022144.1| GL25136 [Drosophila persimilis] gi|194104105|gb|EDW26148.1| GL25136 [Drosophila persimilis] Back     alignment and taxonomy information
 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 221/530 (41%), Positives = 278/530 (52%), Gaps = 121/530 (22%)

Query: 93  PSVVELKDFNSLISATIPSFQ------------FWNSDFNIEQSAFF----RFNF----- 131
           P VVELK+FN +  A IP++Q            F   +F +   A F    R N      
Sbjct: 362 PQVVELKEFNEVYHANIPAYQFWTLEFRNKHPAFIRFNFTLPWGAHFAVYSRRNVAPSVT 421

Query: 132 -----DLPRGSNFAVYGRRNVAP-----SITNYDFSEFIKDNTRTSAFFRFNFDLPRGSN 181
                +  +G     + R   +P     SI   D+     D  +     RF    PR S 
Sbjct: 422 QHDFVEFIKGGRLDSHLRHRRSPPGNASSIAGKDWDAVYLDEQQQHLQERFT---PRPSP 478

Query: 182 FAVYGRRNVAPSITNYDFSEFIKGGKINQKRSVDSILGHDDGVSFTSHISNQH------- 234
              Y  ++      + D  +        +   V++ L     +    H   Q+       
Sbjct: 479 QFSYEEQDPDLMDDSNDDPDPDPDSDSGEFFDVETPLDTAKHLQRQIHFQQQNPQYAQHS 538

Query: 235 HTLSKRSD--------QTTETNFVEVQILKFLMSGKWFLSVYNDDVKTHEIKLLIKEAEG 286
           H + KRS            +   V V +L++L +G WF+SVYND++  H + LL +EAEG
Sbjct: 539 HEVKKRSAVDGGGLPALDMDAMTVNVSLLQYLDTGLWFISVYNDELVAHSVSLLAEEAEG 598

Query: 287 VSSTCPNGCSGHGSCYLGKCDCIDGYEGTDCSKSVCPVLCSNHGKYGGGICHCENGWKGP 346
           VS+TCPN CSG GSCYLGKCDCIDGY+G DCSKSVCPVLCS HG YGGG+CHCE+GWKG 
Sbjct: 599 VSTTCPNDCSGRGSCYLGKCDCIDGYQGVDCSKSVCPVLCSAHGHYGGGVCHCEDGWKGA 658

Query: 347 ECDIPASDCQYSDCS--------------------------------GHGSCVEGTCHCQ 374
           ECDIP  +C+  +CS                                GHG+CV G C+C+
Sbjct: 659 ECDIPVGECEVPNCSSHGRCIEGECHCERGWKGPYCDQHDCLDPLCSGHGTCVAGQCYCK 718

Query: 375 SGWKG--------------------------------------IGCQEAGCPNACNRHGT 396
           +GW+G                                        C +AGC N C+RHG 
Sbjct: 719 AGWQGEDCGTIDQQVYQCLPGCSEHGTYDLETGQCVCERHWTGPDCSQAGCENGCSRHGQ 778

Query: 397 CAFENEEYQCVCAEGWAGVDCNIKLEMSCNDDTDNDKDGVTDCSDSDCCSQPVCSDQPHI 456
           C  EN EY+C C EGWAG DC+I LE++C D+ DND DG+TDCSDS+CCS P CS+  HI
Sbjct: 779 CTLENGEYRCDCIEGWAGSDCSIALELNCKDNIDNDGDGMTDCSDSECCSHPACSE--HI 836

Query: 457 MCLASNDPVEVLLRKQPPSVTASFYQRVKFLVEENSVQSYAHMDEYSESE 506
           MCL+SNDPVEVLLRKQPPSVTASFYQRVKFL+EENSVQSYAHMDEYSE+ 
Sbjct: 837 MCLSSNDPVEVLLRKQPPSVTASFYQRVKFLIEENSVQSYAHMDEYSENR 886

Source: Drosophila persimilis

Species: Drosophila persimilis

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328790868|ref|XP_394629.4| PREDICTED: teneurin-3-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|383855590|ref|XP_003703293.1| PREDICTED: teneurin-3-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|242025636|ref|XP_002433230.1| type II transmembrane protein, putative [Pediculus humanus corporis] gi|212518771|gb|EEB20492.1| type II transmembrane protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|170051033|ref|XP_001861581.1| type II transmembrane protein [Culex quinquefasciatus] gi|167872458|gb|EDS35841.1| type II transmembrane protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|340714986|ref|XP_003396002.1| PREDICTED: teneurin-3-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350397567|ref|XP_003484916.1| PREDICTED: teneurin-3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340714984|ref|XP_003396001.1| PREDICTED: teneurin-3-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|307167252|gb|EFN60940.1| Teneurin-3 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|195469828|ref|XP_002099838.1| GE16501 [Drosophila yakuba] gi|194187362|gb|EDX00946.1| GE16501 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query514
FB|FBgn0259240 3378 Ten-a "Tenascin accessory" [Dr 0.616 0.093 0.489 1.1e-82
FB|FBgn0004449 2731 Ten-m "Tenascin major" [Drosop 0.408 0.076 0.408 5.1e-57
UNIPROTKB|J9NRQ0 2429 ODZ3 "Uncharacterized protein" 0.392 0.083 0.397 4e-51
UNIPROTKB|Q9P273 2699 TENM3 "Teneurin-3" [Homo sapie 0.392 0.074 0.392 4.1e-51
RGD|1306641 2529 Tenm3 "teneurin transmembrane 0.392 0.079 0.397 4.4e-51
UNIPROTKB|E1C414831 ODZ2 "Uncharacterized protein" 0.338 0.209 0.428 7.6e-51
UNIPROTKB|F1P9A6 2699 ODZ3 "Uncharacterized protein" 0.392 0.074 0.397 3.6e-50
UNIPROTKB|F1M0Y7 2598 Odz2 "Protein Odz2" [Rattus no 0.379 0.075 0.410 1.8e-49
UNIPROTKB|F1RR76 2534 ODZ2 "Uncharacterized protein" 0.381 0.077 0.407 2.1e-49
ZFIN|ZDB-GENE-060503-100 2515 si:ch211-12m10.1 "si:ch211-12m 0.408 0.083 0.371 2.7e-49
FB|FBgn0259240 Ten-a "Tenascin accessory" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 846 (302.9 bits), Expect = 1.1e-82, P = 1.1e-82
 Identities = 165/337 (48%), Positives = 204/337 (60%)

Query:    95 VVELKDFNSLISATIPSFQFWNSDFNIEQSAFFRFNFDLPRGSNFAVYGRRNVAPSITNY 154
             VVELK+FN    ATIP++QFW  +F  +  AF RFNF LP G++FAVY RRNVAPS+T +
Sbjct:   727 VVELKEFNEAYHATIPAYQFWTLEFRNKHPAFIRFNFTLPWGAHFAVYSRRNVAPSVTQH 786

Query:   155 DFSEFIKDNTRTSAFFRFNFDLPR----GSNFAVY--GRRNVAPSITNYDFSEFIKGGKI 208
             DF EFIK   R  +  R           G +  +Y   +   A S  + D SE  +    
Sbjct:   787 DFVEFIKGG-RLDSHLRHRRSSANATTTGQDMELYRQDKDQSAESAQDQD-SEQDESRSF 844

Query:   209 NQKRSVDSILGHDDGVSFTSHISN-QHHTLSKRS--DQT----TETNFVEVQILKFLMSG 261
             +   S D     D        I   Q H ++KRS  D       +   V V +L++L +G
Sbjct:   845 DSSESYDVETPLDTAKQHLQRIGKPQSHWVNKRSAGDGLPALDVDAMTVNVSLLQYLDTG 904

Query:   262 KWFLSVYNDDVKTHEIKLLIKEAEGVSSTCPNGCSGHGSCYLGKCDCIDGYEGTDCSKSV 321
              WF+SVYND++  H + LL +EAEGVS+TCPN CSG GSCYLGKCDCIDGY+G DCSKSV
Sbjct:   905 LWFISVYNDELVAHSVSLLAEEAEGVSTTCPNDCSGRGSCYLGKCDCIDGYQGVDCSKSV 964

Query:   322 CPVLCSNHGKYGGGICHCENGWKGPECDIPASDCQYSDCSGHGSCVEGTCHCQSGWKGIG 381
             CPVLCS HG YGGG+CHCE GWKG ECDIP  +C+  +CS HG C+EG CHC+ GWKG  
Sbjct:   965 CPVLCSAHGHYGGGVCHCEEGWKGAECDIPVGECEVPNCSSHGRCIEGECHCERGWKGPY 1024

Query:   382 CQEAGCPNA-CNRHGTCAFENEEYQCVCAEGWAGVDC 417
             C +  C +  C+ HGTC       QC C  GW G DC
Sbjct:  1025 CDQHDCLDPLCSGHGTCVAG----QCYCKAGWQGEDC 1057
GO:0005578 "proteinaceous extracellular matrix" evidence=ISS
GO:0007155 "cell adhesion" evidence=ISS
GO:0005576 "extracellular region" evidence=ISS
GO:0007160 "cell-matrix adhesion" evidence=ISS
GO:0005886 "plasma membrane" evidence=NAS
GO:0008039 "synaptic target recognition" evidence=IMP
GO:0051124 "synaptic growth at neuromuscular junction" evidence=IMP
GO:0031594 "neuromuscular junction" evidence=IDA
GO:0042734 "presynaptic membrane" evidence=IDA
GO:0016200 "synaptic target attraction" evidence=IMP
FB|FBgn0004449 Ten-m "Tenascin major" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|J9NRQ0 ODZ3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P273 TENM3 "Teneurin-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1306641 Tenm3 "teneurin transmembrane protein 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C414 ODZ2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P9A6 ODZ3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1M0Y7 Odz2 "Protein Odz2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RR76 ODZ2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-100 si:ch211-12m10.1 "si:ch211-12m10.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 514
KOG1225|consensus525 99.86
KOG1225|consensus525 99.57
KOG3512|consensus592 99.56
KOG1226|consensus783 99.52
KOG1219|consensus 4289 99.52
KOG4289|consensus 2531 99.23
KOG1219|consensus 4289 99.17
KOG1226|consensus783 99.04
KOG4289|consensus 2531 98.98
KOG1214|consensus 1289 98.79
KOG4260|consensus350 98.31
KOG4260|consensus350 98.22
KOG1217|consensus487 98.22
KOG1214|consensus 1289 98.16
KOG1217|consensus 487 98.16
KOG0994|consensus 1758 97.69
KOG0994|consensus 1758 97.37
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.3
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.14
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 97.1
KOG4659|consensus 1899 97.02
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 96.96
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 96.75
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 96.57
KOG1836|consensus 1705 96.29
cd0005336 EGF Epidermal growth factor domain, found in epide 96.08
smart0018135 EGF Epidermal growth factor-like domain. 95.74
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 95.0
KOG1836|consensus 1705 94.73
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 94.7
PF0000832 EGF: EGF-like domain This is a sub-family of the P 94.53
smart0017939 EGF_CA Calcium-binding EGF-like domain. 94.27
smart0005163 DSL delta serrate ligand. 94.1
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 93.97
smart00136238 LamNT Laminin N-terminal domain (domain VI). N-ter 93.94
KOG1218|consensus316 93.58
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 93.46
KOG1218|consensus316 92.84
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 92.74
smart0005163 DSL delta serrate ligand. 91.53
cd0005336 EGF Epidermal growth factor domain, found in epide 88.83
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 88.82
PF1266224 cEGF: Complement Clr-like EGF-like 87.87
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 85.71
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 85.52
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 85.4
smart0018135 EGF Epidermal growth factor-like domain. 83.61
PHA02887126 EGF-like protein; Provisional 81.25
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 81.1
KOG3512|consensus592 80.24
>KOG1225|consensus Back     alignment and domain information 
Probab=99.86  E-value=1.9e-21  Score=208.95  Aligned_cols=303  Identities=24%  Similarity=0.341  Sum_probs=216.5

Q ss_pred             CCccchhhheeeeeEEeeCccchhhhhhhhhhhhhhhccccccCcCCCCCcccccCCCCCC------CCCCCCceeeecc
Q psy12789         27 PPSVTASFYQRVKFLVEENSVQSYAHMDEYSERYFNSISNVTAGVSSSGPIGVTDFSQVPD------SFEEAPSVVELKD  100 (514)
Q Consensus        27 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~  100 (514)
                      ++-+++.|-+++-++.--|.. +=.|+-+...+-.++.|...+.....+..-...-.-...      ....|.=.....+
T Consensus        52 ~a~~~~~~~~~~~~~~~~ni~-~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~g~~~~~~~~~g~~~~~~~c~~~~~~  130 (525)
T KOG1225|consen   52 AAGFGSDFGTPTGLNHLYNIG-VPNPQLCALGSARAALSRLVALGLCLGGGICSLGKCELFFGDTGSDCPVRKCENDSST  130 (525)
T ss_pred             ccccchhccCeeeeeeeeccC-CCcchhhccccchhhhhhcccccccccccccccceeeeeeccchhcCCcccCCcCchh
Confidence            566788888888877766655 556777777666677766655554444222211111111      0112211111112


Q ss_pred             ccc-----eeeeeeCCcceecceeccccceeeEEeeecCCCCceeEeeccCCCCCcccceeEEEeeCccccccccccCCC
Q psy12789        101 FNS-----LISATIPSFQFWNSDFNIEQSAFFRFNFDLPRGSNFAVYGRRNVAPSITNYDFSEFIKDNTRTSAFFRFNFD  175 (514)
Q Consensus       101 ~~~-----~~~~~ipp~~fW~~~~~~~~p~~~~fn~tl~~~a~~~vygrr~~~ps~tqydf~Ell~G~~~~~~~~~~~~~  175 (514)
                      +++     .-...|++...|.+++++.-.+++.+=-+.+.+|.+|+|++++.-+.|.+|-|-+.|++.. .+.+.-.   
T Consensus       131 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~g~~~~~~~~~~hg~~~~~~~l~~~~-~s~~~~~---  206 (525)
T KOG1225|consen  131 QGVCDELLFRIDCIESLLSEDCLVRILCKNGVCSLKPNPFGAECGQYKCPNDGSGHGRYYFGNCLSGIS-ASGETCN---  206 (525)
T ss_pred             hhhhhhhhcccchhhhhhhhhhcchhhhhcccccccCCccccccceecCCcCCCCCccceecccccccC-cchhhhh---
Confidence            211     2344788889999999999999999999999999999999999999999999999999985 1110000   


Q ss_pred             CCCCCcceecCccccCCCcCccceeeeeeCCcccCccccccccCCCcceeeeeccCccccceeeccCCCeeeEEEEEEEE
Q psy12789        176 LPRGSNFAVYGRRNVAPSITNYDFSEFIKGGKINQKRSVDSILGHDDGVSFTSHISNQHHTLSKRSDQTTETNFVEVQIL  255 (514)
Q Consensus       176 ~~~~~~~~~~g~~~~~~~~~~~~~~~~i~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~R~~~~~~~~~~~~~~~  255 (514)
                                   |.               +                                         ........
T Consensus       207 -------------~~---------------~-----------------------------------------~~~~~~~~  217 (525)
T KOG1225|consen  207 -------------QL---------------G-----------------------------------------CNDDCFRT  217 (525)
T ss_pred             -------------cc---------------c-----------------------------------------CCccceec
Confidence                         00               0                                         00001112


Q ss_pred             EeecCCeEEEeEecCCcceeEEEEEEeccccccCCCCCCCCCCcEEeCCeEecCCCCcCCCCCCCCCCCCCCCCCeecCc
Q psy12789        256 KFLMSGKWFLSVYNDDVKTHEIKLLIKEAEGVSSTCPNGCSGHGSCYLGKCDCIDGYEGTDCSKSVCPVLCSNHGKYGGG  335 (514)
Q Consensus       256 ~~l~~G~~~l~~~nd~~~~~~v~~~~~~~~~~~~~Cp~~C~~~G~C~~g~C~C~~Gf~G~~Ce~~~C~~~C~~~G~c~~~  335 (514)
                      .+...++|+...+.++.. ...........+....|++.|.++|.|+.|+|+|++||+|.+|++..|+..|+.++.+..+
T Consensus       218 ~r~~~~~~~~~~~~~~~i-c~c~~~~~g~~c~~~~C~~~c~~~g~c~~G~CIC~~Gf~G~dC~e~~Cp~~cs~~g~~~~g  296 (525)
T KOG1225|consen  218 GRCREGRCFCTAGFFDGI-CECPEGYFGPLCSTIYCPGGCTGRGQCVEGRCICPPGFTGDDCDELVCPVDCSGGGVCVDG  296 (525)
T ss_pred             cccccCcccccccccCce-eecCCceeCCccccccCCCCCcccceEeCCeEeCCCCCcCCCCCcccCCcccCCCceecCC
Confidence            355566776555554441 1111112223345678999999999999999999999999999999999999999999999


Q ss_pred             eeecCCCCCCCCCCCCCCCCCCCCCCCCceeeCCceecCCCCCccccCCCCCCCCCCCCCeeeccCCceeeecCCCcccC
Q psy12789        336 ICHCENGWKGPECDIPASDCQYSDCSGHGSCVEGTCHCQSGWKGIGCQEAGCPNACNRHGTCAFENEEYQCVCAEGWAGV  415 (514)
Q Consensus       336 ~C~C~~G~~G~~Ce~~i~eC~~~~C~~~G~C~~~~C~C~~Gy~G~~C~~~~C~~~C~~~G~C~~~~Gsy~C~C~~Gy~G~  415 (514)
                      .|.|++||+|..|+..  .| +.+|.++|.|++++|.|.+||+|..|...    .|.++|.|++     .|.|..||.|.
T Consensus       297 ~CiC~~g~~G~dCs~~--~c-padC~g~G~Ci~G~C~C~~Gy~G~~C~~~----~C~~~g~cv~-----gC~C~~Gw~G~  364 (525)
T KOG1225|consen  297 ECICNPGYSGKDCSIR--RC-PADCSGHGKCIDGECLCDEGYTGELCIQR----ACSGGGQCVN-----GCKCKKGWRGP  364 (525)
T ss_pred             EeecCCCccccccccc--cC-CccCCCCCcccCCceEeCCCCcCCccccc----ccCCCceecc-----CceeccCccCC
Confidence            9999999999999743  46 57899999999999999999999999876    3999999985     29999999998


Q ss_pred             C
Q psy12789        416 D  416 (514)
Q Consensus       416 ~  416 (514)
                      +
T Consensus       365 d  365 (525)
T KOG1225|consen  365 D  365 (525)
T ss_pred             C
Confidence            8

>KOG1225|consensus Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>smart00136 LamNT Laminin N-terminal domain (domain VI) Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query514
2ygq_A324 Wif Domain-Epidermal Growth Factor (Egf)-Like Domai 9e-11
2ygq_A324 Wif Domain-Epidermal Growth Factor (Egf)-Like Domai 2e-06
2vj2_A169 Human Jagged-1, Domains Dsl And Egfs1-3 Length = 16 1e-05
3k6s_B687 Structure Of Integrin Alphaxbeta2 Ectodomain Length 2e-05
1jv2_B692 Crystal Structure Of The Extracellular Segment Of I 2e-04
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 3e-04
3ije_B695 Crystal Structure Of The Complete Integrin Alhavbet 5e-04
4g1m_B692 Re-Refinement Of Alpha V Beta 3 Structure Length = 5e-04
3fcs_B690 Structure Of Complete Ectodomain Of Integrin Aiibb3 6e-04
4g1e_B738 Crystal Structure Of Integrin Alpha V Beta 3 With C 6e-04
>pdb|2YGQ|A Chain A, Wif Domain-Epidermal Growth Factor (Egf)-Like Domains 1-3 Of Human Wnt Inhibitory Factor 1 In Complex With 1,2-Dipalmitoylphosphatidylcholine Length = 324 Back     alignment and structure 
Iteration: 1

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 76/188 (40%), Gaps = 37/188 (19%)
Query: 269 NDDVKTHEIKLLIKEAEGVSSTCPNGCSGHGSCYLGK-CDCIDGYEGTDCSKSVCPVLCS 327
           N  +KT +  +  K  +   + CP GC   G C   + C+C DG+ G  C K++C   C 
Sbjct: 131 NTILKTPQNAIFFKTCQ--QAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCM 188
Query: 328 NHGK-YGGGICHCENGWKGPECD-------------------------IPASDCQYSD-- 359
           N G     G C C  G+ G  CD                         +    C+ S   
Sbjct: 189 NGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCP 248
Query: 360 --CSGHGSCV-EGTCHCQSGWKGIGCQEAGCPNACNRHGTCAFENEEYQCVCAEGWAGVD 416
             C   G C+ +  C C  G++G  C +  C   C  HGTC   +E  +C C EGW G  
Sbjct: 249 QPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTC---HEPNKCQCQEGWHGRH 305
Query: 417 CNIKLEMS 424
           CN + E S
Sbjct: 306 CNKRYEAS 313
>pdb|2YGQ|A Chain A, Wif Domain-Epidermal Growth Factor (Egf)-Like Domains 1-3 Of Human Wnt Inhibitory Factor 1 In Complex With 1,2-Dipalmitoylphosphatidylcholine Length = 324 Back     alignment and structure
>pdb|2VJ2|A Chain A, Human Jagged-1, Domains Dsl And Egfs1-3 Length = 169 Back     alignment and structure
>pdb|3K6S|B Chain B, Structure Of Integrin Alphaxbeta2 Ectodomain Length = 687 Back     alignment and structure
>pdb|1JV2|B Chain B, Crystal Structure Of The Extracellular Segment Of Integrin Alphavbeta3 Length = 692 Back     alignment and structure
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure
>pdb|3IJE|B Chain B, Crystal Structure Of The Complete Integrin Alhavbeta3 Ectodomain Plus An Alpha/beta Transmembrane Fragment Length = 695 Back     alignment and structure
>pdb|4G1M|B Chain B, Re-Refinement Of Alpha V Beta 3 Structure Length = 692 Back     alignment and structure
>pdb|3FCS|B Chain B, Structure Of Complete Ectodomain Of Integrin Aiibb3 Length = 690 Back     alignment and structure
>pdb|4G1E|B Chain B, Crystal Structure Of Integrin Alpha V Beta 3 With Coil-Coiled Tag Length = 738 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query514
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 1e-33
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 8e-23
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 1e-15
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 6e-05
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 1e-30
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 4e-19
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 2e-13
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 2e-27
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 1e-25
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 2e-17
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 3e-10
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 6e-26
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 8e-23
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-18
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 5e-13
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 8e-20
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 5e-07
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 4e-18
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 6e-17
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 3e-09
2uvo_A171 Agglutinin isolectin 1; carbohydrate-binding prote 5e-14
2uvo_A171 Agglutinin isolectin 1; carbohydrate-binding prote 5e-10
2uvo_A171 Agglutinin isolectin 1; carbohydrate-binding prote 2e-05
2vh0_B134 Activated factor XA light chain; serine protease, 2e-13
2vh0_B134 Activated factor XA light chain; serine protease, 2e-10
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 2e-13
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 1e-11
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 6e-06
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 6e-13
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 5e-12
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 3e-07
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 5e-12
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 2e-10
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 3e-05
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 1e-10
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 7e-09
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 8e-09
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 3e-10
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 2e-06
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 5e-10
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 4e-06
1aut_L114 Activated protein C; serine proteinase, plasma cal 6e-10
1aut_L114 Activated protein C; serine proteinase, plasma cal 2e-06
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 2e-09
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 4e-09
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 1e-08
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 9e-06
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 2e-08
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 4e-07
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 5e-07
2ddu_A387 Reelin; beta-jelly-roll, signaling protein; 2.05A 7e-07
2ddu_A387 Reelin; beta-jelly-roll, signaling protein; 2.05A 1e-04
2ddu_A387 Reelin; beta-jelly-roll, signaling protein; 2.05A 4e-04
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 2e-06
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 5e-06
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 2e-04
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 5e-04
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 2e-06
1ulk_A126 Lectin-C; chitin-binding protein, hevein domain, P 3e-06
1ulk_A126 Lectin-C; chitin-binding protein, hevein domain, P 2e-04
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 4e-06
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 7e-04
3g5c_A510 ADAM 22; alpha/beta fold, cross-linked domain, cel 9e-06
3g5c_A510 ADAM 22; alpha/beta fold, cross-linked domain, cel 1e-05
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 7e-05
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 2e-04
3v4v_B503 Integrin beta-7; cell adhesion, madcam-1, membrane 2e-04
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 2e-04
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 4e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 6e-04
2oo4_A234 Notch 2, neurogenic locus notch homolog protein 2, 8e-04
3i08_A220 Neurogenic locus notch homolog protein 1; SEA doma 8e-04
3t3p_B472 Integrin beta-3; integrin, cell adhesion, blood cl 9e-04
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
 Score =  128 bits (324), Expect = 1e-33
 Identities = 48/140 (34%), Positives = 63/140 (45%), Gaps = 9/140 (6%)

Query: 291 CPNGCSGHGSCY-LGKCDCIDGYEGTDCSKSVCPVLCSNHGK-YGGGICHCENGWKGPEC 348
           C   C   G C   G C C  G+ G +C K+ C   C N G  +  G C C  G +G +C
Sbjct: 183 CTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQC 242

Query: 349 DIPASDCQYSDCSGHGSCV-EGTCHCQSGWKGIGCQEAGCPNACNRHGTCAFENEEYQCV 407
           +I    C    C   G C+ +  C C  G++G  C +  C   C  HGTC   +E  +C 
Sbjct: 243 EIS--KCP-QPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTC---HEPNKCQ 296

Query: 408 CAEGWAGVDCNIKLEMSCND 427
           C EGW G  CN + E S   
Sbjct: 297 CQEGWHGRHCNKRYEASLIG 316
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Length = 217 Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Length = 217 Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Length = 217 Back     alignment and structure
>2uvo_A Agglutinin isolectin 1; carbohydrate-binding protein, hevein domain, chitin-binding, GERM agglutinin, chitin-binding protein; HET: NDG NAG GOL; 1.40A {Triticum aestivum} PDB: 1wgc_A* 2cwg_A* 2uwg_A* 2x3t_A* 4aml_A* 7wga_A 9wga_A 2wgc_A 1wgt_A 1k7t_A* 1k7v_A* 1k7u_A 2uwz_A* 2x52_A* 1t0w_A* Length = 171 Back     alignment and structure
>2uvo_A Agglutinin isolectin 1; carbohydrate-binding protein, hevein domain, chitin-binding, GERM agglutinin, chitin-binding protein; HET: NDG NAG GOL; 1.40A {Triticum aestivum} PDB: 1wgc_A* 2cwg_A* 2uwg_A* 2x3t_A* 4aml_A* 7wga_A 9wga_A 2wgc_A 1wgt_A 1k7t_A* 1k7v_A* 1k7u_A 2uwz_A* 2x52_A* 1t0w_A* Length = 171 Back     alignment and structure
>2uvo_A Agglutinin isolectin 1; carbohydrate-binding protein, hevein domain, chitin-binding, GERM agglutinin, chitin-binding protein; HET: NDG NAG GOL; 1.40A {Triticum aestivum} PDB: 1wgc_A* 2cwg_A* 2uwg_A* 2x3t_A* 4aml_A* 7wga_A 9wga_A 2wgc_A 1wgt_A 1k7t_A* 1k7v_A* 1k7u_A 2uwz_A* 2x52_A* 1t0w_A* Length = 171 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Length = 725 Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Length = 725 Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Length = 725 Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Length = 280 Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Length = 280 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Length = 188 Back     alignment and structure
>2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} Length = 387 Back     alignment and structure
>2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} Length = 387 Back     alignment and structure
>2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} Length = 387 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>1ulk_A Lectin-C; chitin-binding protein, hevein domain, PL-C, sugar binding protein; 1.80A {Phytolacca americana} SCOP: g.3.1.1 g.3.1.1 g.3.1.1 Length = 126 Back     alignment and structure
>1ulk_A Lectin-C; chitin-binding protein, hevein domain, PL-C, sugar binding protein; 1.80A {Phytolacca americana} SCOP: g.3.1.1 g.3.1.1 g.3.1.1 Length = 126 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, cell adhesion, cleavag of basic residues, EGF-like domain, glycoprotein, membrane, phosphoprotein; HET: NAG; 2.36A {Homo sapiens} Length = 510 Back     alignment and structure
>3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, cell adhesion, cleavag of basic residues, EGF-like domain, glycoprotein, membrane, phosphoprotein; HET: NAG; 2.36A {Homo sapiens} Length = 510 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B* Length = 503 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>2oo4_A Notch 2, neurogenic locus notch homolog protein 2, HN2, notch2, NOTC2; alpha-beta-sandwich, SEA domain, LNR, LIN12 notch repeat, CY rich, HD domain; 2.00A {Homo sapiens} Length = 234 Back     alignment and structure
>3i08_A Neurogenic locus notch homolog protein 1; SEA domain, LIN-12 notch repeat, LNR, heterodimerization domain, HD, activator, ANK repeat, calcium; 3.20A {Homo sapiens} Length = 220 Back     alignment and structure
>3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* Length = 472 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query514
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.8
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.79
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.73
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.69
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.62
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.59
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.58
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.57
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.48
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.46
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.43
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 99.4
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 99.36
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 99.35
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.35
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.32
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.28
2bou_A143 EGF-like module containing mucin-like hormone rece 99.26
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.21
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.14
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 99.13
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.1
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.08
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.04
2bou_A143 EGF-like module containing mucin-like hormone rece 98.95
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 98.88
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.83
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 98.81
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.77
2y38_A403 Laminin subunit alpha-5; structural protein, cell 98.72
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.68
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.66
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.62
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.62
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.62
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.61
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.6
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.59
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 98.56
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.54
2vh0_B134 Activated factor XA light chain; serine protease, 98.48
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 98.45
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 98.43
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.42
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 98.38
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.33
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 98.28
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.11
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.09
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.03
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.03
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 97.89
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 97.82
1aut_L114 Activated protein C; serine proteinase, plasma cal 97.81
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 97.78
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 97.76
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 97.74
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.73
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.71
1a3p_A45 Epidermal growth factor; disulfide connectivities, 97.69
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 97.68
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.68
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 97.65
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 97.65
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 97.61
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 97.59
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 97.59
2vh0_B134 Activated factor XA light chain; serine protease, 97.57
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 97.54
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.52
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 97.5
3v65_B 386 Low-density lipoprotein receptor-related protein; 97.49
2k2s_B61 Micronemal protein 6; microneme protein complex, c 97.45
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 97.41
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.34
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.31
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.24
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.22
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 97.15
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.12
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 96.75
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 96.61
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 96.57
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 96.56
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 96.42
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 96.35
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 96.33
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 96.31
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 96.1
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 96.06
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 96.03
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 95.96
3v65_B 386 Low-density lipoprotein receptor-related protein; 95.87
1a3p_A45 Epidermal growth factor; disulfide connectivities, 95.83
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 95.76
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 95.68
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 95.6
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 95.53
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 95.37
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 95.35
2k2s_B61 Micronemal protein 6; microneme protein complex, c 95.22
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 95.11
3t3p_B472 Integrin beta-3; integrin, cell adhesion, blood cl 94.75
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 94.57
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 94.14
2ddu_A387 Reelin; beta-jelly-roll, signaling protein; 2.05A 94.03
2i9a_A145 Urokinase-type plasminogen activator; growth facto 93.94
1nql_B53 Epidermal growth factor; cell surface receptor, ty 93.9
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 93.82
1ob1_C99 Major merozoite surface protein; immune system, im 93.28
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 93.03
2i9a_A145 Urokinase-type plasminogen activator; growth facto 92.6
2y38_A403 Laminin subunit alpha-5; structural protein, cell 92.48
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 92.09
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 92.08
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 92.05
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 91.58
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 91.49
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 91.13
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 91.0
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 90.38
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 88.3
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 88.01
3v4v_B503 Integrin beta-7; cell adhesion, madcam-1, membrane 87.99
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 86.59
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 86.42
2ddu_A387 Reelin; beta-jelly-roll, signaling protein; 2.05A 84.93
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 83.98
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 83.6
1szb_A170 Mannose binding lectin-associated serine protease- 83.39
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 82.82
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 81.4
2wph_E59 Coagulation factor IXA light chain; serine proteas 81.12
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 81.04
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 80.78
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 80.49
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 80.47
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
Probab=99.80  E-value=5.7e-20  Score=188.58  Aligned_cols=158  Identities=31%  Similarity=0.826  Sum_probs=83.7

Q ss_pred             cCCCCCCCCCCcEEe-CCeEecCCCCcCCCCCCCCCCCCCCCCCeec-CceeecCCCCCCCCCCCCCCCCCCCCCCCCce
Q psy12789        288 SSTCPNGCSGHGSCY-LGKCDCIDGYEGTDCSKSVCPVLCSNHGKYG-GGICHCENGWKGPECDIPASDCQYSDCSGHGS  365 (514)
Q Consensus       288 ~~~Cp~~C~~~G~C~-~g~C~C~~Gf~G~~Ce~~~C~~~C~~~G~c~-~~~C~C~~G~~G~~Ce~~i~eC~~~~C~~~G~  365 (514)
                      ...|++.|.++|.|. .+.|.|.+||+|..|+...|...|.++|.|. .+.|.|.+||.|..|+.  ..|. .+|.++|+
T Consensus       148 ~~~C~~~C~~~G~C~~~~~C~C~~G~~G~~C~~~~C~~~C~~~G~C~~~~~C~C~~G~~G~~C~~--~~C~-~~C~~~G~  224 (324)
T 2ygq_A          148 QAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDK--ANCS-TTCFNGGT  224 (324)
T ss_dssp             CCCCSSCCCSSCEECTTSCEECCTTEESSSSCEESSSSCCCTTCEECSSCCEECCTTCBTTTTCB--CCCS-SCCCSSCC
T ss_pred             CCCCCCCCCCCCEECCCCeEECCCCCcCCCCCCCCCCCCCCCCCEEcCCCEEeCCCCccCCCccc--CcCC-CCCCCCCe
Confidence            468999999999998 4899999999999999888988999999995 58999999999999975  3574 68999999


Q ss_pred             eeC-CceecCCCCCccccCCCCCCCCCCCCCeeeccCCceeeecCCCcccCCCCccccCCCCCCCCCCCCCCCCCCCCCC
Q psy12789        366 CVE-GTCHCQSGWKGIGCQEAGCPNACNRHGTCAFENEEYQCVCAEGWAGVDCNIKLEMSCNDDTDNDKDGVTDCSDSDC  444 (514)
Q Consensus       366 C~~-~~C~C~~Gy~G~~C~~~~C~~~C~~~G~C~~~~Gsy~C~C~~Gy~G~~Ce~~~~~~C~d~~~~d~~g~~eC~d~~C  444 (514)
                      |+. +.|.|++||+|..|+++.|..+|.++|+|..   .+.|.|++||+|..|+..                 .|. .+|
T Consensus       225 C~~~~~C~C~~G~~G~~C~~~~C~~~C~~~g~C~~---~~~C~C~~G~~G~~C~~~-----------------~C~-~~C  283 (324)
T 2ygq_A          225 CFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIG---KSKCKCSKGYQGDLCSKP-----------------VCE-PGC  283 (324)
T ss_dssp             BSCSSCBCCCTTCCTTTTC-------------------------------------------------------------
T ss_pred             eCCCCeeeCCCCccCCCCCcCcCCCcCCCCCEECC---CCEEECCCCCcCCCCcCC-----------------CCC-CCC
Confidence            986 6999999999999999999999999999984   469999999999999843                 343 457


Q ss_pred             CCCCeEecCCCceeecCCCCceeeccc
Q psy12789        445 CSQPVCSDQPHIMCLASNDPVEVLLRK  471 (514)
Q Consensus       445 ~~~~~C~n~~g~~C~~~~~p~~~~l~~  471 (514)
                      ..+++|.+  ...|.+..+........
T Consensus       284 ~~~g~C~~--~~~C~C~~G~~G~~C~~  308 (324)
T 2ygq_A          284 GAHGTCHE--PNKCQCQEGWHGRHCNK  308 (324)
T ss_dssp             ---------------------------
T ss_pred             CCCCEECC--CCEeECCCCCcCCCCCC
Confidence            78888887  45677777766555543
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3t3p_B Integrin beta-3; integrin, cell adhesion, blood clotting, fibrinogen, platele; HET: NAG BMA MAN; 2.20A {Homo sapiens} PDB: 3t3m_B* 3nig_B* 3nif_B* 3nid_B* 2vdr_B* 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>3v4v_B Integrin beta-7; cell adhesion, madcam-1, membrane; HET: NAG BMA MAN 0DU; 3.10A {Homo sapiens} PDB: 3v4p_B* Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 514
d1l3ya_41 g.3.11.6 (A:) Integrin beta EGF-like domains {Huma 2e-06
d1l3ya_41 g.3.11.6 (A:) Integrin beta EGF-like domains {Huma 8e-04
d1l3ya_41 g.3.11.6 (A:) Integrin beta EGF-like domains {Huma 0.001
d1jv2b543 g.3.11.6 (B:563-605) Integrin beta EGF-like domain 3e-04
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 0.004
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 0.004
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: Integrin beta EGF-like domains
domain: Integrin beta EGF-like domains
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 42.1 bits (99), Expect = 2e-06
 Identities = 14/40 (35%), Positives = 17/40 (42%), Gaps = 3/40 (7%)

Query: 347 ECDI---PASDCQYSDCSGHGSCVEGTCHCQSGWKGIGCQ 383
           ECD       + Q     G G C  G C C  G++G  CQ
Sbjct: 1   ECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQ 40
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query514
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.37
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.37
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.34
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.28
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.24
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.2
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.08
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.01
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.88
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.87
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.74
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.71
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 97.7
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.67
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 97.54
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.5
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.49
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 97.33
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.3
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.07
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.01
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 96.98
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 96.93
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 96.9
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.84
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 96.82
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 96.82
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.8
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 96.79
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 96.69
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 96.57
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 96.42
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 96.13
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.12
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 96.11
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 96.0
d1i0ua241 Low density lipoprotein (LDL) receptor, different 95.88
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 95.72
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 95.58
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 95.5
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 95.47
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 95.41
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 95.34
d1nt0a345 Mannose-binding protein associated serine protease 95.04
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 94.99
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 94.99
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 94.9
d1szba245 Mannose-binding protein associated serine protease 94.62
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 94.58
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 94.57
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 94.55
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 94.11
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 93.96
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 93.54
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 91.67
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 88.37
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 88.12
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 87.68
d3bpse140 Low density lipoprotein (LDL) receptor, different 86.95
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 86.67
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 86.55
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 86.13
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 85.81
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 85.72
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 83.58
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 82.96
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 80.63
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Neurogenic locus notch homolog protein 1, Notch1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.37  E-value=1.2e-07  Score=66.34  Aligned_cols=36  Identities=31%  Similarity=0.895  Sum_probs=32.5

Q ss_pred             CCCC---CCCCCCCCeeeccCCceeeecCCCcccCCCCc
Q psy12789        384 EAGC---PNACNRHGTCAFENEEYQCVCAEGWAGVDCNI  419 (514)
Q Consensus       384 ~~~C---~~~C~~~G~C~~~~Gsy~C~C~~Gy~G~~Ce~  419 (514)
                      +++|   +++|.++|+|++..++|+|.|++||+|..|++
T Consensus         3 ideC~~~~~pC~n~g~C~n~~g~y~C~C~~G~~G~~Ce~   41 (42)
T d2vj3a1           3 VDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEI   41 (42)
T ss_dssp             CCTTTSSSCSSSTTCEEEECSSSEEEECCTTEESTTSCE
T ss_pred             CccccCCCCCCCCCcEeECCCCCEEeECCCCCcCCCCcC
Confidence            5677   37899999999999999999999999999985
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure