Psyllid ID: psy12892


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-----
IWELLSTQTAEQLKATTINGDTALHLAARKRDLDMVRILVDYGTSVDIQNGEGQTALHIASAEGDEALVKYFYGAKANASITDHQGIQRDIAAAGTSVLANCLLMGEGQTALHIASAEGDEALVKYFYGAKANASITDHQDRTPMHLAAENGHASIIELLADKFRASIFERTKENYNVLHLAAMYSREDVVKLLLNKKGIENYNVLHLAAMYSREDVVKLLLNKKGINVAALGGEDLTGRPDLTVGPVQAYLYQVYLISKQQTAVHLVCSRQTGTATSILRALLSTAGREIRMTVDGTLILYYRGKDSKAQIEEL
cEEEcHHccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHcccHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHHHccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHcccccccccccccHHHHHHHHccccccEEc
cHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHccccEEEEEccccccHHHHHHHHccHHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccHHHHHHHcccHHHHHHHHHccccHHHHHHcccccHHHHHHHHHHccccccccccccccHHHHHHHccccEEEEc
IWELLSTQTAEQLKATTINGDTALHLAARKRDLDMVRILVDYGtsvdiqngegqtALHIASAEGDEALVKYFYGakanasitdhqgIQRDIAAAGTSVLANCLLMGEGQTALHIASAEGDEALVKYFYGakanasitdhqdrtpmhlaAENGHASIIELLADKFRASIFERTKENYNVLHLAAMYSREDVVKLLLNKKGIENYNVLHLAAMYSREDVVKLLLNKKginvaalggedltgrpdltvgpvQAYLYQVYLISKQQTAVHLVCSRQTGTATSILRALLSTAGREIRMTVDGTLILYYRGKDSKAQIEEL
IWELLSTQTAEQLkattingdtalHLAARKRDLDMVRILVDYGTSVDIQNGEGQTALHIASAEGDEALVKYFYGAKANASITDHQGIQRDIAAAGTSVLANCLLMGEGQTALHIASAEGDEALVKYFYGAKANASITDHQDRTPMHLAAENGHASIIELLADKFRASIFERTKENYNVLHLAAMYSREDVVKLLLNKKGIENYNVLHLAAMYSREDVVKLLLNKKGINVAalggedltgrpDLTVGPVQAYLYQVYLISKQQTAVHLVCSRQTGTATSILRALlstagreirmtvDGTLILyyrgkdskaqieel
IWELLSTQTAEQLKATTINGDTALHLAARKRDLDMVRILVDYGTSVDIQNGEGQTALHIASAEGDEALVKYFYGAKANASITDHQGIQRDIAAAGTSVLANCLLMGEGQTALHIASAEGDEALVKYFYGAKANASITDHQDRTPMHLAAENGHASIIELLADKFRASIFERTKENYNVLHLAAMYSREDVVKLLLNKKGIENYNVLHLAAMYSREDVVKLLLNKKGINVAALGGEDLTGRPDLTVGPVQAYLYQVYLISKQQTAVHLVCSRQTGTATSILRALLSTAGREIRMTVDGTLILYYRGKDSKAQIEEL
**************ATTINGDTALHLAARKRDLDMVRILVDYGTSVDIQNGEGQTALHIASAEGDEALVKYFYGAKANASITDHQGIQRDIAAAGTSVLANCLLMGEGQTALHIASAEGDEALVKYFYGAKANASITDH****PMHLAAENGHASIIELLADKFRASIFERTKENYNVLHLAAMYSREDVVKLLLNKKGIENYNVLHLAAMYSREDVVKLLLNKKGINVAALGGEDLTGRPDLTVGPVQAYLYQVYLISKQQTAVHLVCSRQTGTATSILRALLSTAGREIRMTVDGTLILYYRG**********
IWELLSTQTAEQLKATTINGDTALHLAARKRDLDMVRILVDYGTSVDIQNGEGQTALHIASAEGDEALVKYFYGAKANASITDHQGIQRDIAAAGTSVLANCLLMGEGQTALHIASAEGDEALVKYFYGAKANASITDHQDRTPMHLAAENGHASIIELLADKFRASIFERTKENYNVLHLAAMYSREDVVKLLLNKKGIENYNVLHLAAMYSREDVVKLLLNKKGINVAALGGEDLTGRPDLTVGPVQAYLYQVYLISKQQTAVHLVCSRQTGTATSILRALLSTAGREIRMTVDGTLILYYRGKDSKAQIEEL
IWELLSTQTAEQLKATTINGDTALHLAARKRDLDMVRILVDYGTSVDIQNGEGQTALHIASAEGDEALVKYFYGAKANASITDHQGIQRDIAAAGTSVLANCLLMGEGQTALHIASAEGDEALVKYFYGAKANASITDHQDRTPMHLAAENGHASIIELLADKFRASIFERTKENYNVLHLAAMYSREDVVKLLLNKKGIENYNVLHLAAMYSREDVVKLLLNKKGINVAALGGEDLTGRPDLTVGPVQAYLYQVYLISKQQTAVHLVCSRQTGTATSILRALLSTAGREIRMTVDGTLILYYRGKDSKAQIEEL
IWELLSTQTAEQLKATTINGDTALHLAARKRDLDMVRILVDYGTSVDIQNGEGQTALHIASAEGDEALVKYFYGAKANASITDHQGIQRDIAAAGTSVLANCLLMGEGQTALHIASAEGDEALVKYFYGAKANASITDHQDRTPMHLAAENGHASIIELLADKFRASIFERTKENYNVLHLAAMYSREDVVKLLLNKKGIENYNVLHLAAMYSREDVVKLLLNKKGINVAALGGEDLTGRPDLTVGPVQAYLYQVYLISKQQTAVHLVCSRQTGTATSILRALLSTAGREIRMTVDGTLILYYRGKDSKAQIEEL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IWELLSTQTAEQLKATTINGDTALHLAARKRDLDMVRILVDYGTSVDIQNGEGQTALHIASAEGDEALVKYFYGAKANASITDHQGIQRDIAAAGTSVLANCLLMGEGQTALHIASAEGDEALVKYFYGAKANASITDHQDRTPMHLAAENGHASIIELLADKFRASIFERTKENYNVLHLAAMYSREDVVKLLLNKKGIENYNVLHLAAMYSREDVVKLLLNKKGINVAALGGEDLTGRPDLTVGPVQAYLYQVYLISKQQTAVHLVCSRQTGTATSILRALLSTAGREIRMTVDGTLILYYRGKDSKAQIEEL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query315 2.2.26 [Sep-21-2011]
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus yes N/A 0.663 0.053 0.308 8e-18
Q01484 3957 Ankyrin-2 OS=Homo sapiens yes N/A 0.663 0.052 0.308 1e-17
Q12955 4377 Ankyrin-3 OS=Homo sapiens no N/A 0.698 0.050 0.309 3e-17
P16157 1881 Ankyrin-1 OS=Homo sapiens no N/A 0.634 0.106 0.311 1e-16
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no N/A 0.622 0.099 0.320 2e-16
Q02357 1862 Ankyrin-1 OS=Mus musculus no N/A 0.568 0.096 0.301 5e-16
Q9ERK0786 Receptor-interacting seri no N/A 0.676 0.270 0.304 1e-15
P57078832 Receptor-interacting seri no N/A 0.647 0.245 0.301 8e-15
Q02989 1411 Alpha-latroinsectotoxin-L N/A N/A 0.914 0.204 0.241 2e-14
Q9ULJ7 1429 Ankyrin repeat domain-con no N/A 0.707 0.156 0.3 4e-14
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function desciption
 Score = 91.3 bits (225), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 70/227 (30%), Positives = 103/227 (45%), Gaps = 18/227 (7%)

Query: 15  ATTINGDTALHLAARKRDLDMVRILVDYGTSVDIQNGEGQTALHIASAEGDEALVKYFYG 74
           A  +NG T LH+A +K  + ++ +LV YG S+      G T +H+A+  G   +V     
Sbjct: 393 ARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQ 452

Query: 75  AKANASITDHQG--IQRDIAAAGTSVLANCLLMG---------EGQTALHIASAEGDEAL 123
             A+  +T+ +G       A AG   +  CLL           E QT LHIAS  G   +
Sbjct: 453 NGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEI 512

Query: 124 VKYFYGAKANASITDHQDRTPMHLAAENGHASIIELLADKFRASIFERTKENYNVLHLAA 183
           V+      A+         TP+H++A  G   +  +L +   A     TK+ +  LH+AA
Sbjct: 513 VQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLA-TKKGFTPLHVAA 571

Query: 184 MYSREDVVKLLLNKK------GIENYNVLHLAAMYSREDVVKLLLNK 224
            Y   DV KLLL ++      G      LH+AA Y  + V  LLL K
Sbjct: 572 KYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEK 618




Attaches integral membrane proteins to cytoskeletal elements. Also binds to cytoskeletal proteins. Required for coordinate assembly of Na/Ca exchanger, Na/K ATPase and InsP3 receptor at sarcoplasmic reticulum sites in cardiomyocytes (By similarity). Required for the coordinated expression of the Na/K ATPase, Na/Ca exchanger and beta-2-spectrin (SPTBN1) in the inner segment of rod photoreceptors. Required for expression and targeting of SPTBN1 in neonatal cardiomyocytes and for the regulation of neonatal cardiomyocyte contraction rate.
Mus musculus (taxid: 10090)
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 Back     alignment and function description
>sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 Back     alignment and function description
>sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 Back     alignment and function description
>sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 Back     alignment and function description
>sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query315
380011932 1711 PREDICTED: LOW QUALITY PROTEIN: serine/t 0.520 0.095 0.463 5e-45
270014282 1823 hypothetical protein TcasGA2_TC012313 [T 0.526 0.091 0.471 1e-44
195576738 636 GD23336 [Drosophila simulans] gi|1941902 0.526 0.261 0.462 2e-44
386769136 1732 no mechanoreceptor potential C, isoform 0.526 0.095 0.462 4e-44
45552223 1712 no mechanoreceptor potential C, isoform 0.526 0.096 0.462 4e-44
221472807 1726 no mechanoreceptor potential C, isoform 0.526 0.096 0.462 4e-44
195118072 1761 GI17984 [Drosophila mojavensis] gi|19391 0.526 0.094 0.462 4e-44
195388509 1716 GJ19559 [Drosophila virilis] gi|19414937 0.526 0.096 0.462 4e-44
195473883 1755 GE25396 [Drosophila yakuba] gi|194175322 0.526 0.094 0.462 4e-44
198476772 1756 GA25465 [Drosophila pseudoobscura pseudo 0.526 0.094 0.462 4e-44
>gi|380011932|ref|XP_003690046.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B-like [Apis florea] Back     alignment and taxonomy information
 Score =  187 bits (475), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 107/231 (46%), Positives = 132/231 (57%), Gaps = 67/231 (29%)

Query: 3   ELLSTQTAEQLKATTINGDTALHLAARKRDLDMVRILVDYGTSVDIQNGEGQTALHIASA 62
           ELL+ Q  +QL+ATT  GD+ALHLAAR+RD+DMVRILVDYG                   
Sbjct: 235 ELLAQQAPDQLRATTTTGDSALHLAARRRDIDMVRILVDYG------------------- 275

Query: 63  EGDEALVKYFYGAKANASITDHQGIQRDIAAAGTSVLANCLLMGEGQTALHIASAEGDEA 122
                                           GT  + N    G+GQTALHIASAEGDE 
Sbjct: 276 --------------------------------GTVDMQN----GDGQTALHIASAEGDET 299

Query: 123 LVKYFYGAKANASITDHQDRTPMHLAAENGHASIIELLADKFRASIFERTKENYNVLHLA 182
           LVKYFYG +A+ASITDHQDRTPMHLAAENGHASIIELLADKF+ASIFERTK+   ++H+A
Sbjct: 300 LVKYFYGVRASASITDHQDRTPMHLAAENGHASIIELLADKFKASIFERTKDGSTLMHIA 359

Query: 183 AMYSREDVVKLLL---------NKKGIENYNVLHLAAMYSREDVVKLLLNK 224
           ++    +   +L          NK+G  +   +H AA Y    ++  LL +
Sbjct: 360 SLNGHSECATMLFKKAXYLHMPNKRGARS---IHTAAKYGHVGIISTLLQR 407




Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270014282|gb|EFA10730.1| hypothetical protein TcasGA2_TC012313 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195576738|ref|XP_002078231.1| GD23336 [Drosophila simulans] gi|194190240|gb|EDX03816.1| GD23336 [Drosophila simulans] Back     alignment and taxonomy information
>gi|386769136|ref|NP_001245891.1| no mechanoreceptor potential C, isoform E [Drosophila melanogaster] gi|301344460|gb|ADK73985.1| no mechanoreceptor potential C isoform L [Drosophila melanogaster] gi|383291340|gb|AFH03565.1| no mechanoreceptor potential C, isoform E [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|45552223|ref|NP_995634.1| no mechanoreceptor potential C, isoform B [Drosophila melanogaster] gi|45445013|gb|AAS64642.1| no mechanoreceptor potential C, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|221472807|ref|NP_001097089.2| no mechanoreceptor potential C, isoform D [Drosophila melanogaster] gi|220901951|gb|ABV53627.2| no mechanoreceptor potential C, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195118072|ref|XP_002003564.1| GI17984 [Drosophila mojavensis] gi|193914139|gb|EDW13006.1| GI17984 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195388509|ref|XP_002052922.1| GJ19559 [Drosophila virilis] gi|194149379|gb|EDW65077.1| GJ19559 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195473883|ref|XP_002089221.1| GE25396 [Drosophila yakuba] gi|194175322|gb|EDW88933.1| GE25396 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|198476772|ref|XP_002132444.1| GA25465 [Drosophila pseudoobscura pseudoobscura] gi|198137846|gb|EDY69846.1| GA25465 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query315
FB|FBgn0016920 1726 nompC "no mechanoreceptor pote 0.609 0.111 0.478 2.7e-37
ZFIN|ZDB-GENE-030728-7 1614 trpn1 "transient receptor pote 0.609 0.118 0.368 1.4e-26
ZFIN|ZDB-GENE-091113-6 1923 si:ch211-263m18.3 "si:ch211-26 0.669 0.109 0.336 3.7e-21
ZFIN|ZDB-GENE-060621-1 3980 ank3a "ankyrin 3a" [Danio reri 0.930 0.073 0.297 5.2e-21
ZFIN|ZDB-GENE-081104-19 1929 si:ch211-173b16.3 "si:ch211-17 0.660 0.107 0.328 4.3e-20
FB|FBgn0011747 1549 Ank "Ankyrin" [Drosophila mela 0.692 0.140 0.308 1.1e-19
UNIPROTKB|P16157 1881 ANK1 "Ankyrin-1" [Homo sapiens 0.660 0.110 0.327 1.4e-19
UNIPROTKB|F1MY81 1136 ANK1 "Uncharacterized protein" 0.657 0.182 0.308 8.5e-19
UNIPROTKB|J9NTH2 2063 ANK2 "Uncharacterized protein" 0.704 0.107 0.307 1.4e-18
RGD|620156 843 Ank2 "ankyrin 2, neuronal" [Ra 0.704 0.263 0.330 1.5e-18
FB|FBgn0016920 nompC "no mechanoreceptor potential C" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 415 (151.1 bits), Expect = 2.7e-37, P = 2.7e-37
 Identities = 98/205 (47%), Positives = 122/205 (59%)

Query:     3 ELLSTQTAEQLKATTINGDTALHLAARKRDLDMVRILVDYGTSVDIQNGEGQTALHIASA 62
             ELL+ QTAEQLKATT NGDTALHLAAR+RD+DMVRILVDYGT+VD QNGEGQT LHIA+A
Sbjct:   251 ELLAAQTAEQLKATTANGDTALHLAARRRDVDMVRILVDYGTNVDTQNGEGQTPLHIAAA 310

Query:    63 EGDEALVKYFYGAKANASITDHQG-IQRDIAAAG-----TSVLANCLLMG------EGQT 110
             EGDEAL+KYFYG +A+ASI D+Q      +AA         +LA+           +G T
Sbjct:   311 EGDEALLKYFYGVRASASIADNQDRTPMHLAAENGHAHVIEILADKFKASIFERTKDGST 370

Query:   111 ALHIASAEGDEALVKYFYGAKANASITDHQDRTPMHLAAENGHASIIELLADKFRASIFE 170
              +HIAS  G        +       + +      +H AA  GH  II  L  K    +  
Sbjct:   371 LMHIASLNGHAECATMLFKKGVYLHMPNKDGARSIHTAAAYGHTGIINTLLQKGE-KVDV 429

Query:   171 RTKENYNVLHLAAMYSREDVVKLLL 195
              T +NY  LH+A   ++  VV+ LL
Sbjct:   430 TTNDNYTALHIAVESAKPAVVETLL 454


GO:0005262 "calcium channel activity" evidence=IEA;ISS
GO:0006816 "calcium ion transport" evidence=ISS
GO:0007638 "mechanosensory behavior" evidence=IMP
GO:0005216 "ion channel activity" evidence=ISS
GO:0008381 "mechanically-gated ion channel activity" evidence=NAS;TAS
GO:0050954 "sensory perception of mechanical stimulus" evidence=NAS
GO:0007605 "sensory perception of sound" evidence=IMP
GO:0008092 "cytoskeletal protein binding" evidence=ISS
GO:0030506 "ankyrin binding" evidence=NAS
GO:0050974 "detection of mechanical stimulus involved in sensory perception" evidence=TAS
GO:0070588 "calcium ion transmembrane transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0005929 "cilium" evidence=IDA
GO:0040011 "locomotion" evidence=IMP
GO:0050975 "sensory perception of touch" evidence=IMP
ZFIN|ZDB-GENE-030728-7 trpn1 "transient receptor potential cation channel, subfamily N, member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091113-6 si:ch211-263m18.3 "si:ch211-263m18.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060621-1 ank3a "ankyrin 3a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081104-19 si:ch211-173b16.3 "si:ch211-173b16.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0011747 Ank "Ankyrin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P16157 ANK1 "Ankyrin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MY81 ANK1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NTH2 ANK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|620156 Ank2 "ankyrin 2, neuronal" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-26
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-25
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-25
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-17
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-12
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-11
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-11
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-10
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 7e-10
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 7e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-08
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-08
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-08
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 9e-08
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 5e-07
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 7e-07
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-06
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 6e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 9e-06
smart0024830 smart00248, ANK, ankyrin repeats 4e-05
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 4e-05
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 6e-05
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-05
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 8e-05
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 8e-05
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-04
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 4e-04
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 5e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 9e-04
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.002
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.002
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 99.4 bits (248), Expect = 7e-26
 Identities = 45/146 (30%), Positives = 74/146 (50%), Gaps = 22/146 (15%)

Query: 15  ATTINGDTALHLAARKRDLDMVRILVDYGTSVDIQNGEGQTALHIASAEGDEALVKYFYG 74
           A   +G T LHLAA    L++V++L++ G  V+ ++ +G+T LH+A+  G   +VK    
Sbjct: 2   ARDEDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLLE 61

Query: 75  AKANASITDHQGIQRDIAAAGTSVLANCLLMGEGQTALHIASAEGDEALVKYFYGAKANA 134
             A+ +  D                       +G T LH+A+  G+  +VK      A+ 
Sbjct: 62  KGADVNARDK----------------------DGNTPLHLAARNGNLDVVKLLLKHGADV 99

Query: 135 SITDHQDRTPMHLAAENGHASIIELL 160
           +  D   RTP+HLAA+NGH  +++LL
Sbjct: 100 NARDKDGRTPLHLAAKNGHLEVVKLL 125


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 315
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02874 434 ankyrin repeat protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA02946 446 ankyin-like protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02874 434 ankyrin repeat protein; Provisional 100.0
KOG0510|consensus 929 100.0
KOG0510|consensus 929 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
KOG4412|consensus226 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
KOG0508|consensus 615 100.0
KOG4412|consensus226 100.0
KOG0508|consensus 615 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
KOG4177|consensus 1143 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
KOG0509|consensus 600 100.0
PHA02792 631 ankyrin-like protein; Provisional 100.0
KOG4177|consensus 1143 100.0
KOG0509|consensus 600 100.0
PHA02792 631 ankyrin-like protein; Provisional 100.0
PHA02795437 ankyrin-like protein; Provisional 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.97
PHA02795 437 ankyrin-like protein; Provisional 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.97
KOG0507|consensus 854 99.96
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.95
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.94
KOG0502|consensus296 99.94
KOG0502|consensus296 99.94
PLN03192823 Voltage-dependent potassium channel; Provisional 99.94
KOG0514|consensus452 99.93
KOG0507|consensus 854 99.93
KOG0505|consensus 527 99.93
PHA02743166 Viral ankyrin protein; Provisional 99.92
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.92
PHA02741169 hypothetical protein; Provisional 99.92
KOG4369|consensus 2131 99.91
PHA02884300 ankyrin repeat protein; Provisional 99.91
KOG4369|consensus 2131 99.91
KOG0514|consensus452 99.9
PHA02743166 Viral ankyrin protein; Provisional 99.88
PHA02736154 Viral ankyrin protein; Provisional 99.88
PHA02741169 hypothetical protein; Provisional 99.88
PHA02884300 ankyrin repeat protein; Provisional 99.87
KOG0505|consensus 527 99.87
KOG0512|consensus228 99.86
KOG0512|consensus228 99.86
PHA02736154 Viral ankyrin protein; Provisional 99.84
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.82
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.81
KOG0195|consensus 448 99.81
KOG3676|consensus 782 99.79
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.77
KOG0195|consensus 448 99.76
KOG3676|consensus 782 99.75
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.74
KOG4214|consensus117 99.69
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.64
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.64
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.6
KOG4214|consensus117 99.59
KOG1710|consensus 396 99.56
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.54
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.54
KOG1710|consensus396 99.47
KOG0515|consensus752 99.47
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.46
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.46
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.41
KOG0515|consensus752 99.38
PF1360630 Ank_3: Ankyrin repeat 99.12
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 99.01
KOG0783|consensus 1267 98.94
KOG0783|consensus 1267 98.94
PF1360630 Ank_3: Ankyrin repeat 98.92
KOG0782|consensus1004 98.91
KOG0818|consensus 669 98.87
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.79
KOG0506|consensus622 98.76
KOG0818|consensus 669 98.74
KOG0782|consensus1004 98.7
KOG0506|consensus622 98.67
KOG0511|consensus 516 98.62
KOG2384|consensus223 98.59
KOG0522|consensus 560 98.59
KOG0705|consensus749 98.58
KOG0522|consensus 560 98.52
KOG3609|consensus 822 98.5
KOG0705|consensus749 98.39
KOG3609|consensus 822 98.39
KOG0521|consensus785 98.3
KOG0520|consensus 975 98.16
KOG2384|consensus223 98.14
KOG0511|consensus 516 98.05
KOG0521|consensus785 98.03
KOG0520|consensus 975 97.66
KOG2505|consensus 591 97.64
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.5
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 97.39
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.26
KOG2505|consensus591 96.77
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.63
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.53
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.06
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 95.97
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 95.15
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.1e-45  Score=314.85  Aligned_cols=273  Identities=17%  Similarity=0.171  Sum_probs=226.5

Q ss_pred             hhHhhhhchhhccccccCCCcHHHHHHHcCCHHHHHHHHHcCCcccccCCCCChHHHHHHhcC--CHHHHHHHHhccCCC
Q psy12892          2 WELLSTQTAEQLKATTINGDTALHLAARKRDLDMVRILVDYGTSVDIQNGEGQTALHIASAEG--DEALVKYFYGAKANA   79 (315)
Q Consensus         2 ~~~l~~~~~~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~l~~A~~~~--~~~~v~~Ll~~~~~~   79 (315)
                      +++|++++. ++|.+|.+|.||||+|+..|+.+++++|+++|++++.+|..|.||||+|+..+  ..+++++|+++|+++
T Consensus        55 v~~Ll~~Ga-dvn~~d~~G~TpLh~Aa~~g~~eiv~lLL~~GAdin~~d~~g~TpLh~A~~~~~~~~e~v~lLl~~Gadi  133 (446)
T PHA02946         55 VEELLHRGY-SPNETDDDGNYPLHIASKINNNRIVAMLLTHGADPNACDKQHKTPLYYLSGTDDEVIERINLLVQYGAKI  133 (446)
T ss_pred             HHHHHHCcC-CCCccCCCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCCchHHHHHHHHHcCCCc
Confidence            567777764 59999999999999999999999999999999999999999999999998766  489999999999999


Q ss_pred             cc-ccccchhhHHHhhhh-hhHHhh---------hhccCCChHHHHHHhcCC--HHHHHHHHhCCCCcccCCCCCCcHHH
Q psy12892         80 SI-TDHQGIQRDIAAAGT-SVLANC---------LLMGEGQTALHIASAEGD--EALVKYFYGAKANASITDHQDRTPMH  146 (315)
Q Consensus        80 ~~-~~~~~~~~~~~~~~~-~~~~~~---------~~~~~~~~~l~~A~~~~~--~~~v~~Ll~~~~~~~~~~~~~~~~l~  146 (315)
                      +. .+..+.+........ ......         ..+..|.||||.|+..++  .+++++|++.|++++..|..|.||||
T Consensus       134 n~~~d~~g~tpL~aa~~~~~~vv~~Ll~~gad~~~~d~~G~t~Lh~A~~~~~~~~~~v~~Ll~~Gadin~~d~~G~TpLH  213 (446)
T PHA02946        134 NNSVDEEGCGPLLACTDPSERVFKKIMSIGFEARIVDKFGKNHIHRHLMSDNPKASTISWMMKLGISPSKPDHDGNTPLH  213 (446)
T ss_pred             ccccCCCCCcHHHHHHCCChHHHHHHHhccccccccCCCCCCHHHHHHHhcCCCHHHHHHHHHcCCCCcccCCCCCCHHH
Confidence            85 355444443322211 111111         134678999999887554  68999999999999999999999999


Q ss_pred             HHHHcC--CHHHHHHHHHhcCccccccccCCccHHHHHHHcCc-HHHHHHHHhcC-------------------------
Q psy12892        147 LAAENG--HASIIELLADKFRASIFERTKENYNVLHLAAMYSR-EDVVKLLLNKK-------------------------  198 (315)
Q Consensus       147 ~a~~~~--~~~~~~~Ll~~~~~~~~~~~~~~~~~l~~a~~~~~-~~~~~~Ll~~~-------------------------  198 (315)
                      +|+..|  +.+++++|++  +++++..+..|.||||+|+..++ .+++++|++.+                         
T Consensus       214 ~Aa~~~~~~~~iv~lLl~--gadin~~d~~G~TpLh~A~~~~~~~~~~~~Ll~~g~~~~~~~~~~a~~~~~~~~~e~l~~  291 (446)
T PHA02946        214 IVCSKTVKNVDIINLLLP--STDVNKQNKFGDSPLTLLIKTLSPAHLINKLLSTSNVITDQTVNICIFYDRDDVLEIIND  291 (446)
T ss_pred             HHHHcCCCcHHHHHHHHc--CCCCCCCCCCCCCHHHHHHHhCChHHHHHHHHhCCCCCCCcHHHHHHHcCchHHHHHHHH
Confidence            999876  7889998884  78999999999999999999877 46676666543                         


Q ss_pred             --CCCCCcHHHHHHHcCCHHHHHHHHhccCCccccCCCCCCCCCCccccchhhhhhHHHHHhhhcCCcceeeeccCCCCc
Q psy12892        199 --GIENYNVLHLAAMYSREDVVKLLLNKKGINVAALGGEDLTGRPDLTVGPVQAYLYQVYLISKQQTAVHLVCSRQTGTA  276 (315)
Q Consensus       199 --~~~~~~~l~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~L~~A~~~~~~~~  276 (315)
                        ...|.||||+|+..|+.+++++|++ +|.                                .++||||+|+..   ++
T Consensus       292 ~g~~~~~TpLh~Aa~~g~~eivk~Ll~-~~~--------------------------------~~~t~L~~A~~~---~~  335 (446)
T PHA02946        292 KGKQYDSTDFKMAVEVGSIRCVKYLLD-NDI--------------------------------ICEDAMYYAVLS---EY  335 (446)
T ss_pred             cCcccCCCHHHHHHHcCCHHHHHHHHH-CCC--------------------------------ccccHHHHHHHh---CH
Confidence              3356799999999999999999998 543                                246999999999   99


Q ss_pred             HHHHHHHHhhccceeeeccCCceeEEEeecCchhhhhc
Q psy12892        277 TSILRALLSTAGREIRMTVDGTLILYYRGKDSKAQIEE  314 (315)
Q Consensus       277 ~~~i~~Ll~~g~~~~~~~~~g~t~l~~A~~~~~~~~~~  314 (315)
                      .+++++|+++|++++.+ ..|.|||++|++.++.++++
T Consensus       336 ~~~v~~Ll~~ga~~n~~-~~G~t~l~~a~~~~~~~~~~  372 (446)
T PHA02946        336 ETMVDYLLFNHFSVDSV-VNGHTCMSECVRLNNPVILS  372 (446)
T ss_pred             HHHHHHHHHCCCCCCCc-cccccHHHHHHHcCCHHHHH
Confidence            99999999999999986 58999999999999999986



>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-17
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 1e-15
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 5e-13
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 6e-09
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-14
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 7e-13
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 7e-14
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-11
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-13
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-11
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 6e-13
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 4e-12
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 6e-11
2xee_A157 Structural Determinants For Improved Thermal Stabil 8e-11
2xeh_A157 Structural Determinants For Improved Thermal Stabil 8e-11
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-10
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-07
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 5e-10
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 7e-08
1uoh_A226 Human Gankyrin Length = 226 8e-10
1uoh_A226 Human Gankyrin Length = 226 3e-06
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 1e-09
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 3e-06
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-09
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 6e-08
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 1e-09
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 3e-09
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 7e-09
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 3e-07
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-08
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 1e-07
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 2e-08
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 2e-08
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-08
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-08
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-08
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 3e-08
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 4e-08
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 4e-08
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 7e-08
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-06
3ljn_A364 Ankyrin Repeat Protein From Leishmania Major Length 1e-07
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 2e-07
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 6e-06
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 2e-07
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 9e-06
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-07
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 4e-07
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 6e-07
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 6e-07
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 6e-07
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 1e-06
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 1e-06
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 1e-06
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 2e-06
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-06
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 2e-06
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 4e-05
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 6e-06
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 6e-06
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 8e-06
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 1e-05
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 2e-05
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 2e-05
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 2e-05
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 3e-05
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 3e-05
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 3e-05
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 3e-05
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 4e-05
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 5e-05
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 7e-05
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 7e-05
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 8e-05
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 8e-05
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 9e-05
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 1e-04
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 1e-04
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 1e-04
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 1e-04
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-04
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 2e-04
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 2e-04
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 3e-04
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 3e-04
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 3e-04
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 3e-04
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 3e-04
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 5e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure

Iteration: 1

Score = 66.6 bits (161), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 60/217 (27%), Positives = 98/217 (45%), Gaps = 29/217 (13%) Query: 16 TTINGDTALHLAARKRDLDMVRILVDYGTSVDIQNGEGQTALHIASAEGDEALVKYFYGA 75 + + +T LH+AAR ++ + L+ V+ + + QT LH A+ G +VK Sbjct: 43 SNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLEN 102 Query: 76 KANASITDHQGIQRDIAAAGTSVLANCLLMGEGQTALHIASAEGDEALVKYFYGAKANAS 135 AN ++ A T+ G T LHIA+ EG V +A+ + Sbjct: 103 NANPNL------------ATTA----------GHTPLHIAAREGHVETVLALLEKEASQA 140 Query: 136 ITDHQDRTPMHLAAENGHASIIELLADKFRASIFERTKENYNVLHLAAMYSREDVVKLLL 195 + TP+H+AA+ G + ELL ++ A K LH+A ++ D+VKLLL Sbjct: 141 CMTKKGFTPLHVAAKYGKVRVAELLLER-DAHPNAAGKNGLTPLHVAVHHNNLDIVKLLL 199 Query: 196 NKKGIEN------YNVLHLAAMYSREDVVKLLLNKKG 226 + G + Y LH+AA ++ +V + LL G Sbjct: 200 PRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGG 236
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|3LJN|A Chain A, Ankyrin Repeat Protein From Leishmania Major Length = 364 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-45
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-45
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-43
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-41
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-33
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-19
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-41
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-38
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-36
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-32
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-40
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-38
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-29
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-26
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-15
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-40
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-31
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-28
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 7e-40
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-37
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-30
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-12
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-40
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-35
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-26
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-40
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-38
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-40
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-38
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-36
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-22
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-14
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-04
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-39
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-22
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-16
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-39
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-37
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-27
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-15
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-39
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-38
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-35
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-30
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-27
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-17
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-38
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-37
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-33
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-28
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-15
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-37
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-35
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-31
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 4e-25
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 6e-16
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 4e-08
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-37
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-33
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-21
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-36
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-27
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-27
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-13
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-35
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-30
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-28
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-35
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-34
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-33
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-29
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-22
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-17
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-34
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-31
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-28
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-14
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-34
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-24
3v30_A172 DNA-binding protein rfxank; structural genomics co 7e-33
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-27
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-19
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-15
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-32
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 8e-32
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-25
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-31
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-31
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-30
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-26
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-13
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-31
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-27
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-26
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-21
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-31
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-21
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-21
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-14
2rfa_A232 Transient receptor potential cation channel subfa 2e-30
2rfa_A232 Transient receptor potential cation channel subfa 1e-27
2rfa_A232 Transient receptor potential cation channel subfa 1e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-30
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-29
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 8e-08
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 8e-30
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-23
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-20
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-29
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-24
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 7e-21
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-29
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-26
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-16
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-13
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-29
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-28
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-27
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-23
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 9e-18
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-28
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-26
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-24
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-24
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-27
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-22
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-20
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-12
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-27
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-24
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-16
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 9e-07
2pnn_A273 Transient receptor potential cation channel subfa 4e-27
2pnn_A273 Transient receptor potential cation channel subfa 1e-25
2pnn_A273 Transient receptor potential cation channel subfa 1e-17
2pnn_A273 Transient receptor potential cation channel subfa 4e-09
2pnn_A273 Transient receptor potential cation channel subfa 5e-07
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-27
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-24
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-23
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-20
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-16
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-13
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-26
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-21
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-20
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-18
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-12
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-26
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-23
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-22
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-16
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-25
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-21
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-21
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-12
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-24
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-21
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-19
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-16
2etb_A256 Transient receptor potential cation channel subfam 6e-24
2etb_A256 Transient receptor potential cation channel subfam 7e-19
2etb_A256 Transient receptor potential cation channel subfam 9e-12
2etb_A256 Transient receptor potential cation channel subfam 2e-09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-23
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-21
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-19
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-14
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-23
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-18
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-13
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-04
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-22
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-19
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-21
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-13
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-13
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-18
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-16
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-13
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-07
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-17
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-11
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-16
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-15
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-12
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-17
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-15
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-14
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 8e-14
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-10
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-10
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-09
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-07
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-05
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 8e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-09
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  157 bits (399), Expect = 6e-45
 Identities = 64/221 (28%), Positives = 98/221 (44%), Gaps = 30/221 (13%)

Query: 15  ATTINGDTALHLAARKRDLDMVRILVDYGTSVDIQNGEGQTALHIASAEGDEALVKYFYG 74
               +G T LH+A+    L +V+ L+  G S ++ N + +T LH+A+  G   + KY   
Sbjct: 9   GGGESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQ 68

Query: 75  AKANASITDHQGIQRDIAAAGTSVLANCLLMGEGQTALHIASAEGDEALVKYFYGAKANA 134
            KA  +                          + QT LH A+  G   +VK      AN 
Sbjct: 69  NKAKVNAKAK----------------------DDQTPLHCAARIGHTNMVKLLLENNANP 106

Query: 135 SITDHQDRTPMHLAAENGHASIIELLADKFRASIFERTKENYNVLHLAAMYSREDVVKLL 194
           ++      TP+H+AA  GH   +  L +K  AS    TK+ +  LH+AA Y +  V +LL
Sbjct: 107 NLATTAGHTPLHIAAREGHVETVLALLEK-EASQACMTKKGFTPLHVAAKYGKVRVAELL 165

Query: 195 L------NKKGIENYNVLHLAAMYSREDVVKLLLNKKGINV 229
           L      N  G      LH+A  ++  D+VKLLL  +G + 
Sbjct: 166 LERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLL-PRGGSP 205


>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query315
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 100.0
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 100.0
3v31_A167 Ankyrin repeat family A protein 2; structural geno 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 100.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 100.0
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 100.0
1awc_B153 Protein (GA binding protein beta 1); complex (tran 100.0
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.98
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.96
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.95
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.95
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.95
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.94
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.94
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.93
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.93
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.93
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.93
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.92
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.92
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.91
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.9
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.9
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.9
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.9
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.89
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.89
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.89
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.89
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.87
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.86
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.86
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.86
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.85
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.83
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.77
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=2.5e-49  Score=341.18  Aligned_cols=304  Identities=23%  Similarity=0.286  Sum_probs=225.0

Q ss_pred             hhHhhhhchhhccccccCCCcHHHHHHHcCCHHHHHHHHHcCCcccccCCCCChHHHHHHhcCCHHHHHHHHhccCCCcc
Q psy12892          2 WELLSTQTAEQLKATTINGDTALHLAARKRDLDMVRILVDYGTSVDIQNGEGQTALHIASAEGDEALVKYFYGAKANASI   81 (315)
Q Consensus         2 ~~~l~~~~~~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~l~~A~~~~~~~~v~~Ll~~~~~~~~   81 (315)
                      +++|++++ .+++.++..|.||||+|+..|+.+++++|+++|++++..+..|.||||+|+..|+.+++++|+++|++++.
T Consensus        30 v~~Ll~~g-~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~ga~~~~  108 (437)
T 1n11_A           30 VKNLLQRG-ASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNL  108 (437)
T ss_dssp             HHHHHHTT-CCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSSCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTTC
T ss_pred             HHHHHHcC-CCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHhCCCCCCC
Confidence            56677665 35888888999999999999999999999999999988888999999999999999999999999998888


Q ss_pred             ccccchhhHHHhhhhh--hHHhhh---------hccCCChHHHHHHhcCCHHHHHHHHhCCCCcccCCCCCCcHHHHHHH
Q psy12892         82 TDHQGIQRDIAAAGTS--VLANCL---------LMGEGQTALHIASAEGDEALVKYFYGAKANASITDHQDRTPMHLAAE  150 (315)
Q Consensus        82 ~~~~~~~~~~~~~~~~--~~~~~~---------~~~~~~~~l~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~~~~l~~a~~  150 (315)
                      .+..+.+.........  .....+         .+..|.||||+|+..|+.+++++|++.+.+++..+..|.||||+|+.
T Consensus       109 ~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~  188 (437)
T 1n11_A          109 ATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVH  188 (437)
T ss_dssp             CCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCSSCCCHHHHHHH
T ss_pred             CCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCcCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCCHHHHHHH
Confidence            7776655433332221  111111         13467889999999999999999999999999889899999999999


Q ss_pred             cCCHHHHHHHHHhcCccccccccCCccHHHHHHHcCcHHHHHHHHhcC------CCCCCcHHHHHHHcCCHHHHHHHHhc
Q psy12892        151 NGHASIIELLADKFRASIFERTKENYNVLHLAAMYSREDVVKLLLNKK------GIENYNVLHLAAMYSREDVVKLLLNK  224 (315)
Q Consensus       151 ~~~~~~~~~Ll~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~Ll~~~------~~~~~~~l~~A~~~~~~~~~~~Ll~~  224 (315)
                      .|+.+++++|+++ +.+++..+..+.|||++|+..++.+++++|++.+      +..|.||||.|+..++.+++++|++ 
T Consensus       189 ~~~~~~v~~Ll~~-g~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~-  266 (437)
T 1n11_A          189 HNNLDIVKLLLPR-GGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLS-  266 (437)
T ss_dssp             TTCHHHHHHHGGG-TCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHHHHHTTCHHHHHHHHT-
T ss_pred             cCCHHHHHHHHhC-CCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHh-
Confidence            9999999999986 8888888888999999999999999999999876      5578899999999999999999998 


Q ss_pred             cCCccccCCCCCCCCCCcccc------chhhhhhHHH-----HHhhhcCCcceeeeccCCCCcHHHHHHHHhhccceeee
Q psy12892        225 KGINVAALGGEDLTGRPDLTV------GPVQAYLYQV-----YLISKQQTAVHLVCSRQTGTATSILRALLSTAGREIRM  293 (315)
Q Consensus       225 ~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~-----~~~~~~~t~L~~A~~~~~~~~~~~i~~Ll~~g~~~~~~  293 (315)
                      .+++++..+..+.+   ++..      ..+..++.+.     ..+..|+||||+|+..   ++.+++++|+++|++++.+
T Consensus       267 ~~~~~~~~~~~g~t---~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~~A~~~---g~~~~v~~Ll~~gad~n~~  340 (437)
T 1n11_A          267 KQANGNLGNKSGLT---PLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHY---GNIKLVKFLLQHQADVNAK  340 (437)
T ss_dssp             TTCCTTCCCTTCCC---HHHHHHHHTCHHHHHHHHHHTCCTTCCCSSCCCHHHHHHHS---SCSHHHHHHHHTTCCTTCC
T ss_pred             cCCCCCCCCCCCCC---HHHHHHHcCCHHHHHHHHhCCccCCCCCCCCCCHHHHHHHc---CcHHHHHHHHhcCCCCCCC
Confidence            89888876654433   1110      0111112211     1233455555555555   5555555555555555555


Q ss_pred             ccCCceeEEEeecCchhhhhc
Q psy12892        294 TVDGTLILYYRGKDSKAQIEE  314 (315)
Q Consensus       294 ~~~g~t~l~~A~~~~~~~~~~  314 (315)
                      |..|.|||++|++.|+.++++
T Consensus       341 ~~~g~t~L~~A~~~g~~~iv~  361 (437)
T 1n11_A          341 TKLGYSPLHQAAQQGHTDIVT  361 (437)
T ss_dssp             CTTSCCHHHHHHHTTCHHHHH
T ss_pred             CCCCCCHHHHHHHCChHHHHH
Confidence            555555555555555555554



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 315
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-27
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-27
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-22
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-21
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-26
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-17
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-14
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-10
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-20
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-11
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 9e-08
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.002
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-20
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-20
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-14
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-11
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-19
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-19
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-15
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-14
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-17
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-17
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-11
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-16
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.003
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-16
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-13
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-10
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-15
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-09
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.003
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-13
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 7e-12
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.003
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 4e-12
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-11
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-10
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.002
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-08
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 9e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.001
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 2e-04
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  108 bits (271), Expect = 1e-27
 Identities = 59/223 (26%), Positives = 91/223 (40%), Gaps = 30/223 (13%)

Query: 22  TALHLAARKRDLDMVRILVDYGTSVDIQNGEGQTALHIASAEGDEALVKYFYGAKANASI 81
           T LH+A+    L +V+ L+  G S ++ N + +T LH+A+  G   + KY    KA  + 
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNA 61

Query: 82  TDHQGIQRDIAAAGTSVLANCLLMGEGQTALHIASAEGDEALVKYFYGAKANASITDHQD 141
                                    + QT LH A+  G   +VK      AN ++     
Sbjct: 62  KAK----------------------DDQTPLHCAARIGHTNMVKLLLENNANPNLATTAG 99

Query: 142 RTPMHLAAENGHASIIELLADKFRASIFERTKENYNVLHLAAMYSREDVVKLLL------ 195
            TP+H  A         L   +  AS    TK+ +  LH+AA Y +  V +LLL      
Sbjct: 100 HTPLH-IAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHP 158

Query: 196 NKKGIENYNVLHLAAMYSREDVVKLLLNKKGINVAALGGEDLT 238
           N  G      LH+A  ++  D+VK LL  +G +  +      T
Sbjct: 159 NAAGKNGLTPLHVAVHHNNLDIVK-LLLPRGGSPHSPAWNGYT 200


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query315
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 100.0
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 100.0
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.97
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.97
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.96
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.96
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.96
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.95
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.95
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.94
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.93
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.93
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.93
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.91
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.9
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.87
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=3.5e-45  Score=310.56  Aligned_cols=300  Identities=23%  Similarity=0.308  Sum_probs=219.5

Q ss_pred             hhHhhhhchhhccccccCCCcHHHHHHHcCCHHHHHHHHHcCCcccccCCCCChHHHHHHhcCCHHHHHHHHhccCCCcc
Q psy12892          2 WELLSTQTAEQLKATTINGDTALHLAARKRDLDMVRILVDYGTSVDIQNGEGQTALHIASAEGDEALVKYFYGAKANASI   81 (315)
Q Consensus         2 ~~~l~~~~~~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~l~~A~~~~~~~~v~~Ll~~~~~~~~   81 (315)
                      +++|++++ .++|.+|.+|.||||+||..|+.+++++|+++|++++..+..|.||||+|+..|+.+++++|+..+.+...
T Consensus        16 v~~Ll~~g-~~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gadi~~~~~~g~t~L~~A~~~g~~~~~~~Ll~~~~~~~~   94 (408)
T d1n11a_          16 VKNLLQRG-ASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNL   94 (408)
T ss_dssp             HHHHHHTT-CCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSSCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTTC
T ss_pred             HHHHHHCC-CCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHhhhcccc
Confidence            57777775 46999999999999999999999999999999999999999999999999999999999999988776554


Q ss_pred             ccccchhhHHHhhhhhhHH-----------hhhhccCCChHHHHHHhcCCHHHHHHHHhCCCCcccCCCCCCcHHHHHHH
Q psy12892         82 TDHQGIQRDIAAAGTSVLA-----------NCLLMGEGQTALHIASAEGDEALVKYFYGAKANASITDHQDRTPMHLAAE  150 (315)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~-----------~~~~~~~~~~~l~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~~~~l~~a~~  150 (315)
                      ...................           ....+..+.++++.|+..++.+++++|++.+.+++..+..|.+||++|+.
T Consensus        95 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~~~~~~~~~~~~~~~~L~~A~~  174 (408)
T d1n11a_          95 ATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVH  174 (408)
T ss_dssp             CCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCSSCCCHHHHHHH
T ss_pred             ccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHHHcCCCCCcCCCcCchHHHHHHH
Confidence            4433322211111110000           00112345666777777777777777777777766666666777777777


Q ss_pred             cCCHHHHHHHHHhcCccccccccC---------------------------------CccHHHHHHHcCcHHHHHHHHhc
Q psy12892        151 NGHASIIELLADKFRASIFERTKE---------------------------------NYNVLHLAAMYSREDVVKLLLNK  197 (315)
Q Consensus       151 ~~~~~~~~~Ll~~~~~~~~~~~~~---------------------------------~~~~l~~a~~~~~~~~~~~Ll~~  197 (315)
                      .|+.+++++|+++ |++++..+..                                 +.||++.|+..+..++++++++.
T Consensus       175 ~~~~~~~~~Ll~~-g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~l~~a~~~~~~~~~~~~~~~  253 (408)
T d1n11a_         175 HNNLDIVKLLLPR-GGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSK  253 (408)
T ss_dssp             TTCHHHHHHHGGG-TCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHHHHHTTCHHHHHHHHTT
T ss_pred             cCCHHHHHHHHhc-CCcccccCCCCCCcchhhhccchhhhhhhhhhccccccccCCCCCCHHHHHHHhCcHhHhhhhhcc
Confidence            7777777777664 5555544444                                 44556666666666666666554


Q ss_pred             C------CCCCCcHHHHHHHcCCHHHHHHHHhccCCccccCCCCCCCCCCccccchhh-----------hhhHH-----H
Q psy12892        198 K------GIENYNVLHLAAMYSREDVVKLLLNKKGINVAALGGEDLTGRPDLTVGPVQ-----------AYLYQ-----V  255 (315)
Q Consensus       198 ~------~~~~~~~l~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~-----------~~~~~-----~  255 (315)
                      +      +..|.+|++.|+..++.+++++|++ .|++++..+...        .++++           ..+.+     +
T Consensus       254 ~~~~~~~~~~g~~~l~~a~~~~~~~i~~~Ll~-~g~~~~~~~~~~--------~t~L~~~~~~~~~~~~~~ll~~g~~in  324 (408)
T d1n11a_         254 QANGNLGNKSGLTPLHLVAQEGHVPVADVLIK-HGVMVDATTRMG--------YTPLHVASHYGNIKLVKFLLQHQADVN  324 (408)
T ss_dssp             TCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHH-HTCCTTCCCSSC--------CCHHHHHHHSSCSHHHHHHHHTTCCTT
T ss_pred             ccccccccCCCCChhhhhhhcCcHHHHHHHHH-CCCccccccccc--------cccchhhcccCcceeeeeecccccccc
Confidence            3      5567788888888888999999988 888887765433        23332           12221     1


Q ss_pred             HHhhhcCCcceeeeccCCCCcHHHHHHHHhhccceeeeccCCceeEEEeecCchhhhhcC
Q psy12892        256 YLISKQQTAVHLVCSRQTGTATSILRALLSTAGREIRMTVDGTLILYYRGKDSKAQIEEL  315 (315)
Q Consensus       256 ~~~~~~~t~L~~A~~~~~~~~~~~i~~Ll~~g~~~~~~~~~g~t~l~~A~~~~~~~~~~l  315 (315)
                      .++..|+||||+|++.   |+.++|++|+++|||++.+|.+|.|||++|++.|+.++|++
T Consensus       325 ~~d~~G~T~Lh~A~~~---g~~~iv~~Ll~~GAd~n~~d~~G~t~L~~A~~~~~~~iv~~  381 (408)
T d1n11a_         325 AKTKLGYSPLHQAAQQ---GHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDV  381 (408)
T ss_dssp             CCCTTSCCHHHHHHHT---TCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHHTTCHHHHHH
T ss_pred             ccCCCCCCHHHHHHHc---CCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHH
Confidence            4567899999999999   99999999999999999999999999999999999999873



>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure