Psyllid ID: psy12898

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60----
MLQDWDAFWDFISLLPETTHQVMILFSDRGIPDGFRHMHGYGSHTFKLVNKDNEPVYCKFHFRQ
ccccccccEEEEccccHHHHEEEEEcccccccccccccccccccEEEEEEccccEEEEEEEEEc
ccEcHHHHHHHHHHcHHHHHHHHHHccccccEcccccccEEccccEEEEcccccEEEEEEEEEc
MLQDWDAFWDFISLLPETTHQVMILFsdrgipdgfrhmhgygshtfklvnkdnepvyckfhfrq
MLQDWDAFWDFISLLPETTHQVMILFSDRGIPDGFRHMHGYGSHtfklvnkdnepvYCKFHFRQ
MLQDWDAFWDFISLLPETTHQVMILFSDRGIPDGFRHMHGYGSHTFKLVNKDNEPVYCKFHFRQ
***DWDAFWDFISLLPETTHQVMILFSDRGIPDGFRHMHGYGSHTFKLVNKDNEPVYCKFHF**
*LQDWDAFWDFISLLPETTHQVMILFSDRGIPDGFRHMHGYGSHTFKLVNKDNEPVYCKFHFRQ
MLQDWDAFWDFISLLPETTHQVMILFSDRGIPDGFRHMHGYGSHTFKLVNKDNEPVYCKFHFRQ
MLQDWDAFWDFISLLPETTHQVMILFSDRGIPDGFRHMHGYGSHTFKLVNKDNEPVYCKFHFRQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQDWDAFWDFISLLPETTHQVMILFSDRGIPDGFRHMHGYGSHTFKLVNKDNEPVYCKFHFRQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query64 2.2.26 [Sep-21-2011]
P90682 541 Catalase OS=Ascaris suum N/A N/A 0.968 0.114 0.758 1e-22
Q9PT92 526 Catalase OS=Danio rerio G yes N/A 0.968 0.117 0.709 3e-21
P17336 506 Catalase OS=Drosophila me yes N/A 0.968 0.122 0.677 5e-21
Q9PWF7 528 Catalase OS=Glandirana ru N/A N/A 0.968 0.117 0.693 6e-21
P24270 527 Catalase OS=Mus musculus yes N/A 0.968 0.117 0.725 6e-21
P04762 527 Catalase OS=Rattus norveg yes N/A 0.968 0.117 0.709 1e-20
Q5RF10 527 Catalase OS=Pongo abelii yes N/A 0.968 0.117 0.709 2e-20
P04040 527 Catalase OS=Homo sapiens yes N/A 0.968 0.117 0.709 2e-20
P00432 527 Catalase OS=Bos taurus GN yes N/A 0.968 0.117 0.709 2e-20
O62839 527 Catalase OS=Sus scrofa GN yes N/A 0.968 0.117 0.709 2e-20
>sp|P90682|CATA_ASCSU Catalase OS=Ascaris suum GN=CAT PE=2 SV=2 Back     alignment and function desciption
 Score =  104 bits (260), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 47/62 (75%), Positives = 51/62 (82%)

Query: 2   LQDWDAFWDFISLLPETTHQVMILFSDRGIPDGFRHMHGYGSHTFKLVNKDNEPVYCKFH 61
           L+D +  WDF SL PETTHQVMILF DRGIPDGFRHM G+GSHTFKLVNKD   VYCKFH
Sbjct: 175 LKDPNMMWDFFSLRPETTHQVMILFGDRGIPDGFRHMDGFGSHTFKLVNKDGNAVYCKFH 234

Query: 62  FR 63
            +
Sbjct: 235 IK 236
Occurs in almost all aerobically respiring organisms and serves to protect cells from the toxic effects of hydrogen peroxide.
Ascaris suum (taxid: 6253)
EC: 1EC: .EC: 1EC: 1EC: .EC: 1EC: .EC: 6
>sp|Q9PT92|CATA_DANRE Catalase OS=Danio rerio GN=cat PE=2 SV=1 Back     alignment and function description
>sp|P17336|CATA_DROME Catalase OS=Drosophila melanogaster GN=Cat PE=1 SV=2 Back     alignment and function description
>sp|Q9PWF7|CATA_GLARU Catalase OS=Glandirana rugosa GN=cat PE=2 SV=3 Back     alignment and function description
>sp|P24270|CATA_MOUSE Catalase OS=Mus musculus GN=Cat PE=1 SV=4 Back     alignment and function description
>sp|P04762|CATA_RAT Catalase OS=Rattus norvegicus GN=Cat PE=1 SV=3 Back     alignment and function description
>sp|Q5RF10|CATA_PONAB Catalase OS=Pongo abelii GN=CAT PE=2 SV=3 Back     alignment and function description
>sp|P04040|CATA_HUMAN Catalase OS=Homo sapiens GN=CAT PE=1 SV=3 Back     alignment and function description
>sp|P00432|CATA_BOVIN Catalase OS=Bos taurus GN=CAT PE=1 SV=3 Back     alignment and function description
>sp|O62839|CATA_PIG Catalase OS=Sus scrofa GN=CAT PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query64
260586476 517 catalase [Scylla paramamosain] 0.968 0.119 0.758 1e-23
312384354 580 hypothetical protein AND_02228 [Anophele 0.968 0.106 0.774 1e-23
442757299 502 Putative catalase pediculus us corporis 0.968 0.123 0.822 1e-23
46909273 264 catalase, partial [Antedon mediterranea] 0.968 0.234 0.790 2e-23
346471027 499 hypothetical protein [Amblyomma maculatu 0.968 0.124 0.806 2e-23
405969523 414 Catalase [Crassostrea gigas] 0.968 0.149 0.774 3e-23
373129792 517 catalase [Portunus trituberculatus] 0.968 0.119 0.758 4e-23
340382861 508 PREDICTED: catalase-like [Amphimedon que 0.968 0.122 0.790 4e-23
359843258 521 catalase, partial [Schistocerca gregaria 0.968 0.119 0.790 4e-23
403183360 504 AAEL013407-PB [Aedes aegypti] 0.968 0.123 0.774 5e-23
>gi|260586476|gb|ACX46120.1| catalase [Scylla paramamosain] Back     alignment and taxonomy information
 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 47/62 (75%), Positives = 55/62 (88%)

Query: 2   LQDWDAFWDFISLLPETTHQVMILFSDRGIPDGFRHMHGYGSHTFKLVNKDNEPVYCKFH 61
           L+D D FWDFI+L PETTHQV  LFSDRG PDG+RHM+GYGSHTFKLVNK+ +PVYCKFH
Sbjct: 172 LKDADMFWDFITLRPETTHQVSFLFSDRGTPDGYRHMNGYGSHTFKLVNKEGKPVYCKFH 231

Query: 62  FR 63
           ++
Sbjct: 232 YK 233

Source: Scylla paramamosain

Species: Scylla paramamosain

Genus: Scylla

Family: Portunidae

Order: Decapoda

Class: Malacostraca

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|312384354|gb|EFR29099.1| hypothetical protein AND_02228 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|442757299|gb|JAA70808.1| Putative catalase pediculus us corporis catalase [Ixodes ricinus] Back     alignment and taxonomy information
>gi|46909273|gb|AAT06154.1| catalase, partial [Antedon mediterranea] Back     alignment and taxonomy information
>gi|346471027|gb|AEO35358.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|405969523|gb|EKC34489.1| Catalase [Crassostrea gigas] Back     alignment and taxonomy information
>gi|373129792|gb|ACI13850.2| catalase [Portunus trituberculatus] Back     alignment and taxonomy information
>gi|340382861|ref|XP_003389936.1| PREDICTED: catalase-like [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|359843258|gb|AEV89764.1| catalase, partial [Schistocerca gregaria] Back     alignment and taxonomy information
>gi|403183360|gb|EJY58037.1| AAEL013407-PB [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query64
ZFIN|ZDB-GENE-000210-20 526 cat "catalase" [Danio rerio (t 0.968 0.117 0.709 4.9e-21
MGI|MGI:88271 527 Cat "catalase" [Mus musculus ( 0.968 0.117 0.725 1e-20
FB|FBgn0000261 506 Cat "Catalase" [Drosophila mel 0.968 0.122 0.677 1.5e-20
RGD|2279 527 Cat "catalase" [Rattus norvegi 0.968 0.117 0.709 2.8e-20
UNIPROTKB|P00432 527 CAT "Catalase" [Bos taurus (ta 0.968 0.117 0.709 3.7e-20
UNIPROTKB|P04040 527 CAT "Catalase" [Homo sapiens ( 0.968 0.117 0.709 3.7e-20
UNIPROTKB|F1SGS9 527 CAT "Catalase" [Sus scrofa (ta 0.968 0.117 0.709 3.7e-20
UNIPROTKB|O62839 527 CAT "Catalase" [Sus scrofa (ta 0.968 0.117 0.709 3.7e-20
UNIPROTKB|Q64405 527 CAT "Catalase" [Cavia porcellu 0.968 0.117 0.709 4.7e-20
UNIPROTKB|O97492 527 CAT "Catalase" [Canis lupus fa 0.968 0.117 0.709 7.7e-20
ZFIN|ZDB-GENE-000210-20 cat "catalase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 254 (94.5 bits), Expect = 4.9e-21, P = 4.9e-21
 Identities = 44/62 (70%), Positives = 51/62 (82%)

Query:     2 LQDWDAFWDFISLLPETTHQVMILFSDRGIPDGFRHMHGYGSHTFKLVNKDNEPVYCKFH 61
             L+D D  WDF SL PE+ HQV  LFSDRGIPDG+RHM+GYGSHTFKLVN   +PVYCKFH
Sbjct:   176 LKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGYRHMNGYGSHTFKLVNAQGQPVYCKFH 235

Query:    62 FR 63
             ++
Sbjct:   236 YK 237
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0004096 "catalase activity" evidence=IEA
GO:0006979 "response to oxidative stress" evidence=IEA
GO:0046688 "response to copper ion" evidence=IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0042744 "hydrogen peroxide catabolic process" evidence=IEA
GO:0004601 "peroxidase activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0005777 "peroxisome" evidence=IEA
MGI|MGI:88271 Cat "catalase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0000261 Cat "Catalase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|2279 Cat "catalase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P00432 CAT "Catalase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P04040 CAT "Catalase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SGS9 CAT "Catalase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O62839 CAT "Catalase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q64405 CAT "Catalase" [Cavia porcellus (taxid:10141)] Back     alignment and assigned GO terms
UNIPROTKB|O97492 CAT "Catalase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P30265CATA_LACSK1, ., 1, 1, ., 1, ., 60.60340.90620.1213yesN/A
Q59714CATA_PSEPU1, ., 1, 1, ., 1, ., 60.58060.96870.1294yesN/A
Q5HPK8CATA_STAEQ1, ., 1, 1, ., 1, ., 60.60.85930.1091yesN/A
Q64405CATA_CAVPO1, ., 1, 1, ., 1, ., 60.70960.96870.1176yesN/A
Q7A5T2CATA_STAAN1, ., 1, 1, ., 1, ., 60.56450.96870.1227yesN/A
P0A323CATA_BORPE1, ., 1, 1, ., 1, ., 60.54830.96870.1286yesN/A
P0A324CATA_BORBR1, ., 1, 1, ., 1, ., 60.54830.96870.1286yesN/A
P0A325CATA_BORPA1, ., 1, 1, ., 1, ., 60.54830.96870.1286yesN/A
P26901CATA_BACSU1, ., 1, 1, ., 1, ., 60.59670.96870.1283yesN/A
Q5HG86CATA_STAAC1, ., 1, 1, ., 1, ., 60.56450.96870.1227yesN/A
Q5RF10CATA_PONAB1, ., 1, 1, ., 1, ., 60.70960.96870.1176yesN/A
Q6GH72CATA_STAAR1, ., 1, 1, ., 1, ., 60.56450.96870.1227yesN/A
O97492CATA_CANFA1, ., 1, 1, ., 1, ., 60.70960.96870.1176yesN/A
P24270CATA_MOUSE1, ., 1, 1, ., 1, ., 60.72580.96870.1176yesN/A
P00432CATA_BOVIN1, ., 1, 1, ., 1, ., 60.70960.96870.1176yesN/A
Q8CPD0CATA_STAES1, ., 1, 1, ., 1, ., 60.60.85930.1091yesN/A
Q49XC1CATA_STAS11, ., 1, 1, ., 1, ., 60.60.85930.1111yesN/A
Q2FYU7CATA_STAA81, ., 1, 1, ., 1, ., 60.56450.96870.1227yesN/A
O61235CATA2_CAEEL1, ., 1, 1, ., 1, ., 60.62900.96870.1247yesN/A
O93662CATA_METBF1, ., 1, 1, ., 1, ., 60.54090.95310.1207yesN/A
Q9X576CATE_RHIME1, ., 1, 1, ., 1, ., 60.53440.90620.0822yesN/A
Q9L4S1CATA_STAAU1, ., 1, 1, ., 1, ., 60.56450.96870.1227yesN/A
P17336CATA_DROME1, ., 1, 1, ., 1, ., 60.67740.96870.1225yesN/A
Q59602CATA_NEIGO1, ., 1, 1, ., 1, ., 60.61810.85930.11yesN/A
O68146CATA_VIBF11, ., 1, 1, ., 1, ., 60.61810.85930.1141yesN/A
Q59296CATA_CAMJE1, ., 1, 1, ., 1, ., 60.56450.96870.1222yesN/A
P04762CATA_RAT1, ., 1, 1, ., 1, ., 60.70960.96870.1176yesN/A
Q2PUJ9CATA_STAEP1, ., 1, 1, ., 1, ., 60.60.85930.1091yesN/A
O77229CATA_DICDI1, ., 1, 1, ., 1, ., 60.56660.93750.1209yesN/A
P44390CATA_HAEIN1, ., 1, 1, ., 1, ., 60.58180.85930.1082yesN/A
Q99UE2CATA_STAAM1, ., 1, 1, ., 1, ., 60.56450.96870.1227yesN/A
Q9I1W8CATE_PSEAE1, ., 1, 1, ., 1, ., 60.58620.90620.0818yesN/A
Q8NWV5CATA_STAAW1, ., 1, 1, ., 1, ., 60.56450.96870.1227yesN/A
P04040CATA_HUMAN1, ., 1, 1, ., 1, ., 60.70960.96870.1176yesN/A
Q2YXT2CATA_STAAB1, ., 1, 1, ., 1, ., 60.56450.96870.1227yesN/A
Q6G9M4CATA_STAAS1, ., 1, 1, ., 1, ., 60.56450.96870.1227yesN/A
O62839CATA_PIG1, ., 1, 1, ., 1, ., 60.70960.96870.1176yesN/A
Q9PT92CATA_DANRE1, ., 1, 1, ., 1, ., 60.70960.96870.1178yesN/A
Q2I6W4CATA_CALJA1, ., 1, 1, ., 1, ., 60.69350.96870.1176yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query64
cd08156 429 cd08156, catalase_clade_3, Clade 3 of the heme-bin 5e-41
smart01060 373 smart01060, Catalase, Catalases are antioxidant en 4e-36
pfam00199 383 pfam00199, Catalase, Catalase 3e-31
COG0753 496 COG0753, KatE, Catalase [Inorganic ion transport a 9e-30
cd00328 433 cd00328, catalase, Catalase heme-binding enzyme 2e-27
PLN02609 492 PLN02609, PLN02609, catalase 5e-26
cd08157 451 cd08157, catalase_fungal, Fungal catalases similar 2e-25
cd08154 469 cd08154, catalase_clade_1, Clade 1 of the heme-bin 2e-22
PRK11249 752 PRK11249, katE, hydroperoxidase II; Provisional 6e-22
cd08155 443 cd08155, catalase_clade_2, Clade 2 of the heme-bin 3e-21
cd08150 283 cd08150, catalase_like, Catalase-like heme-binding 2e-12
>gnl|CDD|163712 cd08156, catalase_clade_3, Clade 3 of the heme-binding enzyme catalase Back     alignment and domain information 
 Score =  137 bits (347), Expect = 5e-41
 Identities = 43/62 (69%), Positives = 49/62 (79%)

Query: 2   LQDWDAFWDFISLLPETTHQVMILFSDRGIPDGFRHMHGYGSHTFKLVNKDNEPVYCKFH 61
           L+D D FWDF SL PE+ HQV ILFSDRGIPDG+RHM+GYGSHTF LVN   E  + KFH
Sbjct: 109 LKDPDMFWDFWSLSPESLHQVTILFSDRGIPDGYRHMNGYGSHTFSLVNAKGERFWVKFH 168

Query: 62  FR 63
           F+
Sbjct: 169 FK 170

Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes, which is involved in the protection of cells from the toxic effects of peroxides. It catalyzes the conversion of hydrogen peroxide to water and molecular oxygen. Catalases also utilize hydrogen peroxide to oxidize various substrates such as alcohol or phenols. Clade 3 catalases are the most abundant subfamily and are found in all three kingdoms of life; they have a relatively small subunit size of 43 to 75 kDa, and bind a protoheme IX (heme b) group buried deep inside the structure. Clade 3 catalases also bind NADPH as a second redox-active cofactor. They form tetramers, and in eukaryotic cells, catalases are located in peroxisomes. Length = 429
>gnl|CDD|215003 smart01060, Catalase, Catalases are antioxidant enzymes that catalyse the conversion of hydrogen peroxide to water and molecular oxygen, serving to protect cells from its toxic effects Back     alignment and domain information
>gnl|CDD|215783 pfam00199, Catalase, Catalase Back     alignment and domain information
>gnl|CDD|223824 COG0753, KatE, Catalase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163705 cd00328, catalase, Catalase heme-binding enzyme Back     alignment and domain information
>gnl|CDD|215328 PLN02609, PLN02609, catalase Back     alignment and domain information
>gnl|CDD|163713 cd08157, catalase_fungal, Fungal catalases similar to yeast catalases A and T Back     alignment and domain information
>gnl|CDD|163710 cd08154, catalase_clade_1, Clade 1 of the heme-binding enzyme catalase Back     alignment and domain information
>gnl|CDD|236886 PRK11249, katE, hydroperoxidase II; Provisional Back     alignment and domain information
>gnl|CDD|163711 cd08155, catalase_clade_2, Clade 2 of the heme-binding enzyme catalase Back     alignment and domain information
>gnl|CDD|163706 cd08150, catalase_like, Catalase-like heme-binding proteins and protein domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 64
KOG0047|consensus 505 99.96
COG0753 496 KatE Catalase [Inorganic ion transport and metabol 99.96
cd08156 429 catalase_clade_3 Clade 3 of the heme-binding enzym 99.94
PLN02609 492 catalase 99.94
cd08154 469 catalase_clade_1 Clade 1 of the heme-binding enzym 99.94
cd00328 433 catalase Catalase heme-binding enzyme. Catalase is 99.94
cd08155 443 catalase_clade_2 Clade 2 of the heme-binding enzym 99.93
PRK11249 752 katE hydroperoxidase II; Provisional 99.93
cd08157 451 catalase_fungal Fungal catalases similar to yeast 99.9
PF00199 384 Catalase: Catalase; InterPro: IPR011614 Catalases 99.76
cd08153 295 srpA_like Catalase-like heme-binding proteins simi 99.67
cd08150 283 catalase_like Catalase-like heme-binding proteins 99.64
cd08151 328 AOS Allene oxide synthase. Allene oxide synthase c 99.39
cd08152 305 y4iL_like Catalase-like heme-binding proteins simi 98.52
PF1351160 DUF4124: Domain of unknown function (DUF4124) 91.02
PF0345665 uDENN: uDENN domain; InterPro: IPR005113 This regi 86.5
>KOG0047|consensus Back     alignment and domain information 
Probab=99.96  E-value=5.4e-30  Score=183.07  Aligned_cols=63  Identities=65%  Similarity=1.243  Sum_probs=61.9

Q ss_pred             CCCchhHHHHHhcCchHHHHHHHHHhCCCCCCCcCCCccccceeeEEEcCCCCeEEEEEEEeC
Q psy12898          2 LQDWDAFWDFISLLPETTHQVMILFSDRGIPDGFRHMHGYGSHTFKLVNKDNEPVYCKFHFRQ   64 (64)
Q Consensus         2 l~D~~~~~df~~~~Pes~~~~~~~~s~~g~P~s~~~~~~~gvhtfk~vn~~G~~~~Vr~~~~~   64 (64)
                      |+||+++|||++.+|||+||+++||||||||++||||+|||+||||+||++|+.+|||||||+
T Consensus       173 lkD~~m~wDf~t~~pEslHqv~~lFsDrGtP~~yrhM~Gyg~hTyk~vNk~G~~~YvkfH~kt  235 (505)
T KOG0047|consen  173 LKDPDMFWDFLTLRPESLHQVMFLFSDRGTPDGYRHMNGYGSHTYKMVNKEGKAHYVKFHFKT  235 (505)
T ss_pred             ccCcchhHHHhhcCHhhhhheeeeeccCCCCcccccccccccceEEEEccCCceEEEEEEEec
Confidence            789999999999999999999999999999999999999999999999999999999999986

>COG0753 KatE Catalase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd08156 catalase_clade_3 Clade 3 of the heme-binding enzyme catalase Back     alignment and domain information
>PLN02609 catalase Back     alignment and domain information
>cd08154 catalase_clade_1 Clade 1 of the heme-binding enzyme catalase Back     alignment and domain information
>cd00328 catalase Catalase heme-binding enzyme Back     alignment and domain information
>cd08155 catalase_clade_2 Clade 2 of the heme-binding enzyme catalase Back     alignment and domain information
>PRK11249 katE hydroperoxidase II; Provisional Back     alignment and domain information
>cd08157 catalase_fungal Fungal catalases similar to yeast catalases A and T Back     alignment and domain information
>PF00199 Catalase: Catalase; InterPro: IPR011614 Catalases (1 Back     alignment and domain information
>cd08153 srpA_like Catalase-like heme-binding proteins similar to the uncharacterized srpA Back     alignment and domain information
>cd08150 catalase_like Catalase-like heme-binding proteins and protein domains Back     alignment and domain information
>cd08151 AOS Allene oxide synthase Back     alignment and domain information
>cd08152 y4iL_like Catalase-like heme-binding proteins similar to the uncharacterized y4iL Back     alignment and domain information
>PF13511 DUF4124: Domain of unknown function (DUF4124) Back     alignment and domain information
>PF03456 uDENN: uDENN domain; InterPro: IPR005113 This region is always found associated with IPR001194 from INTERPRO Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query64
3nwl_A 527 The Crystal Structure Of The P212121 Form Of Bovine 1e-21
7cat_A 506 The Nadph Binding Site On Beef Liver Catalase Lengt 1e-21
1qqw_A 527 Crystal Structure Of Human Erythrocyte Catalase Len 1e-21
1dgh_B 498 Human Erythrocyte Catalase 3-Amino-1,2,4-Triazole C 2e-21
1dgh_A 498 Human Erythrocyte Catalase 3-Amino-1,2,4-Triazole C 2e-21
1dgg_A 497 Human Erythrocyte Catalse Cyanide Complex Length = 2e-21
3rgp_A 499 Structural And Kinetic Analysis Of The Beef Liver C 2e-21
1si8_A 484 Crystal Structure Of E. Faecalis Catalase Length = 5e-17
2isa_A 483 Crystal Structure Of Vibrio Salmonicida Catalase Le 8e-16
3p9s_A 753 Structure Of I274a Variant Of E. Coli Kate Length = 4e-15
3p9r_A 753 Structure Of I274g Variant Of E. Coli Kate Length = 6e-15
3p9q_A 753 Structure Of I274c Variant Of E. Coli Kate Length = 6e-15
3p9p_A 753 Structure Of I274v Variant Of E. Coli Kate Length = 7e-15
1h6n_A 484 Formation Of A Tyrosyl Radical Intermediate In Prot 7e-15
3ttu_A 753 Structure Of F413y/h128n Double Variant Of E. Coli 8e-15
1ggh_A 753 Crystal Structure Of Catalase Hpii From Escherichia 8e-15
1gg9_A 753 Crystal Structure Of Catalase Hpii From Escherichia 8e-15
1qf7_A 753 Structure Of The Mutant His392gln Of Catalase Hpii 8e-15
1p7y_A 753 Crystal Structure Of The D181a Variant Of Catalase 9e-15
1qws_A 753 Structure Of The D181n Variant Of Catalase Hpii Fro 9e-15
1p80_A 753 Crystal Structure Of The D181q Variant Of Catalase 9e-15
1p7z_A 753 Crystal Structure Of The D181s Variant Of Catalase 9e-15
1p81_A 753 Crystal Structure Of The D181e Variant Of Catalase 9e-15
1ggj_A 753 Crystal Structure Of Catalase Hpii From Escherichia 9e-15
4enp_A 753 Structure Of E530a Variant E. Coli Kate Length = 75 9e-15
4env_A 753 Structure Of The S234i Variant Of E. Coli Kate Leng 9e-15
3ttx_A 753 Structure Of The F413k Variant Of E. Coli Kate Leng 9e-15
3ttw_A 753 Structure Of The F413e Variant Of E. Coli Kate Leng 9e-15
3ttv_A 753 Structure Of The F413e Variant Of E. Coli Kate Leng 9e-15
3ttt_A 753 Structure Of F413y Variant Of E. Coli Kate Length = 9e-15
1cf9_A 753 Structure Of The Mutant Val169cys Of Catalase Hpii 9e-15
1iph_A 753 Structure Of Catalase Hpii From Escherichia Coli Le 9e-15
4ent_A 753 Structure Of The S234a Variant Of E. Coli Kate Leng 9e-15
4ens_A 753 Structure Of E530q Variant Of E. Coli Kate Length = 9e-15
4enw_A 753 Structure Of The S234n Variant Of E. Coli Kate Leng 9e-15
4enr_A 753 Structure Of E530i Variant E. Coli Kate Length = 75 1e-14
4enu_A 753 Structure Of The S234d Variant Of E. Coli Kate Leng 1e-14
4enq_A 753 Structure Of E530d Variant E. Coli Kate Length = 75 1e-14
1ggk_A 753 Crystal Structure Of Catalase Hpii From Escherichia 1e-14
3hb6_A 484 Inactive Mutant H54f Of Proteus Mirabilis Catalase 2e-14
1e93_A 484 High Resolution Structure And Biochemical Propertie 2e-14
1m85_A 484 Structure Of Proteus Mirabilis Catalase For The Nat 2e-14
1h7k_A 483 Formation Of A Tyrosyl Radical Intermediate In Prot 5e-14
1ye9_A226 Crystal Structure Of Proteolytically Truncated Cata 6e-14
1qwl_A 505 Structure Of Helicobacter Pylori Catalase Length = 1e-13
2a9e_A 505 Helicobacter Pylori Catalase Compound I Length = 50 2e-13
1a4e_A 488 Catalase A From Saccharomyces Cerevisiae Length = 4 5e-12
2xq1_A 509 Crystal Structure Of Peroxisomal Catalase From The 1e-11
2j2m_A 491 Crystal Structure Analysis Of Catalase From Exiguob 7e-11
1hbz_A 498 Catalase From Micrococcus Lysodeikticu Length = 498 3e-10
4aue_A 717 Crystal Structure, Recombinant Expression And Mutag 3e-10
4aul_A 719 Crystal Structure, Recombinant Expression And Mutag 4e-10
4aum_A 719 Crystal Structure, Recombinant Expression And Mutag 4e-10
2xf2_A 688 Pvc-At Length = 688 4e-10
4aun_A 719 Crystal Structure, Recombinant Expression And Mutag 4e-10
1gwf_A 503 Compound Ii Structure Of Micrococcus Lysodeikticus 4e-10
1gwh_A 503 Atomic Resolution Structure Of Micrococcus Lysodeik 5e-10
2iuf_A 688 The Structures Of Penicillium Vitale Catalase: Rest 6e-10
1m7s_A 484 Crystal Structure Analysis Of Catalase Catf Of Pseu 8e-10
3ej6_A 688 Neurospora Crassa Catalase-3 Crystal Structure Leng 1e-09
1sy7_A 715 Crystal Structure Of The Catalase-1 From Neurospora 8e-07
>pdb|3NWL|A Chain A, The Crystal Structure Of The P212121 Form Of Bovine Liver Catalase Previously Characterized By Electron Microscopy Length = 527 Back     alignment and structure 
Iteration: 1

 Score = 98.2 bits (243), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 45/62 (72%), Positives = 49/62 (79%)
Query: 2   LQDWDAFWDFISLLPETTHQVMILFSDRGIPDGFRHMHGYGSHTFKLVNKDNEPVYCKFH 61
           L+D D  WDF SL PE+ HQV  LFSDRGIPDG RHM GYGSHTFKLVN D E VYCKFH
Sbjct: 176 LKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMDGYGSHTFKLVNADGEAVYCKFH 235
Query: 62  FR 63
           ++
Sbjct: 236 YK 237
>pdb|7CAT|A Chain A, The Nadph Binding Site On Beef Liver Catalase Length = 506 Back     alignment and structure
>pdb|1QQW|A Chain A, Crystal Structure Of Human Erythrocyte Catalase Length = 527 Back     alignment and structure
>pdb|1DGH|B Chain B, Human Erythrocyte Catalase 3-Amino-1,2,4-Triazole Complex Length = 498 Back     alignment and structure
>pdb|1DGH|A Chain A, Human Erythrocyte Catalase 3-Amino-1,2,4-Triazole Complex Length = 498 Back     alignment and structure
>pdb|1DGG|A Chain A, Human Erythrocyte Catalse Cyanide Complex Length = 497 Back     alignment and structure
>pdb|3RGP|A Chain A, Structural And Kinetic Analysis Of The Beef Liver Catalase Complexed With Nitric Oxide Length = 499 Back     alignment and structure
>pdb|1SI8|A Chain A, Crystal Structure Of E. Faecalis Catalase Length = 484 Back     alignment and structure
>pdb|2ISA|A Chain A, Crystal Structure Of Vibrio Salmonicida Catalase Length = 483 Back     alignment and structure
>pdb|3P9S|A Chain A, Structure Of I274a Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3P9R|A Chain A, Structure Of I274g Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3P9Q|A Chain A, Structure Of I274c Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3P9P|A Chain A, Structure Of I274v Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1H6N|A Chain A, Formation Of A Tyrosyl Radical Intermediate In Proteus Mirabilis Catalase By Directed Mutagenesis And Consequences For Nucleotide Reactivity Length = 484 Back     alignment and structure
>pdb|3TTU|A Chain A, Structure Of F413y/h128n Double Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1GGH|A Chain A, Crystal Structure Of Catalase Hpii From Escherichia Coli, His128ala Variant. Length = 753 Back     alignment and structure
>pdb|1GG9|A Chain A, Crystal Structure Of Catalase Hpii From Escherichia Coli, His128asn Variant. Length = 753 Back     alignment and structure
>pdb|1QF7|A Chain A, Structure Of The Mutant His392gln Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|1P7Y|A Chain A, Crystal Structure Of The D181a Variant Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|1QWS|A Chain A, Structure Of The D181n Variant Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|1P80|A Chain A, Crystal Structure Of The D181q Variant Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|1P7Z|A Chain A, Crystal Structure Of The D181s Variant Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|1P81|A Chain A, Crystal Structure Of The D181e Variant Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|1GGJ|A Chain A, Crystal Structure Of Catalase Hpii From Escherichia Coli, Asn201ala Variant. Length = 753 Back     alignment and structure
>pdb|4ENP|A Chain A, Structure Of E530a Variant E. Coli Kate Length = 753 Back     alignment and structure
>pdb|4ENV|A Chain A, Structure Of The S234i Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3TTX|A Chain A, Structure Of The F413k Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3TTW|A Chain A, Structure Of The F413e Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3TTV|A Chain A, Structure Of The F413e Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3TTT|A Chain A, Structure Of F413y Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1CF9|A Chain A, Structure Of The Mutant Val169cys Of Catalase Hpii From Escherichia Coli Length = 753 Back     alignment and structure
>pdb|1IPH|A Chain A, Structure Of Catalase Hpii From Escherichia Coli Length = 753 Back     alignment and structure
>pdb|4ENT|A Chain A, Structure Of The S234a Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|4ENS|A Chain A, Structure Of E530q Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|4ENW|A Chain A, Structure Of The S234n Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|4ENR|A Chain A, Structure Of E530i Variant E. Coli Kate Length = 753 Back     alignment and structure
>pdb|4ENU|A Chain A, Structure Of The S234d Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|4ENQ|A Chain A, Structure Of E530d Variant E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1GGK|A Chain A, Crystal Structure Of Catalase Hpii From Escherichia Coli, Asn201his Variant. Length = 753 Back     alignment and structure
>pdb|3HB6|A Chain A, Inactive Mutant H54f Of Proteus Mirabilis Catalase Length = 484 Back     alignment and structure
>pdb|1E93|A Chain A, High Resolution Structure And Biochemical Properties Of A Recombinant Catalase Depleted In Iron Length = 484 Back     alignment and structure
>pdb|1M85|A Chain A, Structure Of Proteus Mirabilis Catalase For The Native Form Length = 484 Back     alignment and structure
>pdb|1H7K|A Chain A, Formation Of A Tyrosyl Radical Intermediate In Proteus Mirabilis Catalase By Directed Mutagenesis And Consequences For Nucleotide Reactivity Length = 483 Back     alignment and structure
>pdb|1YE9|A Chain A, Crystal Structure Of Proteolytically Truncated Catalase Hpii From E. Coli Length = 226 Back     alignment and structure
>pdb|1QWL|A Chain A, Structure Of Helicobacter Pylori Catalase Length = 505 Back     alignment and structure
>pdb|2A9E|A Chain A, Helicobacter Pylori Catalase Compound I Length = 505 Back     alignment and structure
>pdb|1A4E|A Chain A, Catalase A From Saccharomyces Cerevisiae Length = 488 Back     alignment and structure
>pdb|2XQ1|A Chain A, Crystal Structure Of Peroxisomal Catalase From The Yeast Hansenula Polymorpha Length = 509 Back     alignment and structure
>pdb|2J2M|A Chain A, Crystal Structure Analysis Of Catalase From Exiguobacterium Oxidotolerans Length = 491 Back     alignment and structure
>pdb|1HBZ|A Chain A, Catalase From Micrococcus Lysodeikticu Length = 498 Back     alignment and structure
>pdb|4AUE|A Chain A, Crystal Structure, Recombinant Expression And Mutagenesis Studies Of The Bifunctional Catalase-phenol Oxidase From Scytalidium Thermophilum Length = 717 Back     alignment and structure
>pdb|4AUL|A Chain A, Crystal Structure, Recombinant Expression And Mutagenesis Studies Of The Bifunctional Catalase-phenol Oxidase From Scytalidium Thermophilum Length = 719 Back     alignment and structure
>pdb|4AUM|A Chain A, Crystal Structure, Recombinant Expression And Mutagenesis Studies Of The Bifunctional Catalase-phenol Oxidase From Scytalidium Thermophilum Length = 719 Back     alignment and structure
>pdb|2XF2|A Chain A, Pvc-At Length = 688 Back     alignment and structure
>pdb|4AUN|A Chain A, Crystal Structure, Recombinant Expression And Mutagenesis Studies Of The Bifunctional Catalase-phenol Oxidase From Scytalidium Thermophilum Length = 719 Back     alignment and structure
>pdb|1GWF|A Chain A, Compound Ii Structure Of Micrococcus Lysodeikticus Catalase Length = 503 Back     alignment and structure
>pdb|1GWH|A Chain A, Atomic Resolution Structure Of Micrococcus Lysodeikticus Catalase Complexed With Nadph Length = 503 Back     alignment and structure
>pdb|2IUF|A Chain A, The Structures Of Penicillium Vitale Catalase: Resting State, Oxidised State (Compound I) And Complex With Aminotriazole Length = 688 Back     alignment and structure
>pdb|1M7S|A Chain A, Crystal Structure Analysis Of Catalase Catf Of Pseudomonas Syringae Length = 484 Back     alignment and structure
>pdb|3EJ6|A Chain A, Neurospora Crassa Catalase-3 Crystal Structure Length = 688 Back     alignment and structure
>pdb|1SY7|A Chain A, Crystal Structure Of The Catalase-1 From Neurospora Crassa, Native Structure At 1.75a Resolution. Length = 715 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query64
2isa_A 483 Catalase; peroxidase, heme, oxidoreductase, iron, 3e-40
1dgf_A 497 Catalase; heme, NADPH, hydrogen peroxide, oxidored 9e-40
2xq1_A 509 Peroxisomal catalase; oxidoreductase, hydrogen per 1e-39
1si8_A 484 Catalase; N-terminal ARM, anti-parallel beta-barre 1e-39
1qwl_A 505 KATA catalase; beta barrel, azide complex, oxyferr 1e-39
1gwe_A 503 Catalase; oxidoreductase, hdyrogen-peroxide:hydrog 2e-39
1m7s_A 484 Catalase; beta barrel, alpha helical domain, oxido 2e-39
2j2m_A 491 Catalase; functional class, oxidoreductase; HET: H 4e-39
1a4e_A 488 Catalase A; oxidoreductase, peroxidase; HET: HEM; 1e-37
3ttv_A 753 Catalase HPII; heme orientation, oxidoreductase; H 4e-36
3e4w_A 320 Putative uncharacterized protein; heme enzyme, cat 4e-35
1sy7_A 715 Catalase 1; heme oxidation, singlet oxygen, oxidor 6e-35
3ej6_A 688 Catalase-3; heme, hydrogen iron, metal-binding, ox 6e-35
1u5u_A 374 Allene oxide synthase-lipoxygenase protein; catala 3e-30
3dy5_A 1066 Allene oxide synthase-lipoxygenase protein; fusion 6e-27
2iuf_A 688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 2e-26
>2isa_A Catalase; peroxidase, heme, oxidoreductase, iron, hydrogen peroxide; HET: OMT HEM; 1.97A {Vibrio salmonicida} PDB: 1m85_A* 1mqf_A* 1nm0_A* 2cag_A* 2cah_A* 1e93_A* 1h7k_A* 1h6n_A* 3hb6_A* Length = 483 Back     alignment and structure
 Score =  135 bits (343), Expect = 3e-40
 Identities = 34/62 (54%), Positives = 42/62 (67%)

Query: 2   LQDWDAFWDFISLLPETTHQVMILFSDRGIPDGFRHMHGYGSHTFKLVNKDNEPVYCKFH 61
           ++     WDF + LPE  HQV I+ SDRGIP  +RHMHG+GSHTF  +N DNE  + KFH
Sbjct: 154 MRSAKNNWDFWTSLPEALHQVTIVMSDRGIPATYRHMHGFGSHTFSFINSDNERYWVKFH 213

Query: 62  FR 63
           F 
Sbjct: 214 FV 215
>1dgf_A Catalase; heme, NADPH, hydrogen peroxide, oxidoreductase; HET: HEM NDP; 1.50A {Homo sapiens} SCOP: e.5.1.1 PDB: 1dgg_A* 1f4j_A* 1qqw_A* 1dgh_A* 1dgb_A* 3rgp_A* 3re8_A* 3rgs_A* 3nwl_A* 4blc_A* 1th2_A* 1th3_A* 1th4_A* 1tgu_A* 7cat_A* 8cat_A* Length = 497 Back     alignment and structure
>2xq1_A Peroxisomal catalase; oxidoreductase, hydrogen peroxide detoxification, PTS1; HET: HEM; 2.90A {Pichia angusta} Length = 509 Back     alignment and structure
>1si8_A Catalase; N-terminal ARM, anti-parallel beta-barrel, wrapping region, terminal helical region, tetramer, heme group, oxidoreducta; HET: HEM; 2.30A {Enterococcus faecalis} SCOP: e.5.1.1 Length = 484 Back     alignment and structure
>1qwl_A KATA catalase; beta barrel, azide complex, oxyferryl complex, oxidoreductas; HET: HEM; 1.60A {Helicobacter pylori} SCOP: e.5.1.1 PDB: 1qwm_A* 2a9e_A* 2iqf_A* Length = 505 Back     alignment and structure
>1gwe_A Catalase; oxidoreductase, hdyrogen-peroxide:hydrogen peroxide oxidoreductase; HET: HEM; 0.88A {Micrococcus luteus} SCOP: e.5.1.1 PDB: 1gwh_A* 1hbz_A* 1gwf_A* Length = 503 Back     alignment and structure
>1m7s_A Catalase; beta barrel, alpha helical domain, oxidoreductase; HET: HEM; 1.80A {Pseudomonas syringae} SCOP: e.5.1.1 Length = 484 Back     alignment and structure
>2j2m_A Catalase; functional class, oxidoreductase; HET: HEM; 2.4A {Exiguobacterium oxidotolerans} Length = 491 Back     alignment and structure
>1a4e_A Catalase A; oxidoreductase, peroxidase; HET: HEM; 2.40A {Saccharomyces cerevisiae} SCOP: e.5.1.1 Length = 488 Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Length = 753 Back     alignment and structure
>3e4w_A Putative uncharacterized protein; heme enzyme, catalase, peroxidase, oxidoreductase; HET: HEM; 1.80A {Mycobacterium avium subsp} PDB: 3e4y_A* Length = 320 Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Length = 715 Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Length = 688 Back     alignment and structure
>1u5u_A Allene oxide synthase-lipoxygenase protein; catalase, heme, eicosanoid, fusion PR lyase; HET: HEM; 2.00A {Plexaura homomalla} SCOP: e.5.1.2 Length = 374 Back     alignment and structure
>3dy5_A Allene oxide synthase-lipoxygenase protein; fusion protein, BI-functional enzyme, dioxygenase, fatty ACI biosynthesis, heme, iron; HET: HEM; 3.51A {Plexaura homomalla} Length = 1066 Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Length = 688 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query64
3e4w_A 320 Putative uncharacterized protein; heme enzyme, cat 99.91
2isa_A 483 Catalase; peroxidase, heme, oxidoreductase, iron, 99.91
1m7s_A 484 Catalase; beta barrel, alpha helical domain, oxido 99.91
1gwe_A 503 Catalase; oxidoreductase, hdyrogen-peroxide:hydrog 99.91
1dgf_A 497 Catalase; heme, NADPH, hydrogen peroxide, oxidored 99.91
1si8_A 484 Catalase; N-terminal ARM, anti-parallel beta-barre 99.91
2j2m_A 491 Catalase; functional class, oxidoreductase; HET: H 99.91
3ttv_A 753 Catalase HPII; heme orientation, oxidoreductase; H 99.91
3ej6_A 688 Catalase-3; heme, hydrogen iron, metal-binding, ox 99.91
1qwl_A 505 KATA catalase; beta barrel, azide complex, oxyferr 99.91
2xq1_A 509 Peroxisomal catalase; oxidoreductase, hydrogen per 99.91
1a4e_A 488 Catalase A; oxidoreductase, peroxidase; HET: HEM; 99.9
2iuf_A 688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 99.89
1sy7_A 715 Catalase 1; heme oxidation, singlet oxygen, oxidor 99.88
1u5u_A 374 Allene oxide synthase-lipoxygenase protein; catala 99.83
3dy5_A 1066 Allene oxide synthase-lipoxygenase protein; fusion 99.8
>3e4w_A Putative uncharacterized protein; heme enzyme, catalase, peroxidase, oxidoreductase; HET: HEM; 1.80A {Mycobacterium avium subsp} PDB: 3e4y_A* Back     alignment and structure
Probab=99.91  E-value=1.3e-25  Score=155.01  Aligned_cols=63  Identities=16%  Similarity=0.269  Sum_probs=61.0

Q ss_pred             CCCchhHHHHHhcCchHHHHHHHHHhCCCCCCCcCCCccccceeeEEEcCCCCeEEEEEEEeC
Q psy12898          2 LQDWDAFWDFISLLPETTHQVMILFSDRGIPDGFRHMHGYGSHTFKLVNKDNEPVYCKFHFRQ   64 (64)
Q Consensus         2 l~D~~~~~df~~~~Pes~~~~~~~~s~~g~P~s~~~~~~~gvhtfk~vn~~G~~~~Vr~~~~~   64 (64)
                      ++||+++|||++.+||++||++|+++++|+|+||++|+|||+|||+|+|++|+.+||||||++
T Consensus       131 ~~d~~~~~df~~~~Pes~h~~~~l~s~rg~p~s~~~~~~~s~htf~~~n~~G~~~~vK~~~~p  193 (320)
T 3e4w_A          131 LTTPLRLATHLLTHPRLLGALPLLREANRIPASYATTEYHGLHAFRWIAADGSARFVRYHLVP  193 (320)
T ss_dssp             TTHHHHHHHHHHHCHHHHTTHHHHHHHTCEESCGGGSCEEEEEEEEEECTTSCEEEEEEEEEE
T ss_pred             CCCHHHHHHHHHhCHhHHHHHHHHhccCCCCCCcccCCccccccEEEEcCCCCEEEEEEEEEe
Confidence            478999999999999999999999999999999999999999999999999999999999984
>2isa_A Catalase; peroxidase, heme, oxidoreductase, iron, hydrogen peroxide; HET: OMT HEM; 1.97A {Vibrio salmonicida} PDB: 1m85_A* 1mqf_A* 1nm0_A* 2cag_A* 2cah_A* 1e93_A* 1h7k_A* 1h6n_A* 3hb6_A* Back     alignment and structure
>1m7s_A Catalase; beta barrel, alpha helical domain, oxidoreductase; HET: HEM; 1.80A {Pseudomonas syringae} SCOP: e.5.1.1 Back     alignment and structure
>1gwe_A Catalase; oxidoreductase, hdyrogen-peroxide:hydrogen peroxide oxidoreductase; HET: HEM; 0.88A {Micrococcus luteus} SCOP: e.5.1.1 PDB: 1gwh_A* 1hbz_A* 1gwf_A* Back     alignment and structure
>1dgf_A Catalase; heme, NADPH, hydrogen peroxide, oxidoreductase; HET: HEM NDP; 1.50A {Homo sapiens} SCOP: e.5.1.1 PDB: 1dgg_A* 1f4j_A* 1qqw_A* 1dgh_A* 1dgb_A* 3rgp_A* 3re8_A* 3rgs_A* 3nwl_A* 4blc_A* 1th2_A* 1th3_A* 1th4_A* 1tgu_A* 7cat_A* 8cat_A* Back     alignment and structure
>1si8_A Catalase; N-terminal ARM, anti-parallel beta-barrel, wrapping region, terminal helical region, tetramer, heme group, oxidoreducta; HET: HEM; 2.30A {Enterococcus faecalis} SCOP: e.5.1.1 Back     alignment and structure
>2j2m_A Catalase; functional class, oxidoreductase; HET: HEM; 2.4A {Exiguobacterium oxidotolerans} Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Back     alignment and structure
>1qwl_A KATA catalase; beta barrel, azide complex, oxyferryl complex, oxidoreductas; HET: HEM; 1.60A {Helicobacter pylori} SCOP: e.5.1.1 PDB: 1qwm_A* 2a9e_A* 2iqf_A* Back     alignment and structure
>2xq1_A Peroxisomal catalase; oxidoreductase, hydrogen peroxide detoxification, PTS1; HET: HEM; 2.90A {Pichia angusta} Back     alignment and structure
>1a4e_A Catalase A; oxidoreductase, peroxidase; HET: HEM; 2.40A {Saccharomyces cerevisiae} SCOP: e.5.1.1 Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Back     alignment and structure
>1u5u_A Allene oxide synthase-lipoxygenase protein; catalase, heme, eicosanoid, fusion PR lyase; HET: HEM; 2.00A {Plexaura homomalla} SCOP: e.5.1.2 Back     alignment and structure
>3dy5_A Allene oxide synthase-lipoxygenase protein; fusion protein, BI-functional enzyme, dioxygenase, fatty ACI biosynthesis, heme, iron; HET: HEM; 3.51A {Plexaura homomalla} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 64
d1p80a2 571 e.5.1.1 (A:27-597) Catalase II {Escherichia coli, 7e-26
d1si8a_ 474 e.5.1.1 (A:) Catalase I {Enterococcus faecalis [Ta 8e-26
d1dgfa_ 497 e.5.1.1 (A:) Catalase I {Human (Homo sapiens) [Tax 1e-25
d1qwla_ 491 e.5.1.1 (A:) Catalase I {Helicobacter pylori [TaxI 3e-25
d1e93a_ 476 e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 5e-25
d1gwea_ 498 e.5.1.1 (A:) Catalase I {Micrococcus lysodeikticus 5e-25
d1m7sa_ 484 e.5.1.1 (A:) Catalase I {Pseudomonas syringae [Tax 2e-24
d1u5ua_ 366 e.5.1.2 (A:) Allene oxide synthase-lipoxygenase pr 5e-24
d1a4ea_ 488 e.5.1.1 (A:) Catalase I {Baker's yeast (Saccharomy 1e-23
>d1p80a2 e.5.1.1 (A:27-597) Catalase II {Escherichia coli, HPII [TaxId: 562]} Length = 571 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Heme-dependent catalase-like
superfamily: Heme-dependent catalase-like
family: Heme-dependent catalases
domain: Catalase II
species: Escherichia coli, HPII [TaxId: 562]

 Score = 95.8 bits (238), Expect = 7e-26
 Identities = 29/62 (46%), Positives = 41/62 (66%)

Query: 2   LQDWDAFWDFISLLPETTHQVMILFSDRGIPDGFRHMHGYGSHTFKLVNKDNEPVYCKFH 61
               D FWD++SL PET H VM   SDRGIP  +R M G+G HTF+L+N + +  + +FH
Sbjct: 207 QSAHDTFWDYVSLQPETLHNVMWAMSDRGIPRSYRTMEGFGIHTFRLINAEGKATFVRFH 266

Query: 62  FR 63
           ++
Sbjct: 267 WK 268
>d1si8a_ e.5.1.1 (A:) Catalase I {Enterococcus faecalis [TaxId: 1351]} Length = 474 Back     information, alignment and structure
>d1dgfa_ e.5.1.1 (A:) Catalase I {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1qwla_ e.5.1.1 (A:) Catalase I {Helicobacter pylori [TaxId: 210]} Length = 491 Back     information, alignment and structure
>d1e93a_ e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 584]} Length = 476 Back     information, alignment and structure
>d1gwea_ e.5.1.1 (A:) Catalase I {Micrococcus lysodeikticus [TaxId: 1270]} Length = 498 Back     information, alignment and structure
>d1m7sa_ e.5.1.1 (A:) Catalase I {Pseudomonas syringae [TaxId: 317]} Length = 484 Back     information, alignment and structure
>d1u5ua_ e.5.1.2 (A:) Allene oxide synthase-lipoxygenase protein, N-terminal domain {Black sea rod (Plexaura homomalla) [TaxId: 47982]} Length = 366 Back     information, alignment and structure
>d1a4ea_ e.5.1.1 (A:) Catalase I {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 488 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query64
d1si8a_ 474 Catalase I {Enterococcus faecalis [TaxId: 1351]} 99.87
d1p80a2 571 Catalase II {Escherichia coli, HPII [TaxId: 562]} 99.86
d1qwla_ 491 Catalase I {Helicobacter pylori [TaxId: 210]} 99.86
d1m7sa_ 484 Catalase I {Pseudomonas syringae [TaxId: 317]} 99.85
d1dgfa_ 497 Catalase I {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1gwea_ 498 Catalase I {Micrococcus lysodeikticus [TaxId: 1270 99.85
d1a4ea_ 488 Catalase I {Baker's yeast (Saccharomyces cerevisia 99.84
d1e93a_ 476 Catalase I {Proteus mirabilis [TaxId: 584]} 99.84
d1u5ua_ 366 Allene oxide synthase-lipoxygenase protein, N-term 99.74
d1pgja1300 6-phosphogluconate dehydrogenase (6PGD) {Trypanoso 85.17
>d1si8a_ e.5.1.1 (A:) Catalase I {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Heme-dependent catalase-like
superfamily: Heme-dependent catalase-like
family: Heme-dependent catalases
domain: Catalase I
species: Enterococcus faecalis [TaxId: 1351]

Probab=99.87  E-value=7.4e-23  Score=145.13  Aligned_cols=63  Identities=59%  Similarity=1.013  Sum_probs=61.1

Q ss_pred             CCCchhHHHHHhcCchHHHHHHHHHhCCCCCCCcCCCccccceeeEEEcCCCCeEEEEEEEeC
Q psy12898          2 LQDWDAFWDFISLLPETTHQVMILFSDRGIPDGFRHMHGYGSHTFKLVNKDNEPVYCKFHFRQ   64 (64)
Q Consensus         2 l~D~~~~~df~~~~Pes~~~~~~~~s~~g~P~s~~~~~~~gvhtfk~vn~~G~~~~Vr~~~~~   64 (64)
                      ++||+++|||++.|||++|+++|+++++|+|+||++|+|||+|||+|+|++|+.+||||+|++
T Consensus       152 ~~d~~~~~~f~~~~Pes~~~~~~l~s~r~~P~sy~~~~~~g~htf~~vn~~G~~~~vK~~~~P  214 (474)
T d1si8a_         152 LKSPEAVWDFWSHSPESLHQVTILMSDRGIPLSFRHMHGFGSHTFKWVNAAGEVFFVKYHFKT  214 (474)
T ss_dssp             SBCHHHHHHHHHTCGGGHHHHHHHHSGGGSBSCGGGSCEECCSCEEEECTTCCEEEEEEEEEE
T ss_pred             CCChHHHHHHHhcCHHHHHHHHHHhccCCCCCccCCCcccccceEEEEccCCCEEEEEEEEEe
Confidence            578999999999999999999999999999999999999999999999999999999999974
>d1p80a2 e.5.1.1 (A:27-597) Catalase II {Escherichia coli, HPII [TaxId: 562]} Back     information, alignment and structure
>d1qwla_ e.5.1.1 (A:) Catalase I {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1m7sa_ e.5.1.1 (A:) Catalase I {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1dgfa_ e.5.1.1 (A:) Catalase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gwea_ e.5.1.1 (A:) Catalase I {Micrococcus lysodeikticus [TaxId: 1270]} Back     information, alignment and structure
>d1a4ea_ e.5.1.1 (A:) Catalase I {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e93a_ e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1u5ua_ e.5.1.2 (A:) Allene oxide synthase-lipoxygenase protein, N-terminal domain {Black sea rod (Plexaura homomalla) [TaxId: 47982]} Back     information, alignment and structure
>d1pgja1 a.100.1.1 (A:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure