Psyllid ID: psy12820
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 156 | ||||||
| 242003780 | 1274 | 1-phosphatidylinositol-4,5-bisphosphate | 0.903 | 0.110 | 0.680 | 3e-54 | |
| 345494221 | 1222 | PREDICTED: 1-phosphatidylinositol-4,5-bi | 0.878 | 0.112 | 0.686 | 1e-53 | |
| 328782009 | 1129 | PREDICTED: 1-phosphatidylinositol-4,5-bi | 0.878 | 0.121 | 0.649 | 2e-52 | |
| 380028245 | 1184 | PREDICTED: 1-phosphatidylinositol-4,5-bi | 0.878 | 0.115 | 0.649 | 4e-52 | |
| 340709574 | 1192 | PREDICTED: LOW QUALITY PROTEIN: 1-phosph | 0.878 | 0.114 | 0.627 | 2e-51 | |
| 307167498 | 978 | 1-phosphatidylinositol-4,5-bisphosphate | 0.878 | 0.140 | 0.642 | 2e-51 | |
| 307197544 | 614 | 1-phosphatidylinositol-4,5-bisphosphate | 0.878 | 0.223 | 0.627 | 3e-51 | |
| 350401088 | 1192 | PREDICTED: 1-phosphatidylinositol-4,5-bi | 0.878 | 0.114 | 0.620 | 4e-51 | |
| 332027167 | 855 | 1-phosphatidylinositol-4,5-bisphosphate | 0.878 | 0.160 | 0.642 | 6e-51 | |
| 322794696 | 435 | hypothetical protein SINV_08111 [Solenop | 0.878 | 0.314 | 0.635 | 9e-51 |
| >gi|242003780|ref|XP_002422857.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative [Pediculus humanus corporis] gi|212505739|gb|EEB10119.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 216 bits (550), Expect = 3e-54, Method: Compositional matrix adjust.
Identities = 96/141 (68%), Positives = 117/141 (82%)
Query: 14 NKAMQVNHAKFRMNGGCGYLLRPAFMFSESYDPYDPTSLVGVTRVKVLLRVLAARHLTRS 73
+KAMQ+N +KF +NGGCGY+LRP FMF + +D YD +LVGV + + +RV+ ARHLTR+
Sbjct: 1072 DKAMQINQSKFSLNGGCGYILRPDFMFRDDFDMYDHHTLVGVDPMNISIRVIGARHLTRT 1131
Query: 74 GRCTTSPFVEVEVLGADYDTGLKLTTKTVSDNGFNPTWNESCEFTVHNPEMALLRFVCQD 133
GR TTSPFVEVE++GAD+D+G+KLTTKT+SDNGFNP WNE C+F V+NP ALLRFV QD
Sbjct: 1132 GRGTTSPFVEVEIIGADFDSGVKLTTKTISDNGFNPFWNEICDFDVYNPHFALLRFVVQD 1191
Query: 134 EDMFGDSNFIGQATYPVYTNR 154
EDMFGDSNFIGQ TYPV R
Sbjct: 1192 EDMFGDSNFIGQCTYPVTAIR 1212
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|345494221|ref|XP_003427251.1| PREDICTED: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|328782009|ref|XP_624101.3| PREDICTED: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380028245|ref|XP_003697817.1| PREDICTED: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|340709574|ref|XP_003393380.1| PREDICTED: LOW QUALITY PROTEIN: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|307167498|gb|EFN61071.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307197544|gb|EFN78774.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|350401088|ref|XP_003486046.1| PREDICTED: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|332027167|gb|EGI67260.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|322794696|gb|EFZ17669.1| hypothetical protein SINV_08111 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 156 | ||||||
| FB|FBgn0003416 | 1236 | sl "small wing" [Drosophila me | 0.858 | 0.108 | 0.562 | 1.6e-37 | |
| UNIPROTKB|F1PS03 | 1218 | PLCG1 "Uncharacterized protein | 0.871 | 0.111 | 0.492 | 5e-31 | |
| UNIPROTKB|F1MYF9 | 1219 | PLCG1 "1-phosphatidylinositol | 0.871 | 0.111 | 0.492 | 5e-31 | |
| UNIPROTKB|P08487 | 1291 | PLCG1 "1-phosphatidylinositol | 0.871 | 0.105 | 0.492 | 5.5e-31 | |
| UNIPROTKB|F1SDV6 | 1301 | PLCG1 "Uncharacterized protein | 0.871 | 0.104 | 0.492 | 7.1e-31 | |
| RGD|3347 | 1290 | Plcg1 "phospholipase C, gamma | 0.871 | 0.105 | 0.492 | 1.5e-30 | |
| UNIPROTKB|P10686 | 1290 | Plcg1 "1-phosphatidylinositol | 0.871 | 0.105 | 0.492 | 1.5e-30 | |
| MGI|MGI:97615 | 1302 | Plcg1 "phospholipase C, gamma | 0.871 | 0.104 | 0.492 | 1.5e-30 | |
| UNIPROTKB|F1NHI1 | 1148 | PLCG1 "Uncharacterized protein | 0.871 | 0.118 | 0.5 | 2.5e-30 | |
| UNIPROTKB|F1NN68 | 1219 | PLCG1 "Uncharacterized protein | 0.871 | 0.111 | 0.5 | 2.8e-30 |
| FB|FBgn0003416 sl "small wing" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 415 (151.1 bits), Expect = 1.6e-37, P = 1.6e-37
Identities = 77/137 (56%), Positives = 107/137 (78%)
Query: 14 NKAMQVNHAKFRMNGGCGYLLRPAFMFSESYDPYDPTSLVGVTRVKVLLRVLAARHLTRS 73
+KAMQ+N AKFR NG CGY+L+P+FM S+S++P +P G++ VKV +R++AARHL R
Sbjct: 1066 DKAMQLNQAKFRNNGQCGYILKPSFMKSDSFNPNNPLC-DGLSEVKVSIRLIAARHLFRG 1124
Query: 74 GRCTTSPFVEVEVLGADYDTGLKLTTKTVSDNGFNPTWNESCEFTVHNPEMALLRFVCQD 133
G+ + +P + VE++GA +DTG+K TK V++NGFNP WNESCEF V NP+ A+LRF QD
Sbjct: 1125 GK-SNNPQIVVELIGASFDTGVKYRTK-VNENGFNPVWNESCEFNVRNPQFAILRFEVQD 1182
Query: 134 EDMFGDSNFIGQATYPV 150
EDMF +++FI QA YP+
Sbjct: 1183 EDMFAETHFIAQACYPL 1199
|
|
| UNIPROTKB|F1PS03 PLCG1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MYF9 PLCG1 "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P08487 PLCG1 "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SDV6 PLCG1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|3347 Plcg1 "phospholipase C, gamma 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P10686 Plcg1 "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:97615 Plcg1 "phospholipase C, gamma 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NHI1 PLCG1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NN68 PLCG1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 156 | |||
| cd00275 | 128 | cd00275, C2_PLC_like, C2 domain present in Phospho | 3e-37 | |
| smart00239 | 101 | smart00239, C2, Protein kinase C conserved region | 8e-19 | |
| pfam00168 | 85 | pfam00168, C2, C2 domain | 1e-18 | |
| PLN02952 | 599 | PLN02952, PLN02952, phosphoinositide phospholipase | 4e-16 | |
| cd00030 | 102 | cd00030, C2, C2 domain | 5e-15 | |
| PLN02222 | 581 | PLN02222, PLN02222, phosphoinositide phospholipase | 8e-14 | |
| PLN02230 | 598 | PLN02230, PLN02230, phosphoinositide phospholipase | 1e-11 | |
| PLN02223 | 537 | PLN02223, PLN02223, phosphoinositide phospholipase | 3e-11 | |
| cd04024 | 128 | cd04024, C2A_Synaptotagmin-like, C2 domain first r | 7e-11 | |
| PLN02228 | 567 | PLN02228, PLN02228, Phosphoinositide phospholipase | 3e-09 | |
| smart00149 | 115 | smart00149, PLCYc, Phospholipase C, catalytic doma | 4e-09 | |
| pfam00387 | 117 | pfam00387, PI-PLC-Y, Phosphatidylinositol-specific | 5e-09 | |
| cd04040 | 115 | cd04040, C2D_Tricalbin-like, C2 domain fourth repe | 2e-07 | |
| cd04025 | 123 | cd04025, C2B_RasA1_RasA4, C2 domain second repeat | 4e-07 | |
| cd04022 | 127 | cd04022, C2A_MCTP_PRT_plant, C2 domain first repea | 4e-07 | |
| cd04038 | 145 | cd04038, C2_ArfGAP, C2 domain present in Arf GTPas | 1e-06 | |
| cd04049 | 124 | cd04049, C2_putative_Elicitor-responsive_gene, C2 | 6e-06 | |
| cd08391 | 121 | cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir | 8e-06 | |
| cd00276 | 134 | cd00276, C2B_Synaptotagmin, C2 domain second repea | 9e-06 | |
| cd08375 | 136 | cd08375, C2_Intersectin, C2 domain present in Inte | 2e-05 | |
| cd08682 | 126 | cd08682, C2_Rab11-FIP_classI, C2 domain found in R | 4e-05 | |
| cd04036 | 119 | cd04036, C2_cPLA2, C2 domain present in cytosolic | 1e-04 | |
| cd08390 | 123 | cd08390, C2A_Synaptotagmin-15-17, C2A domain first | 2e-04 | |
| cd04044 | 124 | cd04044, C2A_Tricalbin-like, C2 domain first repea | 5e-04 | |
| cd04052 | 111 | cd04052, C2B_Tricalbin-like, C2 domain second repe | 6e-04 | |
| cd04009 | 133 | cd04009, C2B_Munc13-like, C2 domain second repeat | 0.001 | |
| cd08386 | 125 | cd08386, C2A_Synaptotagmin-7, C2A domain first rep | 0.002 | |
| cd08395 | 120 | cd08395, C2C_Munc13, C2 domain third repeat in Mun | 0.003 | |
| cd04043 | 126 | cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma | 0.003 | |
| cd04027 | 127 | cd04027, C2B_Munc13, C2 domain second repeat in Mu | 0.004 |
| >gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in Phosphoinositide-specific phospholipases C (PLC) | Back alignment and domain information |
|---|
Score = 123 bits (312), Expect = 3e-37
Identities = 40/96 (41%), Positives = 57/96 (59%), Gaps = 4/96 (4%)
Query: 58 VKVLLRVLAARHLTRSGRCTTS---PFVEVEVLGADYDTGLKLTTKTVSDNGFNPTWNES 114
+ + +++++ + L + S P+VEVE+ G D K TK V +NGFNP WNE+
Sbjct: 2 LTLTIKIISGQQLPKPKGDKGSIVDPYVEVEIHGLPADDSAKFKTKVVKNNGFNPVWNET 61
Query: 115 CEFTVHNPEMALLRFVCQDEDMFGDSNFIGQATYPV 150
EF V PE+A LRFV DED D +F+GQA P+
Sbjct: 62 FEFDVTVPELAFLRFVVYDEDSGDD-DFLGQACLPL 96
|
PLCs are involved in the hydrolysis of phosphatidylinositol-4,5-bisphosphate (PIP2) to d-myo-inositol-1,4,5-trisphosphate (1,4,5-IP3) and sn-1,2-diacylglycerol (DAG). 1,4,5-IP3 and DAG are second messengers in eukaryotic signal transduction cascades. PLC is composed of a N-terminal PH domain followed by a series of EF hands, a catalytic TIM barrel and a C-terminal C2 domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. Members here have a type-II topology. Length = 128 |
| >gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >gnl|CDD|215765 pfam00168, C2, C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|178538 PLN02952, PLN02952, phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >gnl|CDD|175973 cd00030, C2, C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|177868 PLN02222, PLN02222, phosphoinositide phospholipase C 2 | Back alignment and domain information |
|---|
| >gnl|CDD|177875 PLN02230, PLN02230, phosphoinositide phospholipase C 4 | Back alignment and domain information |
|---|
| >gnl|CDD|165867 PLN02223, PLN02223, phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >gnl|CDD|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|177873 PLN02228, PLN02228, Phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >gnl|CDD|128454 smart00149, PLCYc, Phospholipase C, catalytic domain (part); domain Y | Back alignment and domain information |
|---|
| >gnl|CDD|215891 pfam00387, PI-PLC-Y, Phosphatidylinositol-specific phospholipase C, Y domain | Back alignment and domain information |
|---|
| >gnl|CDD|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >gnl|CDD|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP) | Back alignment and domain information |
|---|
| >gnl|CDD|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene | Back alignment and domain information |
|---|
| >gnl|CDD|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >gnl|CDD|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family interacting proteins (FIP) class I | Back alignment and domain information |
|---|
| >gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) | Back alignment and domain information |
|---|
| >gnl|CDD|176036 cd08390, C2A_Synaptotagmin-15-17, C2A domain first repeat present in Synaptotagmins 15 and 17 | Back alignment and domain information |
|---|
| >gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176017 cd04052, C2B_Tricalbin-like, C2 domain second repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >gnl|CDD|176041 cd08395, C2C_Munc13, C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group | Back alignment and domain information |
|---|
| >gnl|CDD|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 156 | |||
| PLN02223 | 537 | phosphoinositide phospholipase C | 100.0 | |
| KOG0169|consensus | 746 | 100.0 | ||
| PLN02230 | 598 | phosphoinositide phospholipase C 4 | 100.0 | |
| PLN02222 | 581 | phosphoinositide phospholipase C 2 | 100.0 | |
| KOG1264|consensus | 1267 | 100.0 | ||
| PLN02952 | 599 | phosphoinositide phospholipase C | 100.0 | |
| PLN02228 | 567 | Phosphoinositide phospholipase C | 100.0 | |
| KOG1265|consensus | 1189 | 100.0 | ||
| cd08395 | 120 | C2C_Munc13 C2 domain third repeat in Munc13 (mamma | 99.91 | |
| cd08677 | 118 | C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a | 99.89 | |
| cd08381 | 122 | C2B_PI3K_class_II C2 domain second repeat present | 99.88 | |
| cd04029 | 125 | C2A_SLP-4_5 C2 domain first repeat present in Syna | 99.86 | |
| cd08392 | 128 | C2A_SLP-3 C2 domain first repeat present in Synapt | 99.86 | |
| cd08393 | 125 | C2A_SLP-1_2 C2 domain first repeat present in Syna | 99.86 | |
| cd04028 | 146 | C2B_RIM1alpha C2 domain second repeat contained in | 99.85 | |
| cd08680 | 124 | C2_Kibra C2 domain found in Human protein Kibra. K | 99.85 | |
| cd08692 | 135 | C2B_Tac2-N C2 domain second repeat found in Tac2-N | 99.85 | |
| cd04016 | 121 | C2_Tollip C2 domain present in Toll-interacting pr | 99.85 | |
| cd08407 | 138 | C2B_Synaptotagmin-13 C2 domain second repeat prese | 99.84 | |
| cd08406 | 136 | C2B_Synaptotagmin-12 C2 domain second repeat prese | 99.84 | |
| cd04010 | 148 | C2B_RasA3 C2 domain second repeat present in RAS p | 99.84 | |
| cd08682 | 126 | C2_Rab11-FIP_classI C2 domain found in Rab11-famil | 99.84 | |
| cd04039 | 108 | C2_PSD C2 domain present in Phosphatidylserine dec | 99.84 | |
| cd08685 | 119 | C2_RGS-like C2 domain of the Regulator Of G-Protei | 99.84 | |
| cd04041 | 111 | C2A_fungal C2 domain first repeat; fungal group. C | 99.83 | |
| KOG1030|consensus | 168 | 99.83 | ||
| cd08388 | 128 | C2A_Synaptotagmin-4-11 C2A domain first repeat pre | 99.82 | |
| cd04036 | 119 | C2_cPLA2 C2 domain present in cytosolic PhosphoLip | 99.82 | |
| cd08408 | 138 | C2B_Synaptotagmin-14_16 C2 domain second repeat pr | 99.82 | |
| cd08375 | 136 | C2_Intersectin C2 domain present in Intersectin. A | 99.82 | |
| cd08385 | 124 | C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe | 99.82 | |
| cd00275 | 128 | C2_PLC_like C2 domain present in Phosphoinositide- | 99.81 | |
| cd08681 | 118 | C2_fungal_Inn1p-like C2 domain found in fungal Ing | 99.81 | |
| cd04031 | 125 | C2A_RIM1alpha C2 domain first repeat contained in | 99.81 | |
| cd08379 | 126 | C2D_MCTP_PRT_plant C2 domain fourth repeat found i | 99.81 | |
| cd04018 | 151 | C2C_Ferlin C2 domain third repeat in Ferlin. Ferli | 99.81 | |
| cd08384 | 133 | C2B_Rabphilin_Doc2 C2 domain second repeat present | 99.81 | |
| cd04030 | 127 | C2C_KIAA1228 C2 domain third repeat present in unc | 99.81 | |
| cd04009 | 133 | C2B_Munc13-like C2 domain second repeat in Munc13 | 99.81 | |
| cd04022 | 127 | C2A_MCTP_PRT_plant C2 domain first repeat found in | 99.81 | |
| cd04032 | 127 | C2_Perforin C2 domain of Perforin. Perforin contai | 99.81 | |
| cd08688 | 110 | C2_KIAA0528-like C2 domain found in the Human KIAA | 99.81 | |
| cd04025 | 123 | C2B_RasA1_RasA4 C2 domain second repeat present in | 99.81 | |
| cd04019 | 150 | C2C_MCTP_PRT_plant C2 domain third repeat found in | 99.8 | |
| cd08387 | 124 | C2A_Synaptotagmin-8 C2A domain first repeat presen | 99.8 | |
| cd04020 | 162 | C2B_SLP_1-2-3-4 C2 domain second repeat present in | 99.8 | |
| cd08521 | 123 | C2A_SLP C2 domain first repeat present in Synaptot | 99.8 | |
| cd04042 | 121 | C2A_MCTP_PRT C2 domain first repeat found in Multi | 99.8 | |
| cd08376 | 116 | C2B_MCTP_PRT C2 domain second repeat found in Mult | 99.8 | |
| cd08404 | 136 | C2B_Synaptotagmin-4 C2 domain second repeat presen | 99.79 | |
| cd08678 | 126 | C2_C21orf25-like C2 domain found in the Human chro | 99.79 | |
| cd08402 | 136 | C2B_Synaptotagmin-1 C2 domain second repeat presen | 99.79 | |
| cd04037 | 124 | C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli | 99.79 | |
| cd04050 | 105 | C2B_Synaptotagmin-like C2 domain second repeat pre | 99.79 | |
| cd04033 | 133 | C2_NEDD4_NEDD4L C2 domain present in the Human neu | 99.79 | |
| cd04038 | 145 | C2_ArfGAP C2 domain present in Arf GTPase Activati | 99.79 | |
| cd08410 | 135 | C2B_Synaptotagmin-17 C2 domain second repeat prese | 99.78 | |
| cd08386 | 125 | C2A_Synaptotagmin-7 C2A domain first repeat presen | 99.78 | |
| cd08405 | 136 | C2B_Synaptotagmin-7 C2 domain second repeat presen | 99.78 | |
| cd08409 | 137 | C2B_Synaptotagmin-15 C2 domain second repeat prese | 99.78 | |
| cd08400 | 126 | C2_Ras_p21A1 C2 domain present in RAS p21 protein | 99.78 | |
| cd08389 | 124 | C2A_Synaptotagmin-14_16 C2A domain first repeat pr | 99.78 | |
| cd08378 | 121 | C2B_MCTP_PRT_plant C2 domain second repeat found i | 99.78 | |
| cd04011 | 111 | C2B_Ferlin C2 domain second repeat in Ferlin. Ferl | 99.78 | |
| cd08390 | 123 | C2A_Synaptotagmin-15-17 C2A domain first repeat pr | 99.77 | |
| cd08403 | 134 | C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe | 99.77 | |
| cd04043 | 126 | C2_Munc13_fungal C2 domain in Munc13 (mammalian un | 99.77 | |
| cd08401 | 121 | C2A_RasA2_RasA3 C2 domain first repeat present in | 99.77 | |
| cd04051 | 125 | C2_SRC2_like C2 domain present in Soybean genes Re | 99.76 | |
| cd04035 | 123 | C2A_Rabphilin_Doc2 C2 domain first repeat present | 99.76 | |
| cd04026 | 131 | C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( | 99.76 | |
| cd04024 | 128 | C2A_Synaptotagmin-like C2 domain first repeat pres | 99.76 | |
| cd08382 | 123 | C2_Smurf-like C2 domain present in Smad ubiquitina | 99.76 | |
| cd04048 | 120 | C2A_Copine C2 domain first repeat in Copine. There | 99.76 | |
| cd04049 | 124 | C2_putative_Elicitor-responsive_gene C2 domain pre | 99.75 | |
| cd08394 | 127 | C2A_Munc13 C2 domain first repeat in Munc13 (mamma | 99.75 | |
| cd04054 | 121 | C2A_Rasal1_RasA4 C2 domain first repeat present in | 99.75 | |
| cd08686 | 118 | C2_ABR C2 domain in the Active BCR (Breakpoint clu | 99.75 | |
| cd08377 | 119 | C2C_MCTP_PRT C2 domain third repeat found in Multi | 99.74 | |
| cd04040 | 115 | C2D_Tricalbin-like C2 domain fourth repeat present | 99.74 | |
| cd04017 | 135 | C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl | 99.74 | |
| cd08391 | 121 | C2A_C2C_Synaptotagmin_like C2 domain first and thi | 99.74 | |
| cd08675 | 137 | C2B_RasGAP C2 domain second repeat of Ras GTPase a | 99.74 | |
| KOG0696|consensus | 683 | 99.74 | ||
| cd00276 | 134 | C2B_Synaptotagmin C2 domain second repeat present | 99.74 | |
| cd04044 | 124 | C2A_Tricalbin-like C2 domain first repeat present | 99.74 | |
| cd04014 | 132 | C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) | 99.74 | |
| cd04045 | 120 | C2C_Tricalbin-like C2 domain third repeat present | 99.73 | |
| cd04027 | 127 | C2B_Munc13 C2 domain second repeat in Munc13 (mamm | 99.73 | |
| cd04046 | 126 | C2_Calpain C2 domain present in Calpain proteins. | 99.72 | |
| cd04015 | 158 | C2_plant_PLD C2 domain present in plant phospholip | 99.72 | |
| cd08676 | 153 | C2A_Munc13-like C2 domain first repeat in Munc13 ( | 99.72 | |
| cd08373 | 127 | C2A_Ferlin C2 domain first repeat in Ferlin. Ferli | 99.72 | |
| cd08691 | 137 | C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li | 99.72 | |
| cd08690 | 155 | C2_Freud-1 C2 domain found in 5' repressor element | 99.7 | |
| cd04021 | 125 | C2_E3_ubiquitin_ligase C2 domain present in E3 ubi | 99.69 | |
| cd04047 | 110 | C2B_Copine C2 domain second repeat in Copine. Ther | 99.68 | |
| PF00168 | 85 | C2: C2 domain; InterPro: IPR000008 The C2 domain i | 99.67 | |
| KOG1028|consensus | 421 | 99.67 | ||
| cd08374 | 133 | C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli | 99.56 | |
| cd04052 | 111 | C2B_Tricalbin-like C2 domain second repeat present | 99.54 | |
| smart00239 | 101 | C2 Protein kinase C conserved region 2 (CalB). Ca2 | 99.53 | |
| PF00387 | 118 | PI-PLC-Y: Phosphatidylinositol-specific phospholip | 99.53 | |
| cd08383 | 117 | C2A_RasGAP C2 domain (first repeat) of Ras GTPase | 99.53 | |
| KOG1028|consensus | 421 | 99.52 | ||
| cd04013 | 146 | C2_SynGAP_like C2 domain present in Ras GTPase act | 99.51 | |
| PLN03008 | 868 | Phospholipase D delta | 99.5 | |
| KOG1011|consensus | 1283 | 99.48 | ||
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 99.47 | |
| smart00149 | 115 | PLCYc Phospholipase C, catalytic domain (part); do | 99.46 | |
| cd00030 | 102 | C2 C2 domain. The C2 domain was first identified i | 99.42 | |
| COG5038 | 1227 | Ca2+-dependent lipid-binding protein, contains C2 | 99.33 | |
| KOG1328|consensus | 1103 | 99.2 | ||
| PLN02270 | 808 | phospholipase D alpha | 99.04 | |
| KOG1011|consensus | 1283 | 99.01 | ||
| COG5038 | 1227 | Ca2+-dependent lipid-binding protein, contains C2 | 99.01 | |
| cd08689 | 109 | C2_fungal_Pkc1p C2 domain found in protein kinase | 98.98 | |
| KOG2059|consensus | 800 | 98.93 | ||
| KOG1031|consensus | 1169 | 98.77 | ||
| KOG0905|consensus | 1639 | 98.63 | ||
| KOG1013|consensus | 362 | 98.56 | ||
| KOG1326|consensus | 1105 | 98.53 | ||
| KOG2059|consensus | 800 | 98.5 | ||
| cd08684 | 103 | C2A_Tac2-N C2 domain first repeat found in Tac2-N | 98.3 | |
| KOG1328|consensus | 1103 | 98.29 | ||
| cd08683 | 143 | C2_C2cd3 C2 domain found in C2 calcium-dependent d | 98.2 | |
| PLN02352 | 758 | phospholipase D epsilon | 98.19 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 98.01 | |
| KOG1013|consensus | 362 | 98.01 | ||
| cd08693 | 173 | C2_PI3K_class_I_beta_delta C2 domain present in cl | 97.88 | |
| cd08380 | 156 | C2_PI3K_like C2 domain present in phosphatidylinos | 97.86 | |
| cd08398 | 158 | C2_PI3K_class_I_alpha C2 domain present in class I | 97.82 | |
| KOG1327|consensus | 529 | 97.73 | ||
| KOG1326|consensus | 1105 | 97.57 | ||
| cd08397 | 159 | C2_PI3K_class_III C2 domain present in class III p | 97.55 | |
| KOG2060|consensus | 405 | 97.53 | ||
| cd08399 | 178 | C2_PI3K_class_I_gamma C2 domain present in class I | 97.34 | |
| cd04012 | 171 | C2A_PI3K_class_II C2 domain first repeat present i | 97.32 | |
| PF00792 | 142 | PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I | 97.0 | |
| KOG3837|consensus | 523 | 96.8 | ||
| cd08695 | 189 | C2_Dock-B C2 domains found in Dedicator Of CytoKin | 96.66 | |
| PF14429 | 184 | DOCK-C2: C2 domain in Dock180 and Zizimin proteins | 96.53 | |
| cd08694 | 196 | C2_Dock-A C2 domains found in Dedicator Of CytoKin | 96.24 | |
| smart00142 | 100 | PI3K_C2 Phosphoinositide 3-kinase, region postulat | 96.09 | |
| PF15627 | 156 | CEP76-C2: CEP76 C2 domain | 95.8 | |
| PF10358 | 143 | NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; | 95.03 | |
| KOG1327|consensus | 529 | 94.54 | ||
| KOG1452|consensus | 442 | 93.93 | ||
| cd08679 | 178 | C2_DOCK180_related C2 domains found in Dedicator O | 92.8 | |
| cd08696 | 179 | C2_Dock-C C2 domains found in Dedicator Of CytoKin | 92.26 | |
| PF15625 | 168 | CC2D2AN-C2: CC2D2A N-terminal C2 domain | 91.54 | |
| cd08697 | 185 | C2_Dock-D C2 domains found in Dedicator Of CytoKin | 90.19 | |
| PF12416 | 340 | DUF3668: Cep120 protein; InterPro: IPR022136 This | 86.04 | |
| KOG0904|consensus | 1076 | 85.72 |
| >PLN02223 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.1e-45 Score=288.65 Aligned_cols=147 Identities=24% Similarity=0.462 Sum_probs=129.2
Q ss_pred ceeeeecCcccCChhhhccccccccCCceeEEecCCcccCC----CCCCCCCCCCCceeeEEEEEEEeeeeecccC----
Q psy12820 2 LREFTYNRQSVINKAMQVNHAKFRMNGGCGYLLRPAFMFSE----SYDPYDPTSLVGVTRVKVLLRVLAARHLTRS---- 73 (156)
Q Consensus 2 ~~~valN~q~t~d~~m~~n~~~F~~ng~~GyvlKP~~l~~~----~~~p~~~~~~~~~~~~~L~v~v~~a~~L~~~---- 73 (156)
-|||||||| |.|.+||||+|||+.||+|||||||++||+. .|+|... ...+..|+|+|++|++++..
T Consensus 354 cQmVALN~Q-T~d~~M~LN~G~F~~NG~CGYVLKP~~Lr~~~~~~~FdP~~~----~~~~~~L~V~Visgq~~~~~~~k~ 428 (537)
T PLN02223 354 AQLIALSRK-DDKEKLWLMQGMFRANGGCGYVKKPDFLLNAGPSGVFYPTEN----PVVVKILKVKIYMGDGWIVDFKKR 428 (537)
T ss_pred eeEeeeccC-CCChhHHhhcchhccCCCCCceECChhhccCCcccccCCCCC----cccceEEEEEEEEcccccCCcccc
Confidence 499999999 9999999999999999999999999999985 4777532 23467899999999987521
Q ss_pred -C-CCCCCCEEEEEEecCCCCCCceEEeEEecCCCCCCeeCceEEEEEeCCCccEEEEEEEecCCCCCCceEEEEEEECC
Q psy12820 74 -G-RCTTSPFVEVEVLGADYDTGLKLTTKTVSDNGFNPTWNESCEFTVHNPEMALLRFVCQDEDMFGDSNFIGQATYPVY 151 (156)
Q Consensus 74 -~-~~~~dpyv~v~l~~~~~~~~~~~kT~~~~~~~~nP~w~e~f~f~v~~~~~~~l~~~V~d~~~~~~~~~iG~~~i~l~ 151 (156)
+ .+..||||+|++.|.+.|.. +++|+ +.+||+||+|||+|.|.+..|+++.|+|.|+|+|..+.++|+|++++|+.
T Consensus 429 ~~~~s~~DpyV~VeI~Gvp~D~~-~~kT~-v~nNg~nPvWne~F~F~i~~PELAlLrf~V~D~D~~~~ddfiGQ~~LPv~ 506 (537)
T PLN02223 429 IGRLSKPDLYVRISIAGVPHDEK-IMKTT-VKNNEWKPTWGEEFTFPLTYPDLALISFEVYDYEVSTADAFCGQTCLPVS 506 (537)
T ss_pred cCCCCCCCeEEEEEEeeccCCcc-eeEEE-eCCCCcCceecceeEEEEEccCceEEEEEEEecCCCCCCcEEEEEecchH
Confidence 1 35679999999999998887 77786 66778999999999999999999999999999998888999999999999
Q ss_pred CCCC
Q psy12820 152 TNRF 155 (156)
Q Consensus 152 ~l~~ 155 (156)
+||+
T Consensus 507 ~Lr~ 510 (537)
T PLN02223 507 ELIE 510 (537)
T ss_pred HhcC
Confidence 9986
|
|
| >KOG0169|consensus | Back alignment and domain information |
|---|
| >PLN02230 phosphoinositide phospholipase C 4 | Back alignment and domain information |
|---|
| >PLN02222 phosphoinositide phospholipase C 2 | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >PLN02952 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >PLN02228 Phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >KOG1265|consensus | Back alignment and domain information |
|---|
| >cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd08677 C2A_Synaptotagmin-13 C2 domain | Back alignment and domain information |
|---|
| >cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 | Back alignment and domain information |
|---|
| >cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 | Back alignment and domain information |
|---|
| >cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 | Back alignment and domain information |
|---|
| >cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd08680 C2_Kibra C2 domain found in Human protein Kibra | Back alignment and domain information |
|---|
| >cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) | Back alignment and domain information |
|---|
| >cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 | Back alignment and domain information |
|---|
| >cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 | Back alignment and domain information |
|---|
| >cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) | Back alignment and domain information |
|---|
| >cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I | Back alignment and domain information |
|---|
| >cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) | Back alignment and domain information |
|---|
| >cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family | Back alignment and domain information |
|---|
| >cd04041 C2A_fungal C2 domain first repeat; fungal group | Back alignment and domain information |
|---|
| >KOG1030|consensus | Back alignment and domain information |
|---|
| >cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 | Back alignment and domain information |
|---|
| >cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) | Back alignment and domain information |
|---|
| >cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd08375 C2_Intersectin C2 domain present in Intersectin | Back alignment and domain information |
|---|
| >cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) | Back alignment and domain information |
|---|
| >cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins | Back alignment and domain information |
|---|
| >cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04018 C2C_Ferlin C2 domain third repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins | Back alignment and domain information |
|---|
| >cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04032 C2_Perforin C2 domain of Perforin | Back alignment and domain information |
|---|
| >cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone | Back alignment and domain information |
|---|
| >cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 | Back alignment and domain information |
|---|
| >cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 | Back alignment and domain information |
|---|
| >cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 | Back alignment and domain information |
|---|
| >cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein | Back alignment and domain information |
|---|
| >cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 | Back alignment and domain information |
|---|
| >cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) | Back alignment and domain information |
|---|
| >cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) | Back alignment and domain information |
|---|
| >cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 | Back alignment and domain information |
|---|
| >cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 | Back alignment and domain information |
|---|
| >cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) | Back alignment and domain information |
|---|
| >cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04011 C2B_Ferlin C2 domain second repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 | Back alignment and domain information |
|---|
| >cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group | Back alignment and domain information |
|---|
| >cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 | Back alignment and domain information |
|---|
| >cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins | Back alignment and domain information |
|---|
| >cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma | Back alignment and domain information |
|---|
| >cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins | Back alignment and domain information |
|---|
| >cd04048 C2A_Copine C2 domain first repeat in Copine | Back alignment and domain information |
|---|
| >cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene | Back alignment and domain information |
|---|
| >cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein | Back alignment and domain information |
|---|
| >cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >KOG0696|consensus | Back alignment and domain information |
|---|
| >cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon | Back alignment and domain information |
|---|
| >cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd04046 C2_Calpain C2 domain present in Calpain proteins | Back alignment and domain information |
|---|
| >cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) | Back alignment and domain information |
|---|
| >cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd08373 C2A_Ferlin C2 domain first repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) | Back alignment and domain information |
|---|
| >cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) | Back alignment and domain information |
|---|
| >cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase | Back alignment and domain information |
|---|
| >cd04047 C2B_Copine C2 domain second repeat in Copine | Back alignment and domain information |
|---|
| >PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking | Back alignment and domain information |
|---|
| >KOG1028|consensus | Back alignment and domain information |
|---|
| >cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >smart00239 C2 Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >PF00387 PI-PLC-Y: Phosphatidylinositol-specific phospholipase C, Y domain This entry is for the whole phospholipase C protein; InterPro: IPR001711 Phosphatidylinositol-specific phospholipase C (3 | Back alignment and domain information |
|---|
| >cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >KOG1028|consensus | Back alignment and domain information |
|---|
| >cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family | Back alignment and domain information |
|---|
| >PLN03008 Phospholipase D delta | Back alignment and domain information |
|---|
| >KOG1011|consensus | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >smart00149 PLCYc Phospholipase C, catalytic domain (part); domain Y | Back alignment and domain information |
|---|
| >cd00030 C2 C2 domain | Back alignment and domain information |
|---|
| >COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1328|consensus | Back alignment and domain information |
|---|
| >PLN02270 phospholipase D alpha | Back alignment and domain information |
|---|
| >KOG1011|consensus | Back alignment and domain information |
|---|
| >COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >KOG1031|consensus | Back alignment and domain information |
|---|
| >KOG0905|consensus | Back alignment and domain information |
|---|
| >KOG1013|consensus | Back alignment and domain information |
|---|
| >KOG1326|consensus | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >KOG1328|consensus | Back alignment and domain information |
|---|
| >cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins | Back alignment and domain information |
|---|
| >PLN02352 phospholipase D epsilon | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >KOG1013|consensus | Back alignment and domain information |
|---|
| >cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >KOG1327|consensus | Back alignment and domain information |
|---|
| >KOG1326|consensus | Back alignment and domain information |
|---|
| >cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >KOG2060|consensus | Back alignment and domain information |
|---|
| >cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 | Back alignment and domain information |
|---|
| >KOG3837|consensus | Back alignment and domain information |
|---|
| >cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins | Back alignment and domain information |
|---|
| >PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A | Back alignment and domain information |
|---|
| >cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins | Back alignment and domain information |
|---|
| >smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain | Back alignment and domain information |
|---|
| >PF15627 CEP76-C2: CEP76 C2 domain | Back alignment and domain information |
|---|
| >PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] | Back alignment and domain information |
|---|
| >KOG1327|consensus | Back alignment and domain information |
|---|
| >KOG1452|consensus | Back alignment and domain information |
|---|
| >cd08679 C2_DOCK180_related C2 domains found in Dedicator Of CytoKinesis 1 (DOCK 180) and related proteins | Back alignment and domain information |
|---|
| >cd08696 C2_Dock-C C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins | Back alignment and domain information |
|---|
| >PF15625 CC2D2AN-C2: CC2D2A N-terminal C2 domain | Back alignment and domain information |
|---|
| >cd08697 C2_Dock-D C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins | Back alignment and domain information |
|---|
| >PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length | Back alignment and domain information |
|---|
| >KOG0904|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 156 | ||||
| 1djg_A | 624 | Phosphoinositide-Specific Phospholipase C-Delta1 Fr | 2e-17 | ||
| 1qas_A | 622 | 1-Phosphatidylinositol-4,5-Bisphosphate Phosphodies | 2e-17 | ||
| 3qr1_A | 813 | Crystal Structure Of L. Pealei Plc21 Length = 813 | 6e-13 | ||
| 3qr0_A | 816 | Crystal Structure Of S. Officinalis Plc21 Length = | 9e-13 | ||
| 4gnk_B | 1235 | Crystal Structure Of Galphaq In Complex With Full-l | 2e-12 | ||
| 3ohm_B | 885 | Crystal Structure Of Activated G Alpha Q Bound To I | 2e-12 | ||
| 2fju_B | 799 | Activated Rac1 Bound To Its Effector Phospholipase | 6e-08 | ||
| 3b7y_A | 153 | Crystal Structure Of The C2 Domain Of The E3 Ubiqui | 3e-05 | ||
| 3jzy_A | 510 | Crystal Structure Of Human Intersectin 2 C2 Domain | 9e-05 | ||
| 2chd_A | 142 | Crystal Structure Of The C2a Domain Of Rabphilin-3a | 1e-04 | ||
| 2k3h_A | 140 | Structural Determinants For Ca2+ And Pip2 Binding B | 1e-04 | ||
| 2nsq_A | 155 | Crystal Structure Of The C2 Domain Of The Human E3 | 2e-04 |
| >pdb|1DJG|A Chain A, Phosphoinositide-Specific Phospholipase C-Delta1 From Rat Complexed With Lanthanum Length = 624 | Back alignment and structure |
|
| >pdb|1QAS|A Chain A, 1-Phosphatidylinositol-4,5-Bisphosphate Phosphodiesterase Delta 1 Length = 622 | Back alignment and structure |
| >pdb|3QR1|A Chain A, Crystal Structure Of L. Pealei Plc21 Length = 813 | Back alignment and structure |
| >pdb|3QR0|A Chain A, Crystal Structure Of S. Officinalis Plc21 Length = 816 | Back alignment and structure |
| >pdb|4GNK|B Chain B, Crystal Structure Of Galphaq In Complex With Full-length Human Plcbeta3 Length = 1235 | Back alignment and structure |
| >pdb|3OHM|B Chain B, Crystal Structure Of Activated G Alpha Q Bound To Its Effector Phospholipase C Beta 3 Length = 885 | Back alignment and structure |
| >pdb|2FJU|B Chain B, Activated Rac1 Bound To Its Effector Phospholipase C Beta 2 Length = 799 | Back alignment and structure |
| >pdb|3B7Y|A Chain A, Crystal Structure Of The C2 Domain Of The E3 Ubiquitin- Protein Ligase Nedd4 Length = 153 | Back alignment and structure |
| >pdb|3JZY|A Chain A, Crystal Structure Of Human Intersectin 2 C2 Domain Length = 510 | Back alignment and structure |
| >pdb|2CHD|A Chain A, Crystal Structure Of The C2a Domain Of Rabphilin-3a Length = 142 | Back alignment and structure |
| >pdb|2K3H|A Chain A, Structural Determinants For Ca2+ And Pip2 Binding By The C2a Domain Of Rabphilin-3a Length = 140 | Back alignment and structure |
| >pdb|2NSQ|A Chain A, Crystal Structure Of The C2 Domain Of The Human E3 Ubiquitin-Protein Ligase Nedd4-Like Protein Length = 155 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 156 | |||
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 5e-38 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 3e-33 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 1e-32 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 3e-30 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 2e-16 | |
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 3e-16 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 5e-16 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 2e-15 | |
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 1e-14 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 2e-13 | |
| 3pyc_A | 132 | E3 ubiquitin-protein ligase smurf1; phospholipid b | 4e-12 | |
| 2nq3_A | 173 | Itchy homolog E3 ubiquitin protein ligase; C2 doma | 5e-12 | |
| 3kwu_A | 148 | MUNC13-1; calcium binding protein, phospholipid bi | 2e-11 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 3e-11 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 3e-11 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 2e-10 | |
| 2z0u_A | 155 | WW domain-containing protein 1; C2 domain, alterna | 2e-10 | |
| 1cjy_A | 749 | CPLA2, protein (cytosolic phospholipase A2); lipid | 2e-10 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 3e-10 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 2e-07 | |
| 2q3x_A | 171 | Regulating synaptic membrane exocytosis protein 1; | 3e-10 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 4e-10 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 7e-10 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 8e-10 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 5e-07 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 2e-09 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 3e-09 | |
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 9e-09 | |
| 2dmg_A | 142 | KIAA1228 protein; beta-sandwich, structural genomi | 2e-08 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 2e-08 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 2e-08 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 4e-08 | |
| 1rh8_A | 142 | Piccolo protein; beta-sandwich, metal binding prot | 2e-07 | |
| 3fbk_A | 153 | RGS3, RGP3, regulator of G-protein signaling 3; al | 2e-07 | |
| 1tjx_A | 159 | Similar to synaptotagmini/P65; C2B domain, calcium | 5e-07 | |
| 2b3r_A | 134 | Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA | 6e-07 | |
| 3nsj_A | 540 | Perforin-1; pore forming protein, immune system; H | 2e-06 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 2e-06 | |
| 2cjt_A | 131 | UNC-13 homolog A, MUNC13-1; phorbol-ester binding, | 3e-06 | |
| 1w15_A | 153 | Synaptotagmin IV; metal binding protein, endocytos | 6e-06 | |
| 2bwq_A | 129 | Regulating synaptic membrane exocytosis protein 2; | 1e-05 | |
| 3n5a_A | 138 | Synaptotagmin-7; calcium/phospholipid binding prot | 1e-05 | |
| 1v27_A | 141 | Regulating synaptic membrane exocytosis protein 2; | 2e-05 | |
| 2cm5_A | 166 | Rabphilin-3A; protein transport, zinc-finger, Ca2+ | 8e-05 | |
| 2cjs_A | 167 | UNC-13 homolog A, MUNC13-1; neurotransmitter trans | 9e-05 |
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 | Back alignment and structure |
|---|
Score = 135 bits (340), Expect = 5e-38
Identities = 48/142 (33%), Positives = 76/142 (53%), Gaps = 6/142 (4%)
Query: 14 NKAMQVNHAKFRMNGGCGYLLRPAFMFSESY--DPYDPTSLVGVTRVKVLLRVLAARHLT 71
M V F+ NGGCGY+L+PAF+ + + T ++ +R+++ + L
Sbjct: 451 GPEMDVYLGCFQDNGGCGYVLKPAFLRDPNTTFNSRALTQGPWWRPERLRVRIISGQQLP 510
Query: 72 RSGRCTTS---PFVEVEVLGADYDTGLKLTTKTVSDNGFNPTWNESCEFTVHNPEMALLR 128
+ + S P V VE+ G DTG T +++NGFNP W+ EF V P++AL+R
Sbjct: 511 KVNKNKNSIVDPKVIVEIHGVGRDTG-SRQTAVITNNGFNPRWDMEFEFEVTVPDLALVR 569
Query: 129 FVCQDEDMFGDSNFIGQATYPV 150
F+ +D D ++FIGQ+T P
Sbjct: 570 FMVEDYDSSSKNDFIGQSTIPW 591
|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Length = 816 | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Length = 885 | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Length = 799 | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 | Back alignment and structure |
|---|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 | Back alignment and structure |
|---|
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 | Back alignment and structure |
|---|
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540 | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 | Back alignment and structure |
|---|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 | Back alignment and structure |
|---|
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 156 | |||
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 100.0 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 100.0 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 100.0 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 100.0 | |
| 2z0u_A | 155 | WW domain-containing protein 1; C2 domain, alterna | 99.85 | |
| 2b3r_A | 134 | Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA | 99.85 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 99.83 | |
| 3fbk_A | 153 | RGS3, RGP3, regulator of G-protein signaling 3; al | 99.83 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 99.83 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 99.82 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 99.82 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 99.82 | |
| 2cm5_A | 166 | Rabphilin-3A; protein transport, zinc-finger, Ca2+ | 99.82 | |
| 3pyc_A | 132 | E3 ubiquitin-protein ligase smurf1; phospholipid b | 99.82 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 99.82 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 99.82 | |
| 3n5a_A | 138 | Synaptotagmin-7; calcium/phospholipid binding prot | 99.82 | |
| 1w15_A | 153 | Synaptotagmin IV; metal binding protein, endocytos | 99.81 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 99.81 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 99.81 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 99.81 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 99.81 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 99.81 | |
| 2bwq_A | 129 | Regulating synaptic membrane exocytosis protein 2; | 99.8 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 99.8 | |
| 1tjx_A | 159 | Similar to synaptotagmini/P65; C2B domain, calcium | 99.8 | |
| 2dmg_A | 142 | KIAA1228 protein; beta-sandwich, structural genomi | 99.8 | |
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 99.8 | |
| 3kwu_A | 148 | MUNC13-1; calcium binding protein, phospholipid bi | 99.8 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 99.8 | |
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 99.8 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 99.8 | |
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 99.8 | |
| 2nq3_A | 173 | Itchy homolog E3 ubiquitin protein ligase; C2 doma | 99.79 | |
| 1v27_A | 141 | Regulating synaptic membrane exocytosis protein 2; | 99.79 | |
| 2q3x_A | 171 | Regulating synaptic membrane exocytosis protein 1; | 99.79 | |
| 2cjt_A | 131 | UNC-13 homolog A, MUNC13-1; phorbol-ester binding, | 99.77 | |
| 1rh8_A | 142 | Piccolo protein; beta-sandwich, metal binding prot | 99.77 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 99.74 | |
| 2cjs_A | 167 | UNC-13 homolog A, MUNC13-1; neurotransmitter trans | 99.72 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 99.72 | |
| 1cjy_A | 749 | CPLA2, protein (cytosolic phospholipase A2); lipid | 99.71 | |
| 3nsj_A | 540 | Perforin-1; pore forming protein, immune system; H | 99.7 | |
| 3l9b_A | 144 | Otoferlin; C2-domain, beta-sheets, cell membrane, | 99.69 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 99.69 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 99.68 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 99.65 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 99.54 | |
| 3bxj_A | 483 | RAS GTPase-activating protein syngap; GTPase activ | 99.41 | |
| 2enj_A | 138 | NPKC-theta, protein kinase C theta type; beta-sand | 98.53 | |
| 1yrk_A | 126 | NPKC-delta, protein kinase C, delta type; C2 domai | 98.52 | |
| 3hhm_A | 1091 | Phosphatidylinositol-4,5-bisphosphate 3-kinase cat | 96.92 | |
| 2wxf_A | 940 | Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca | 96.85 | |
| 3l4c_A | 220 | Dedicator of cytokinesis protein 1; DOCK180, DOCK1 | 96.75 | |
| 1e7u_A | 961 | Phosphatidylinositol 3-kinase catalytic subunit; p | 96.16 | |
| 2y3a_A | 1092 | Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca | 95.34 |
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
Probab=100.00 E-value=4.4e-45 Score=299.74 Aligned_cols=152 Identities=32% Similarity=0.555 Sum_probs=138.3
Q ss_pred ceeeeecCcccCChhhhccccccccCCceeEEecCCcccCC--CCCCCCCCCCCceeeEEEEEEEeeeeecccCC---CC
Q psy12820 2 LREFTYNRQSVINKAMQVNHAKFRMNGGCGYLLRPAFMFSE--SYDPYDPTSLVGVTRVKVLLRVLAARHLTRSG---RC 76 (156)
Q Consensus 2 ~~~valN~q~t~d~~m~~n~~~F~~ng~~GyvlKP~~l~~~--~~~p~~~~~~~~~~~~~L~v~v~~a~~L~~~~---~~ 76 (156)
.|||||||| |+|++||||+|||+.||+|||||||++||.. .|+|......++..+..|+|+|++|++|+..+ .+
T Consensus 440 ~QmvAlN~Q-t~d~~m~ln~g~F~~ng~~GYvlKP~~lr~~~~~f~p~~~~~~~~~~~~~L~V~Vi~A~~L~~~d~~~~~ 518 (624)
T 1djx_A 440 CQIVALNFQ-TPGPEMDVYLGCFQDNGGCGYVLKPAFLRDPNTTFNSRALTQGPWWRPERLRVRIISGQQLPKVNKNKNS 518 (624)
T ss_dssp CCEEEECTT-CCSHHHHHHHHHHHSGGGCSEEECCGGGGCTTCCCCTTSCCSSTTCCCEEEEEEEEEEESCCCCSSCSSS
T ss_pred ceeeeeccc-CCchHHhHHHHHhhcCCCCccEECCHHHcCCCCCcCcccccccCCccceEEEEEEEEcCCCCcccccccC
Confidence 599999999 9999999999999999999999999999987 58887765556677899999999999999876 57
Q ss_pred CCCCEEEEEEecCCCCCCceEEeEEecCCCCCCeeCceEEEEEeCCCccEEEEEEEecCCCCCCceEEEEEEECCCCCC
Q psy12820 77 TTSPFVEVEVLGADYDTGLKLTTKTVSDNGFNPTWNESCEFTVHNPEMALLRFVCQDEDMFGDSNFIGQATYPVYTNRF 155 (156)
Q Consensus 77 ~~dpyv~v~l~~~~~~~~~~~kT~~~~~~~~nP~w~e~f~f~v~~~~~~~l~~~V~d~~~~~~~~~iG~~~i~l~~l~~ 155 (156)
.+||||+|.+.+.+.+.. ++||+++++||+||+|||+|.|.+..++++.|+|.|||+|..+++++||++++||.+|++
T Consensus 519 ~~DPYV~V~l~g~~~d~~-~~kTkvi~~ng~NP~WnE~f~F~v~~~el~~L~~~V~D~D~~~~dd~iG~~~ipl~~L~~ 596 (624)
T 1djx_A 519 IVDPKVIVEIHGVGRDTG-SRQTAVITNNGFNPRWDMEFEFEVTVPDLALVRFMVEDYDSSSKNDFIGQSTIPWNSLKQ 596 (624)
T ss_dssp CCCEEEEEEEESSGGGCE-EEECCCCTTCSSSCEEEEEEEEEESCGGGCEEEEEEEECCSSSCCEEEEEEEEEGGGBCC
T ss_pred CCCcEEEEEEecCCCCcc-eeecccccCCCCCCccCceEEEEEecCCCCEEEEEEEEcCCCCCCceeEEEEEEHHHcCC
Confidence 899999999988665556 889999999889999999999999999889999999999999999999999999999874
|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} | Back alignment and structure |
|---|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A | Back alignment and structure |
|---|
| >3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A | Back alignment and structure |
|---|
| >2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* | Back alignment and structure |
|---|
| >3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} | Back alignment and structure |
|---|
| >2y3a_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit beta isoform; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 156 | ||||
| d1qasa2 | 131 | b.7.1.1 (A:626-756) PI-specific phospholipase C is | 3e-18 | |
| d2zkmx2 | 122 | b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human | 1e-15 | |
| d1w15a_ | 138 | b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi | 6e-12 | |
| d1a25a_ | 132 | b.7.1.2 (A:) C2 domain from protein kinase c (beta | 2e-11 | |
| d2cm5a1 | 137 | b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( | 1e-10 | |
| d2bwqa1 | 125 | b.7.1.2 (A:729-853) Regulating synaptic membrane e | 2e-10 | |
| d1rsya_ | 143 | b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu | 2e-10 | |
| d1rlwa_ | 126 | b.7.1.1 (A:) Domain from cytosolic phospholipase A | 4e-09 | |
| d1uowa_ | 157 | b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu | 6e-09 | |
| d1qasa3 | 327 | c.1.18.1 (A:299-625) Phospholipase C isozyme D1 (P | 2e-08 | |
| d1ugka_ | 138 | b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens | 3e-08 | |
| d1wfja_ | 136 | b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr | 4e-08 | |
| d2zkmx4 | 349 | c.1.18.1 (X:312-660) Phospholipase C-beta-2 {Human | 9e-08 | |
| d1dqva1 | 130 | b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus | 3e-07 | |
| d1wfma_ | 138 | b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie | 7e-07 | |
| d2cjta1 | 128 | b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no | 4e-06 | |
| d2nq3a1 | 133 | b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc | 6e-06 | |
| d2ep6a1 | 126 | b.7.1.1 (A:92-217) Multiple C2 and transmembrane d | 1e-04 | |
| d1bdya_ | 123 | b.7.1.1 (A:) Domain from protein kinase C delta {R | 6e-04 | |
| d1gmia_ | 136 | b.7.1.1 (A:) Domain from protein kinase C epsilon | 0.001 |
| >d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 | Back information, alignment and structure |
|---|
class: All beta proteins fold: C2 domain-like superfamily: C2 domain (Calcium/lipid-binding domain, CaLB) family: PLC-like (P variant) domain: PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 73.6 bits (180), Expect = 3e-18
Identities = 34/100 (34%), Positives = 58/100 (58%), Gaps = 4/100 (4%)
Query: 58 VKVLLRVLAARHLTRSGRCTTS---PFVEVEVLGADYDTGLKLTTKTVSDNGFNPTWNES 114
++ +R+++ + L + + S P V VE+ G DTG T +++NGFNP W+
Sbjct: 4 ERLRVRIISGQQLPKVNKNKNSIVDPKVIVEIHGVGRDTG-SRQTAVITNNGFNPRWDME 62
Query: 115 CEFTVHNPEMALLRFVCQDEDMFGDSNFIGQATYPVYTNR 154
EF V P++AL+RF+ +D D ++FIGQ+T P + +
Sbjct: 63 FEFEVTVPDLALVRFMVEDYDSSSKNDFIGQSTIPWNSLK 102
|
| >d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 | Back information, alignment and structure |
|---|
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 | Back information, alignment and structure |
|---|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 | Back information, alignment and structure |
|---|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 | Back information, alignment and structure |
|---|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 | Back information, alignment and structure |
|---|
| >d1qasa3 c.1.18.1 (A:299-625) Phospholipase C isozyme D1 (PLC-D1) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 327 | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 | Back information, alignment and structure |
|---|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 | Back information, alignment and structure |
|---|
| >d2zkmx4 c.1.18.1 (X:312-660) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 349 | Back information, alignment and structure |
|---|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 | Back information, alignment and structure |
|---|
| >d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123 | Back information, alignment and structure |
|---|
| >d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 156 | |||
| d1qasa2 | 131 | PI-specific phospholipase C isozyme D1 (PLC-D1), C | 99.92 | |
| d2zkmx2 | 122 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 99.87 | |
| d1a25a_ | 132 | C2 domain from protein kinase c (beta) {Rat (Rattu | 99.85 | |
| d2ep6a1 | 126 | Multiple C2 and transmembrane domain-containing pr | 99.82 | |
| d1rlwa_ | 126 | Domain from cytosolic phospholipase A2 {Human (Hom | 99.82 | |
| d1wfja_ | 136 | C2 domain protein At1g63220 {Thale cress (Arabidop | 99.81 | |
| d1dqva1 | 130 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 99.8 | |
| d2cm5a1 | 137 | C2b-domain of rabphilin {Rat (Rattus norvegicus) [ | 99.8 | |
| d2nq3a1 | 133 | E3 ubiquitin-protein ligase Itchy {Human (Homo sap | 99.79 | |
| d1rsya_ | 143 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 99.79 | |
| d1w15a_ | 138 | Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: | 99.78 | |
| d1ugka_ | 138 | Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 | 99.78 | |
| d1uowa_ | 157 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 99.77 | |
| d2bwqa1 | 125 | Regulating synaptic membrane exocytosis protein, r | 99.77 | |
| d1wfma_ | 138 | Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 | 99.76 | |
| d1gmia_ | 136 | Domain from protein kinase C epsilon {Rat (Rattus | 99.75 | |
| d1rh8a_ | 142 | Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.74 | |
| d1qasa3 | 327 | Phospholipase C isozyme D1 (PLC-D1) {Rat (Rattus n | 99.73 | |
| d1dqva2 | 145 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 99.72 | |
| d2cjta1 | 128 | Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: | 99.69 | |
| d1bdya_ | 123 | Domain from protein kinase C delta {Rat (Rattus no | 99.51 | |
| d1e7ua2 | 174 | Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) | 97.57 |
| >d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: C2 domain-like superfamily: C2 domain (Calcium/lipid-binding domain, CaLB) family: PLC-like (P variant) domain: PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.92 E-value=8.1e-25 Score=145.69 Aligned_cols=99 Identities=33% Similarity=0.618 Sum_probs=85.9
Q ss_pred eeEEEEEEEeeeeecccCC---CCCCCCEEEEEEecCCCCCCceEEeEEecCCCCCCeeCceEEEEEeCCCccEEEEEEE
Q psy12820 56 TRVKVLLRVLAARHLTRSG---RCTTSPFVEVEVLGADYDTGLKLTTKTVSDNGFNPTWNESCEFTVHNPEMALLRFVCQ 132 (156)
Q Consensus 56 ~~~~L~v~v~~a~~L~~~~---~~~~dpyv~v~l~~~~~~~~~~~kT~~~~~~~~nP~w~e~f~f~v~~~~~~~l~~~V~ 132 (156)
.+.+|+|+|++|++|+..+ .+.+||||++++.+...+.. +++|++++++++||.|||+|.|.+..++.+.|+|+||
T Consensus 2 ~p~~l~V~Vi~a~~L~~~~~~~~~~~DPyV~v~l~g~~~~~~-~~~T~~v~~~~~nP~wne~f~f~~~~~~~~~L~~~V~ 80 (131)
T d1qasa2 2 RPERLRVRIISGQQLPKVNKNKNSIVDPKVIVEIHGVGRDTG-SRQTAVITNNGFNPRWDMEFEFEVTVPDLALVRFMVE 80 (131)
T ss_dssp CCEEEEEEEEEEESCCCCC-----CCCEEEEEEEESSTTTCE-EEECCCCSSCSSSCEEEEEEEEEESCGGGCEEEEEEE
T ss_pred CcEEEEEEEEEeeCCCCCCCCCCCCcCeEEEEEEccCCCCcE-EEEEEEEecccCCceEEEEEEEEEEcchhceEEEEEE
Confidence 3578999999999997543 56789999999987765566 8899998888789999999999998888889999999
Q ss_pred ecCCCCCCceEEEEEEECCCCCC
Q psy12820 133 DEDMFGDSNFIGQATYPVYTNRF 155 (156)
Q Consensus 133 d~~~~~~~~~iG~~~i~l~~l~~ 155 (156)
|+|..+++++||++.+||+++++
T Consensus 81 D~d~~~~d~~iG~~~i~l~~l~~ 103 (131)
T d1qasa2 81 DYDSSSKNDFIGQSTIPWNSLKQ 103 (131)
T ss_dssp ECCTTTCCEEEEEEEEEGGGBCC
T ss_pred EecCCCCCcEEEEEEEEEeccCC
Confidence 99999999999999999998864
|
| >d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qasa3 c.1.18.1 (A:299-625) Phospholipase C isozyme D1 (PLC-D1) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|