Psyllid ID: psy12933


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60-----
MLKDLKCETSQSNSKEEAQSSAPHNQTPGHLIECTLNPGDMLYIPPKVWHHVRSLSTSISVSFWF
ccccccccccccccccccccccccccccccEEEEEEccccEEEEccccEEEEEEcccEEEEEEEc
ccccccccccccccccccccccccccccHHHEHEEEccccEEEEccccEEEEEEccccEEEEEEc
mlkdlkcetsqsnskeeaqssaphnqtpghliectlnpgdmlyippkvwHHVRSLSTSISVSFWF
mlkdlkcetsqsnskeeaqssaphnqtpgHLIECTLNPGDMLYIPPKVWHHVRSLSTSISVSFWF
MLKDLKCETSQSNSKEEAQSSAPHNQTPGHLIECTLNPGDMLYIPPKVWHHVRSLSTSISVSFWF
*****************************HLIECTLNPGDMLYIPPKVWHHVRSLSTSISVSFW*
ML*****ETSQSNSKEEAQSSAPHNQTPGHLIECTLNPGDMLYIPPKVWHHVRSLSTSISVSFWF
*************************QTPGHLIECTLNPGDMLYIPPKVWHHVRSLSTSISVSFWF
******************QSSAPHNQTPGHLIECTLNPGDMLYIPPKVWHHVRSLSTSISVSFWF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooo
ooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKDLKCETSQSNSKEEAQSSAPHNQTPGHLIECTLNPGDMLYIPPKVWHHVRSLSTSISVSFWF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query65 2.2.26 [Sep-21-2011]
Q9CXT6414 Lysine-specific demethyla yes N/A 0.6 0.094 0.564 6e-07
Q497B8414 Lysine-specific demethyla yes N/A 0.6 0.094 0.564 6e-07
B5XF11404 Lysine-specific demethyla N/A N/A 0.523 0.084 0.617 1e-06
Q54LV7 415 JmjC domain-containing pr yes N/A 0.538 0.084 0.571 3e-06
Q8N371416 Lysine-specific demethyla yes N/A 0.538 0.084 0.542 3e-06
B2GUS6443 Lysine-specific demethyla yes N/A 0.861 0.126 0.421 4e-06
Q1JP61406 Lysine-specific demethyla yes N/A 0.538 0.086 0.542 1e-05
A8E534406 Lysine-specific demethyla yes N/A 0.507 0.081 0.606 2e-05
Q55DF5448 JmjC domain-containing pr no N/A 0.753 0.109 0.406 0.0003
>sp|Q9CXT6|KDM8_MOUSE Lysine-specific demethylase 8 OS=Mus musculus GN=Kdm8 PE=2 SV=1 Back     alignment and function desciption
 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 27/39 (69%)

Query: 27  TPGHLIECTLNPGDMLYIPPKVWHHVRSLSTSISVSFWF 65
           T    + C L+PGD L+IP K WH+VRSL  S SVSFW+
Sbjct: 375 TEAPFLSCILSPGDTLFIPAKYWHYVRSLDLSFSVSFWW 413




Histone demethylase required for G2/M phase cell cycle progression. Specifically demethylates dimethylated 'Lys-36' (H3K36me2) of histone H3, an epigenetic repressive mark, thereby acting as a transcription activator. Regulates expression of CCNA1 (cyclin-A1).
Mus musculus (taxid: 10090)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 1EC: .EC: 2EC: 7
>sp|Q497B8|KDM8_RAT Lysine-specific demethylase 8 OS=Rattus norvegicus GN=Kdm8 PE=2 SV=1 Back     alignment and function description
>sp|B5XF11|KDM8_SALSA Lysine-specific demethylase 8 OS=Salmo salar GN=kdm8 PE=2 SV=1 Back     alignment and function description
>sp|Q54LV7|JMJCC_DICDI JmjC domain-containing protein C OS=Dictyostelium discoideum GN=jcdC PE=4 SV=2 Back     alignment and function description
>sp|Q8N371|KDM8_HUMAN Lysine-specific demethylase 8 OS=Homo sapiens GN=KDM8 PE=1 SV=1 Back     alignment and function description
>sp|B2GUS6|KDM8_XENTR Lysine-specific demethylase 8 OS=Xenopus tropicalis GN=kdm8 PE=2 SV=1 Back     alignment and function description
>sp|Q1JP61|KDM8_BOVIN Lysine-specific demethylase 8 OS=Bos taurus GN=KDM8 PE=2 SV=1 Back     alignment and function description
>sp|A8E534|KDM8_DANRE Lysine-specific demethylase 8 OS=Danio rerio GN=kdm8 PE=2 SV=1 Back     alignment and function description
>sp|Q55DF5|JMJCD_DICDI JmjC domain-containing protein D OS=Dictyostelium discoideum GN=jcdD PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query65
348687306 253 hypothetical protein PHYSODRAFT_472104 [ 0.830 0.213 0.517 9e-09
260802959 409 hypothetical protein BRAFLDRAFT_76168 [B 0.861 0.136 0.491 1e-07
195650201 410 hypothetical protein [Zea mays] 0.538 0.085 0.714 1e-07
226497194 410 uncharacterized protein LOC100272621 [Ze 0.538 0.085 0.714 1e-07
242049646 414 hypothetical protein SORBIDRAFT_02g02837 0.892 0.140 0.491 2e-07
242024517 423 protein PTDSR-A, putative [Pediculus hum 0.861 0.132 0.482 4e-07
221130763 406 PREDICTED: lysine-specific demethylase 8 0.523 0.083 0.705 8e-07
298706548 495 conserved unknown protein [Ectocarpus si 0.938 0.123 0.442 8e-07
449476026 413 PREDICTED: lysine-specific demethylase 8 0.538 0.084 0.657 9e-07
449442507 219 PREDICTED: lysine-specific demethylase 8 0.923 0.273 0.442 9e-07
>gi|348687306|gb|EGZ27120.1| hypothetical protein PHYSODRAFT_472104 [Phytophthora sojae] Back     alignment and taxonomy information
 Score = 64.3 bits (155), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 30/58 (51%), Positives = 36/58 (62%), Gaps = 4/58 (6%)

Query: 12  SNSKEEAQSSAPHNQTP----GHLIECTLNPGDMLYIPPKVWHHVRSLSTSISVSFWF 65
           SN+ +       H Q P       +EC L  G+MLYIPPK WH+VRSLSTS SVSFW+
Sbjct: 195 SNTSQVQVEDPDHEQFPEFRRAKYVECVLREGEMLYIPPKYWHYVRSLSTSFSVSFWW 252




Source: Phytophthora sojae

Species: Phytophthora sojae

Genus: Phytophthora

Family:

Order: Peronosporales

Class:

Phylum:

Superkingdom: Eukaryota

>gi|260802959|ref|XP_002596359.1| hypothetical protein BRAFLDRAFT_76168 [Branchiostoma floridae] gi|229281614|gb|EEN52371.1| hypothetical protein BRAFLDRAFT_76168 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|195650201|gb|ACG44568.1| hypothetical protein [Zea mays] Back     alignment and taxonomy information
>gi|226497194|ref|NP_001140556.1| uncharacterized protein LOC100272621 [Zea mays] gi|194699968|gb|ACF84068.1| unknown [Zea mays] gi|414589825|tpg|DAA40396.1| TPA: hypothetical protein ZEAMMB73_788482 [Zea mays] Back     alignment and taxonomy information
>gi|242049646|ref|XP_002462567.1| hypothetical protein SORBIDRAFT_02g028370 [Sorghum bicolor] gi|241925944|gb|EER99088.1| hypothetical protein SORBIDRAFT_02g028370 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|242024517|ref|XP_002432674.1| protein PTDSR-A, putative [Pediculus humanus corporis] gi|212518144|gb|EEB19936.1| protein PTDSR-A, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|221130763|ref|XP_002165460.1| PREDICTED: lysine-specific demethylase 8-like [Hydra magnipapillata] Back     alignment and taxonomy information
>gi|298706548|emb|CBJ29518.1| conserved unknown protein [Ectocarpus siliculosus] Back     alignment and taxonomy information
>gi|449476026|ref|XP_004154619.1| PREDICTED: lysine-specific demethylase 8-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449442507|ref|XP_004139023.1| PREDICTED: lysine-specific demethylase 8-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query65
WB|WBGene00007387578 jmjd-5 [Caenorhabditis elegans 0.538 0.060 0.571 2.7e-08
TAIR|locus:2091861429 JMJD5 "AT3G20810" [Arabidopsis 0.892 0.135 0.440 3.5e-08
UNIPROTKB|G4MTF9532 MGG_01543 "JmjC domain-contain 0.861 0.105 0.431 1e-07
ZFIN|ZDB-GENE-040718-411406 kdm8 "lysine (K)-specific deme 0.507 0.081 0.636 1.3e-07
DICTYBASE|DDB_G0290869474 jcdF "transcription factor jum 0.553 0.075 0.611 1.4e-07
MGI|MGI:1924285414 Kdm8 "lysine (K)-specific deme 0.6 0.094 0.564 1.9e-07
RGD|1304823414 Kdm8 "lysine (K)-specific deme 0.6 0.094 0.564 1.9e-07
UNIPROTKB|B5XF11404 kdm8 "Lysine-specific demethyl 0.523 0.084 0.617 2.9e-07
UNIPROTKB|B2GUS6443 kdm8 "Lysine-specific demethyl 0.861 0.126 0.421 5.6e-07
UNIPROTKB|F1RFF8414 KDM8 "Uncharacterized protein" 0.523 0.082 0.588 1.4e-06
WB|WBGene00007387 jmjd-5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 123 (48.4 bits), Expect = 2.7e-08, Sum P(2) = 2.7e-08
 Identities = 20/35 (57%), Positives = 27/35 (77%)

Query:    31 LIECTLNPGDMLYIPPKVWHHVRSLSTSISVSFWF 65
             +++  +NPGD ++IP K WH VRS S SIS+SFWF
Sbjct:   543 VLDAVINPGDAIFIPEKWWHFVRSTSPSISISFWF 577


GO:0008080 "N-acetyltransferase activity" evidence=IEA
GO:0006974 "response to DNA damage stimulus" evidence=IMP
TAIR|locus:2091861 JMJD5 "AT3G20810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4MTF9 MGG_01543 "JmjC domain-containing protein 5" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-411 kdm8 "lysine (K)-specific demethylase 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290869 jcdF "transcription factor jumonji, jmjC domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:1924285 Kdm8 "lysine (K)-specific demethylase 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1304823 Kdm8 "lysine (K)-specific demethylase 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|B5XF11 kdm8 "Lysine-specific demethylase 8" [Salmo salar (taxid:8030)] Back     alignment and assigned GO terms
UNIPROTKB|B2GUS6 kdm8 "Lysine-specific demethylase 8" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|F1RFF8 KDM8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q497B8KDM8_RAT1, ., 1, 4, ., 1, 1, ., 2, 70.56410.60.0942yesN/A
Q1JP61KDM8_BOVIN1, ., 1, 4, ., 1, 1, ., 2, 70.54280.53840.0862yesN/A
A8E534KDM8_DANRE1, ., 1, 4, ., 1, 1, ., 2, 70.60600.50760.0812yesN/A
Q8N371KDM8_HUMAN1, ., 1, 4, ., 1, 1, ., 2, 70.54280.53840.0841yesN/A
Q54LV7JMJCC_DICDINo assigned EC number0.57140.53840.0843yesN/A
Q9CXT6KDM8_MOUSE1, ., 1, 4, ., 1, 1, ., 2, 70.56410.60.0942yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query65
pfam13621247 pfam13621, Cupin_8, Cupin-like domain 2e-12
pfam08007 319 pfam08007, Cupin_4, Cupin superfamily protein 2e-08
COG2850 383 COG2850, COG2850, Uncharacterized conserved protei 3e-05
pfam0788370 pfam07883, Cupin_2, Cupin domain 2e-04
pfam02373114 pfam02373, JmjC, JmjC domain, hydroxylase 0.004
>gnl|CDD|222269 pfam13621, Cupin_8, Cupin-like domain Back     alignment and domain information
 Score = 58.5 bits (142), Expect = 2e-12
 Identities = 19/37 (51%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 30  HLIECTLNPGDMLYIPPKVWHHVRSLS-TSISVSFWF 65
             +   L PGD LYIP   WHHVRSL   +I+V++WF
Sbjct: 205 KALVAELEPGDALYIPAGWWHHVRSLDDFNIAVNYWF 241


This cupin like domain shares similarity to the JmjC domain. Length = 247

>gnl|CDD|219693 pfam08007, Cupin_4, Cupin superfamily protein Back     alignment and domain information
>gnl|CDD|225406 COG2850, COG2850, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|219618 pfam07883, Cupin_2, Cupin domain Back     alignment and domain information
>gnl|CDD|202224 pfam02373, JmjC, JmjC domain, hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 65
PF13621251 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU 99.82
KOG2132|consensus355 99.16
PF08007 319 Cupin_4: Cupin superfamily protein; InterPro: IPR0 98.95
KOG2130|consensus 407 98.94
PF02373114 JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 98.86
KOG2131|consensus 427 98.82
COG2850 383 Uncharacterized conserved protein [Function unknow 98.35
KOG2508|consensus 437 97.47
COG2140209 Thermophilic glucose-6-phosphate isomerase and rel 97.15
KOG3706|consensus 629 97.01
PF06560182 GPI: Glucose-6-phosphate isomerase (GPI); InterPro 97.01
PF00190144 Cupin_1: Cupin; InterPro: IPR006045 This family re 96.9
PRK04190191 glucose-6-phosphate isomerase; Provisional 96.88
COG0662127 {ManC} Mannose-6-phosphate isomerase [Carbohydrate 96.81
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 96.76
KOG2508|consensus437 96.44
COG4101142 Predicted mannose-6-phosphate isomerase [Carbohydr 95.94
KOG1633|consensus 776 95.83
smart00835146 Cupin_1 Cupin. This family represents the conserve 95.65
TIGR03404367 bicupin_oxalic bicupin, oxalate decarboxylase fami 95.49
KOG2132|consensus355 95.47
PRK13290125 ectC L-ectoine synthase; Reviewed 95.42
PF0931382 DUF1971: Domain of unknown function (DUF1971); Int 95.17
COG1917131 Uncharacterized conserved protein, contains double 95.13
PF05523131 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 95.0
TIGR01221176 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en 95.0
TIGR03404 367 bicupin_oxalic bicupin, oxalate decarboxylase fami 94.6
PF13759101 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB 94.26
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 94.2
KOG2107|consensus179 94.2
PRK09943185 DNA-binding transcriptional repressor PuuR; Provis 94.07
PF03079157 ARD: ARD/ARD' family; InterPro: IPR004313 The two 93.95
TIGR03037159 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase 93.53
COG3450116 Predicted enzyme of the cupin superfamily [General 93.48
KOG1356|consensus889 93.44
PF01050151 MannoseP_isomer: Mannose-6-phosphate isomerase; In 93.39
PF02311136 AraC_binding: AraC-like ligand binding domain; Int 92.87
COG361599 TehB Uncharacterized protein/domain, possibly invo 92.73
COG1898173 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela 92.66
PF00908176 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer 92.51
PRK13264177 3-hydroxyanthranilate 3,4-dioxygenase; Provisional 92.22
TIGR02466201 conserved hypothetical protein. This family consis 91.92
PF13640100 2OG-FeII_Oxy_3: 2OG-Fe(II) oxygenase superfamily; 91.88
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 91.71
PRK15457233 ethanolamine utilization protein EutQ; Provisional 91.17
TIGR03214 260 ura-cupin putative allantoin catabolism protein. T 90.84
PRK15131 389 mannose-6-phosphate isomerase; Provisional 90.8
PF06249152 EutQ: Ethanolamine utilisation protein EutQ; Inter 90.79
TIGR02272 335 gentisate_1_2 gentisate 1,2-dioxygenase. This fami 90.7
PF15138112 Syncollin: Syncollin 90.5
PLN00212493 glutelin; Provisional 90.33
PRK05467226 Fe(II)-dependent oxygenase superfamily protein; Pr 89.62
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 89.25
TIGR00218 302 manA mannose-6-phosphate isomerase, class I. The n 88.76
PRK11171 266 hypothetical protein; Provisional 88.22
PLN02288 394 mannose-6-phosphate isomerase 87.91
PRK13502 282 transcriptional activator RhaR; Provisional 87.4
TIGR03027165 pepcterm_export putative polysaccharide export pro 86.4
PF12852186 Cupin_6: Cupin 86.29
COG4766176 EutQ Ethanolamine utilization protein [Amino acid 85.88
COG1482 312 ManA Phosphomannose isomerase [Carbohydrate transp 85.82
PRK11171266 hypothetical protein; Provisional 84.83
PRK13501 290 transcriptional activator RhaR; Provisional 84.55
PF07385225 DUF1498: Protein of unknown function (DUF1498); In 84.02
PF05721211 PhyH: Phytanoyl-CoA dioxygenase (PhyH); InterPro: 83.94
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 83.79
COG4297163 Uncharacterized protein containing double-stranded 82.81
smart00702178 P4Hc Prolyl 4-hydroxylase alpha subunit homologues 82.32
PRK13500 312 transcriptional activator RhaR; Provisional 81.4
>PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A Back     alignment and domain information
Probab=99.82  E-value=1.1e-20  Score=123.52  Aligned_cols=56  Identities=34%  Similarity=0.634  Sum_probs=41.1

Q ss_pred             eecccCCccccCccCCCCCCCCceEEEEECCCCEEEeCCCCeEEEEec--CC-eEEEEEeC
Q psy12933          8 ETSQSNSKEEAQSSAPHNQTPGHLIECTLNPGDMLYIPPKVWHHVRSL--ST-SISVSFWF   65 (65)
Q Consensus         8 ~s~~~~~~~d~~~~~~p~~~~~~~~~~~l~pGd~LyiP~~WwH~V~s~--~~-sisvn~w~   65 (65)
                      +|.++.+..|.  +.+|.++++++++++|+|||+||||+||||+|+++  ++ +||||+||
T Consensus       187 ~~~~d~~~~d~--~~~p~~~~~~~~~~~l~pGD~LfiP~gWwH~V~~~~~~~~sisvn~w~  245 (251)
T PF13621_consen  187 FSWVDPDNPDL--ERFPKFRKAPPYEVVLEPGDVLFIPPGWWHQVENLSDDDLSISVNYWF  245 (251)
T ss_dssp             BBSS-TTS--T--TT-CGGGG--EEEEEEETT-EEEE-TT-EEEEEESTTSSCEEEEEEEE
T ss_pred             eeeeeccChhh--hhhhhhccCceeEEEECCCeEEEECCCCeEEEEEcCCCCeEEEEEEEe
Confidence            45555544444  56999999999999999999999999999999999  65 99999997



...

>KOG2132|consensus Back     alignment and domain information
>PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors Back     alignment and domain information
>KOG2130|consensus Back     alignment and domain information
>PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] Back     alignment and domain information
>KOG2131|consensus Back     alignment and domain information
>COG2850 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2508|consensus Back     alignment and domain information
>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG3706|consensus Back     alignment and domain information
>PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 Back     alignment and domain information
>PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) Back     alignment and domain information
>PRK04190 glucose-6-phosphate isomerase; Provisional Back     alignment and domain information
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>KOG2508|consensus Back     alignment and domain information
>COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1633|consensus Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>KOG2132|consensus Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>PF09313 DUF1971: Domain of unknown function (DUF1971); InterPro: IPR015392 This uncharacterised domain is predominantly found in bacterial Tellurite resistance proteins Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] Back     alignment and domain information
>TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>PF13759 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A Back     alignment and domain information
>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>KOG2107|consensus Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] Back     alignment and domain information
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase Back     alignment and domain information
>COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] Back     alignment and domain information
>KOG1356|consensus Back     alignment and domain information
>PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 Back     alignment and domain information
>PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC Back     alignment and domain information
>COG3615 TehB Uncharacterized protein/domain, possibly involved in tellurite resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5 Back     alignment and domain information
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional Back     alignment and domain information
>TIGR02466 conserved hypothetical protein Back     alignment and domain information
>PF13640 2OG-FeII_Oxy_3: 2OG-Fe(II) oxygenase superfamily; PDB: 3DKQ_B 3GZE_D 3HQR_A 2Y34_A 2G1M_A 2G19_A 3OUI_A 3OUJ_A 2HBU_A 2Y33_A Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>PRK15457 ethanolamine utilization protein EutQ; Provisional Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>PRK15131 mannose-6-phosphate isomerase; Provisional Back     alignment and domain information
>PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine Back     alignment and domain information
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase Back     alignment and domain information
>PF15138 Syncollin: Syncollin Back     alignment and domain information
>PLN00212 glutelin; Provisional Back     alignment and domain information
>PRK05467 Fe(II)-dependent oxygenase superfamily protein; Provisional Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>TIGR00218 manA mannose-6-phosphate isomerase, class I Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>PLN02288 mannose-6-phosphate isomerase Back     alignment and domain information
>PRK13502 transcriptional activator RhaR; Provisional Back     alignment and domain information
>TIGR03027 pepcterm_export putative polysaccharide export protein, PEP-CTERM sytem-associated Back     alignment and domain information
>PF12852 Cupin_6: Cupin Back     alignment and domain information
>COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>COG1482 ManA Phosphomannose isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>PRK13501 transcriptional activator RhaR; Provisional Back     alignment and domain information
>PF07385 DUF1498: Protein of unknown function (DUF1498); InterPro: IPR010864 This family consists of several hypothetical bacterial proteins of around 225 residues in length Back     alignment and domain information
>PF05721 PhyH: Phytanoyl-CoA dioxygenase (PhyH); InterPro: IPR008775 This family is made up of several eukaryotic phytanoyl-CoA dioxygenase (PhyH) proteins as well as a number of bacterial deoxygenases Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] Back     alignment and domain information
>smart00702 P4Hc Prolyl 4-hydroxylase alpha subunit homologues Back     alignment and domain information
>PRK13500 transcriptional activator RhaR; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query65
4aap_A239 Crystal Structure Of Jmjd5 Domain Of Human Lysine-S 4e-07
4gjz_A235 Jmjd5 In Complex With 2-Oxoglutarate Length = 235 4e-07
4gjy_A235 Jmjd5 In Complex With N-Oxalylglycine Length = 235 4e-07
3uyj_A248 Crystal Structure Of Jmjd5 Catalytic Core Domain In 4e-07
1iz3_A349 Dimeric Structure Of Fih (Factor Inhibiting Hif) Le 1e-04
1mze_A351 Human Factor Inhibiting Hif (Fih1) Length = 351 2e-04
3d8c_A349 Factor Inhibiting Hif-1 Alpha D201g Mutant In Compl 2e-04
3kcx_A335 Factor Inhibiting Hif-1 Alpha In Complex With Clioq 2e-04
2ilm_A349 Factor Inhibiting Hif-1 Alpha D201a Mutant In Compl 2e-04
1h2k_A349 Factor Inhibiting Hif-1 Alpha In Complex With Hif-1 2e-04
2xum_A349 Factor Inhibiting Hif (Fih) Q239h Mutant In Complex 2e-04
2y0i_A352 Factor Inhibiting Hif-1 Alpha In Complex With Tanky 2e-04
>pdb|4AAP|A Chain A, Crystal Structure Of Jmjd5 Domain Of Human Lysine-Specific Demethylase 8 (Kdm8) In Complex With N-Oxalylglycine (Nog) Length = 239 Back     alignment and structure

Iteration: 1

Score = 49.7 bits (117), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 19/35 (54%), Positives = 27/35 (77%) Query: 31 LIECTLNPGDMLYIPPKVWHHVRSLSTSISVSFWF 65 + C L+PG++L+IP K WH+VR+L S SVSFW+ Sbjct: 204 FLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWW 238
>pdb|4GJZ|A Chain A, Jmjd5 In Complex With 2-Oxoglutarate Length = 235 Back     alignment and structure
>pdb|4GJY|A Chain A, Jmjd5 In Complex With N-Oxalylglycine Length = 235 Back     alignment and structure
>pdb|3UYJ|A Chain A, Crystal Structure Of Jmjd5 Catalytic Core Domain In Complex With Nickle And Alpha-Kg Length = 248 Back     alignment and structure
>pdb|1IZ3|A Chain A, Dimeric Structure Of Fih (Factor Inhibiting Hif) Length = 349 Back     alignment and structure
>pdb|1MZE|A Chain A, Human Factor Inhibiting Hif (Fih1) Length = 351 Back     alignment and structure
>pdb|3D8C|A Chain A, Factor Inhibiting Hif-1 Alpha D201g Mutant In Complex With Zn(Ii), Alpha-Ketoglutarate And Hif-1 Alpha 19mer Length = 349 Back     alignment and structure
>pdb|3KCX|A Chain A, Factor Inhibiting Hif-1 Alpha In Complex With Clioquinol Length = 335 Back     alignment and structure
>pdb|2ILM|A Chain A, Factor Inhibiting Hif-1 Alpha D201a Mutant In Complex With Fe(ii), Alpha-ketoglutarate And Hif-1 Alpha 35mer Length = 349 Back     alignment and structure
>pdb|1H2K|A Chain A, Factor Inhibiting Hif-1 Alpha In Complex With Hif-1 Alpha Fragment Peptide Length = 349 Back     alignment and structure
>pdb|2XUM|A Chain A, Factor Inhibiting Hif (Fih) Q239h Mutant In Complex With Zn(Ii), Nog And Asp-Substrate Peptide (20-Mer) Length = 349 Back     alignment and structure
>pdb|2Y0I|A Chain A, Factor Inhibiting Hif-1 Alpha In Complex With Tankyrase-2 (Tnks2) Fragment Peptide (21-Mer) Length = 352 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query65
3uyj_A248 Lysine-specific demethylase 8; jellyroll-like all 1e-16
3al5_A338 HTYW5, JMJC domain-containing protein C2ORF60; tRN 5e-16
3d8c_A349 Hypoxia-inducible factor 1 alpha inhibitor; FIH, H 2e-14
3k2o_A336 Bifunctional arginine demethylase and lysyl-hydro 2e-13
1vrb_A342 Putative asparaginyl hydroxylase; 2636534, structu 2e-11
4diq_A 489 Lysine-specific demethylase NO66; structural genom 8e-10
3kv9_A 397 JMJC domain-containing histone demethylation prote 4e-09
3k3o_A 371 PHF8, PHD finger protein 8; histone demethylase, c 2e-07
2xdv_A 442 MYC-induced nuclear antigen; ribosome biogenesis, 3e-07
3pua_A 392 GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe 1e-06
2yu1_A 451 JMJC domain-containing histone demethylation PROT; 4e-04
>3uyj_A Lysine-specific demethylase 8; jellyroll-like all beta fold, nuclear, oxidored; HET: AKG; 2.35A {Homo sapiens} PDB: 4aap_A* Length = 248 Back     alignment and structure
 Score = 69.4 bits (170), Expect = 1e-16
 Identities = 19/34 (55%), Positives = 27/34 (79%)

Query: 32  IECTLNPGDMLYIPPKVWHHVRSLSTSISVSFWF 65
           + C L+PG++L+IP K WH+VR+L  S SVSFW+
Sbjct: 214 LSCILSPGEILFIPVKYWHYVRALDLSFSVSFWW 247


>3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* Length = 338 Back     alignment and structure
>3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... Length = 349 Back     alignment and structure
>3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* Length = 336 Back     alignment and structure
>1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 Length = 342 Back     alignment and structure
>4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} Length = 489 Back     alignment and structure
>3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* Length = 397 Back     alignment and structure
>3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* Length = 371 Back     alignment and structure
>2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} Length = 442 Back     alignment and structure
>3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* Length = 392 Back     alignment and structure
>2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A Length = 451 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query65
4gjz_A235 Lysine-specific demethylase 8; JMJC, beta barrel, 99.88
3al5_A338 HTYW5, JMJC domain-containing protein C2ORF60; tRN 99.75
3d8c_A349 Hypoxia-inducible factor 1 alpha inhibitor; FIH, H 99.74
3k2o_A336 Bifunctional arginine demethylase and lysyl-hydro 99.5
1vrb_A342 Putative asparaginyl hydroxylase; 2636534, structu 99.49
3kv5_D 488 JMJC domain-containing histone demethylation prote 99.36
2yu1_A 451 JMJC domain-containing histone demethylation PROT; 99.28
3k3o_A 371 PHF8, PHD finger protein 8; histone demethylase, c 99.24
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 99.22
3kv9_A 397 JMJC domain-containing histone demethylation prote 99.18
3pua_A 392 GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe 99.14
2xdv_A 442 MYC-induced nuclear antigen; ribosome biogenesis, 99.02
4diq_A 489 Lysine-specific demethylase NO66; structural genom 99.0
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 98.91
2ypd_A392 Probable JMJC domain-containing histone demethyla 98.7
2xxz_A332 Lysine-specific demethylase 6B; oxidoreductase, hi 97.06
3bb6_A127 Uncharacterized protein YEAR; structural genomics, 96.77
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 96.72
3dl3_A119 Tellurite resistance protein B; X-RAY NESG VFR98 Q 96.68
3avr_A 531 Lysine-specific demethylase 6A; cupin superfamily, 96.66
1x82_A190 Glucose-6-phosphate isomerase; cupin superfamily, 96.59
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 96.58
1v70_A105 Probable antibiotics synthesis protein; structural 96.54
2opk_A112 Hypothetical protein; putative mannose-6-phosphate 96.53
3lag_A98 Uncharacterized protein RPA4178; functionally unkn 96.52
4ask_A 510 Lysine-specific demethylase 6B; oxidoreductase, KD 96.52
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 96.48
3d82_A102 Cupin 2, conserved barrel domain protein; structur 96.46
2q30_A110 Uncharacterized protein; double-stranded beta-heli 96.41
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 96.34
2oa2_A148 BH2720 protein; 10175341, structural genomics, joi 96.33
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 96.33
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 96.29
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 96.27
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 96.27
3nw4_A 368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 96.2
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 96.2
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 96.19
3h8u_A125 Uncharacterized conserved protein with double-STR 96.15
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 96.13
4axo_A151 EUTQ, ethanolamine utilization protein; structural 96.06
4i4a_A128 Similar to unknown protein; structural genomics, P 96.05
3lwc_A119 Uncharacterized protein; structural genomics, unkn 96.03
3rns_A 227 Cupin 2 conserved barrel domain protein; structura 95.98
1wlt_A196 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 95.94
2b8m_A117 Hypothetical protein MJ0764; structural genomics, 95.86
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 95.86
2o8q_A134 Hypothetical protein; cpuin-like fold, structural 95.79
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 95.77
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 95.76
2vqa_A 361 SLL1358 protein, MNCA; periplasmic binding protein 95.72
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 95.72
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 95.7
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 95.68
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 95.65
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 95.62
3bcw_A123 Uncharacterized protein; structural genomics, join 95.6
3bu7_A 394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 95.58
2d40_A354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 95.58
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 95.57
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 95.54
2ixk_A184 DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l 95.48
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 95.47
1ep0_A185 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race 95.47
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 95.47
2ea7_A434 7S globulin-1; beta barrel, cupin superfamily, pla 95.45
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 95.42
2pyt_A133 Ethanolamine utilization protein EUTQ; structural 95.42
1vr3_A191 Acireductone dioxygenase; 13543033, structural gen 95.36
1dzr_A183 DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 95.32
3ryk_A205 DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat 95.32
2d40_A 354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 95.3
2e9q_A459 11S globulin subunit beta; cucubitin, pumpkin SEED 95.3
1zrr_A179 E-2/E-2' protein; nickel, cupin, beta helix, methi 95.29
1uij_A416 Beta subunit of beta conglycinin; double-stranded 95.28
2y0o_A175 Probable D-lyxose ketol-isomerase; carbohydrate me 95.25
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 95.17
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 95.13
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 95.04
3ejk_A174 DTDP sugar isomerase; YP_390184.1, structural geno 95.02
3eqe_A171 Putative cystein deoxygenase; YUBC, SR112, NESG, s 95.0
1uij_A 416 Beta subunit of beta conglycinin; double-stranded 95.0
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, mang 94.99
1upi_A225 DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat 94.98
2ozi_A98 Hypothetical protein RPA4178; APC6210, putative pr 94.97
2phl_A397 Phaseolin; plant SEED storage protein(vicilin); HE 94.96
1y3t_A 337 Hypothetical protein YXAG; BI cupin, dioxygenase, 94.94
2c0z_A216 NOVW; isomerase, epimerase, antibiotic biosynthesi 94.92
1vj2_A126 Novel manganese-containing cupin TM1459; structura 94.88
2cav_A445 Protein (canavalin); vicilin, 7S SEED protein, dom 94.88
2d5f_A493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 94.86
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 94.85
2ea7_A 434 7S globulin-1; beta barrel, cupin superfamily, pla 94.78
2xlg_A 239 SLL1785 protein, CUCA; metal binding protein, cupi 94.76
2vpv_A166 Protein MIF2, MIF2P; nucleus, mitosis, centromere, 94.72
1oi6_A205 PCZA361.16; epimerase, vancomycin group antibiotic 94.69
3dxt_A354 JMJC domain-containing histone demethylation PROT; 94.68
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 94.68
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 94.6
3fz3_A531 Prunin; TREE NUT allergen, allergy, amandin, almon 94.56
2gm6_A208 Cysteine dioxygenase type I; structural genomics, 94.55
3h7j_A 243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 94.52
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 94.51
1nxm_A197 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell 94.37
3nw4_A368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 94.34
3d0j_A140 Uncharacterized protein CA_C3497; beta-barrel, str 94.17
1rc6_A 261 Hypothetical protein YLBA; structural genomics, NY 93.88
4hn1_A201 Putative 3-epimerase in D-allose pathway; 3'-monoe 93.85
1y3t_A337 Hypothetical protein YXAG; BI cupin, dioxygenase, 93.85
1juh_A350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 93.72
1sq4_A 278 GLXB, glyoxylate-induced protein; structural genom 93.72
1sef_A 274 Conserved hypothetical protein; structural genomic 93.54
3rns_A227 Cupin 2 conserved barrel domain protein; structura 93.49
2f4p_A147 Hypothetical protein TM1010; double-stranded beta- 93.46
4h7l_A157 Uncharacterized protein; structural genomics, PSI- 93.44
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 93.42
3qac_A465 11S globulin SEED storage protein; 11S SEED storag 93.21
3eln_A200 Cysteine dioxygenase type 1; peroxysulfenate, non- 93.1
1juh_A 350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 92.97
3s7i_A418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 92.95
2pa7_A141 DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug 92.91
1sef_A274 Conserved hypothetical protein; structural genomic 92.79
2ox0_A381 JMJC domain-containing histone demethylation PROT; 92.59
3uss_A211 Putative uncharacterized protein; cupin, three his 92.58
2arc_A164 ARAC, arabinose operon regulatory protein; transcr 92.57
1sfn_A246 Conserved hypothetical protein; structural genomic 92.54
4b29_A217 Dimethylsulfoniopropionate lyase; hydrolase, dimet 92.36
1sfn_A 246 Conserved hypothetical protein; structural genomic 92.0
3opt_A373 DNA damage-responsive transcriptional repressor R; 91.72
2cav_A 445 Protein (canavalin); vicilin, 7S SEED protein, dom 91.27
1zx5_A 300 Mannosephosphate isomerase, putative; STRU genomic 90.65
3es1_A172 Cupin 2, conserved barrel domain protein; YP_00116 90.64
1qwr_A 319 Mannose-6-phosphate isomerase; structural genomics 90.53
1dgw_Y93 Canavalin; duplicated swiss-roll beta barrels, loo 90.51
1fxz_A 476 Glycinin G1; proglycinin, legumin, SEED storage pr 90.01
2wfp_A 394 Mannose-6-phosphate isomerase; APO-structure, meta 89.84
1pmi_A 440 PMI, phosphomannose isomerase; aldose-ketose isome 89.79
3i3q_A211 Alpha-ketoglutarate-dependent dioxygenase ALKB; be 89.62
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 89.39
3s7i_A 418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 89.26
3es4_A116 Uncharacterized protein DUF861 with A RMLC-like C; 89.08
1yfu_A174 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid 88.62
3qac_A 465 11S globulin SEED storage protein; 11S SEED storag 88.61
4e2q_A 266 Ureidoglycine aminohydrolase; BI-cupin, manganese 88.25
2o1q_A145 Putative acetyl/propionyl-COA carboxylase, alpha; 88.13
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 88.01
2e9q_A 459 11S globulin subunit beta; cucubitin, pumpkin SEED 87.96
2rg4_A216 Uncharacterized protein; rhodobacterales, oceanico 87.84
2d5f_A 493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 87.51
3c3v_A 510 Arachin ARAH3 isoform; peanut allergen, allergy, g 87.06
3s57_A204 Alpha-ketoglutarate-dependent dioxygenase ALKB HO; 87.03
3myx_A238 Uncharacterized protein pspto_0244; protein of unk 86.87
1yud_A170 Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p 86.82
1zvf_A176 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b 85.83
2qnk_A286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 85.78
3kgl_A 466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 85.57
3gbg_A 276 TCP pilus virulence regulatory protein; cupin, hel 84.82
3ksc_A 496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 84.32
3ebr_A159 Uncharacterized RMLC-like cupin; structural genomi 83.6
3kmh_A246 D-lyxose isomerase; cupin beta-barrel, structural 82.59
3dkq_A243 PKHD-type hydroxylase SBAL_3634; putative oxygenas 81.08
2rdq_A288 1-deoxypentalenic acid 11-beta hydroxylase; Fe(II 81.02
>4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* Back     alignment and structure
Probab=99.88  E-value=4.3e-23  Score=132.91  Aligned_cols=58  Identities=33%  Similarity=0.685  Sum_probs=50.5

Q ss_pred             cceecccCCccccCccCCCCCCCCceEEEEECCCCEEEeCCCCeEEEEecCCeEEEEEeC
Q psy12933          6 KCETSQSNSKEEAQSSAPHNQTPGHLIECTLNPGDMLYIPPKVWHHVRSLSTSISVSFWF   65 (65)
Q Consensus         6 ~~~s~~~~~~~d~~~~~~p~~~~~~~~~~~l~pGd~LyiP~~WwH~V~s~~~sisvn~w~   65 (65)
                      ...|.++.+..|.  +++|++++++.++++|+|||+||||+||||+|++++.|||||+||
T Consensus       177 ~~~s~vd~~~~d~--~~~p~~~~~~~~~~~l~pGD~LyiP~gW~H~V~~l~~sisvn~w~  234 (235)
T 4gjz_A          177 HNTSQVDVENPDL--EKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWW  234 (235)
T ss_dssp             TTBBSSCTTSCCT--TTCGGGGGCCCEEEEECTTCEEEECTTCEEEEEESSSEEEEEEEE
T ss_pred             CccccccccCcch--hhCccccCCCcEEEEECCCCEEEeCCCCcEEEEECCCEEEEEEec
Confidence            3455665555444  469999999999999999999999999999999999999999998



>3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* Back     alignment and structure
>3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... Back     alignment and structure
>3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* Back     alignment and structure
>1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A Back     alignment and structure
>3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* Back     alignment and structure
>3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* Back     alignment and structure
>2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} Back     alignment and structure
>4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>2ypd_A Probable JMJC domain-containing histone demethyla PROT EIN 2C; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>2xxz_A Lysine-specific demethylase 6B; oxidoreductase, histone demethylation, oxygenase, chromatin modification; HET: 8XQ; 1.80A {Homo sapiens} Back     alignment and structure
>3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13 Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>3dl3_A Tellurite resistance protein B; X-RAY NESG VFR98 Q5E3X2_VIBF1, structural genomics, PSI-2, protein structure initiative; 2.30A {Vibrio fischeri ES114} SCOP: b.82.2.13 Back     alignment and structure
>3avr_A Lysine-specific demethylase 6A; cupin superfamily, TRI/dimethyllysine demethylase, oxidoredu structural protein complex; HET: M3L OGA EDO; 1.80A {Homo sapiens} PDB: 3avs_A* Back     alignment and structure
>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Back     alignment and structure
>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} Back     alignment and structure
>3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} Back     alignment and structure
>4ask_A Lysine-specific demethylase 6B; oxidoreductase, KDM6B, GSK-J1, inhibitor, lysine specific HI demethylase; HET: K0I; 1.86A {Homo sapiens} PDB: 2xue_A* 4eyu_A* 4ez4_A* 4ezh_A* Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} Back     alignment and structure
>4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A Back     alignment and structure
>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Back     alignment and structure
>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Back     alignment and structure
>1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 Back     alignment and structure
>1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* Back     alignment and structure
>3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str} Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A Back     alignment and structure
>2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} Back     alignment and structure
>1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A Back     alignment and structure
>3dxt_A JMJC domain-containing histone demethylation PROT; JMJD2D, histone demethylase, H3K9, jumonji domain-CONT protein 2D, oxidoreductase; 1.80A {Homo sapiens} PDB: 3dxu_A* 4hon_A* 4hoo_A 2w2i_A* Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>4hn1_A Putative 3-epimerase in D-allose pathway; 3'-monoepimerase, natural product, deoxysugar, chalcomycin, mycinose, cupin fold; HET: TYD THM; 1.60A {Streptomyces bikiniensis} PDB: 4hmz_A* 4hn0_A Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>2ox0_A JMJC domain-containing histone demethylation PROT; double-stranded beta helix, demethylase, oxygenase, SGC, STR genomics, structural genomics consortium, oxidoreductase; HET: MLY ALY OGA; 1.95A {Homo sapiens} PDB: 2oq7_A* 2os2_A* 2ot7_A* 2oq6_A* 2vd7_A* 2ybk_A* 2ybp_A* 2ybs_A* 3njy_A* 3pdq_A* 3u4s_A* 2p5b_A* 2q8c_A* 2q8d_A* 2q8e_A* 2gp5_A* 2gp3_A* 2wwj_A* 2pxj_A* 2xml_A* Back     alignment and structure
>3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 Back     alignment and structure
>2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>3opt_A DNA damage-responsive transcriptional repressor R; RPH1, histone demethylase, catalytic core, oxidoreductase; HET: DNA AKG; 2.20A {Saccharomyces cerevisiae} PDB: 3opw_A* Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3 Back     alignment and structure
>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 Back     alignment and structure
>1dgw_Y Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_Y Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>2wfp_A Mannose-6-phosphate isomerase; APO-structure, metal-binding; 1.67A {Salmonella typhimurium} PDB: 3h1w_A 3h1m_A 3h1y_A* Back     alignment and structure
>1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3 Back     alignment and structure
>3i3q_A Alpha-ketoglutarate-dependent dioxygenase ALKB; beta jellyroll, DNA damage, DNA repair, iron, M binding, oxidoreductase; HET: AKG; 1.40A {Escherichia coli} SCOP: b.82.2.10 PDB: 2fd8_A* 2fdg_A* 2fdh_A* 2fdf_A* 2fdj_A 2fdk_A* 2fdi_A* 3i2o_A* 3i3m_A* 3i49_A* 3t4h_B* 3t3y_A* 3t4v_A* 3o1t_A* 3o1o_A* 3o1m_A* 3o1r_A* 3o1s_A* 3o1p_A* 3o1u_A* ... Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} Back     alignment and structure
>1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>2rg4_A Uncharacterized protein; rhodobacterales, oceanicola granulosus HTCC2516, Q2CBJ1_9RHO structural genomics, PSI-2; 1.90A {Oceanicola granulosus} PDB: 3bvc_A Back     alignment and structure
>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>3s57_A Alpha-ketoglutarate-dependent dioxygenase ALKB HO; protein-DNA complex, jelly-roll fold, dioxygenase, dsDNA BIN plasma, oxidoreductase-DNA complex; HET: AKG; 1.60A {Homo sapiens} PDB: 3s5a_A* 3rzg_A 3rzl_A 3rzh_A* 3rzj_A* 3rzk_A* 3rzm_A 3bty_A* 3buc_A* 3h8r_A* 3h8o_A* 3h8x_A* 3btx_A* 3bu0_A* 3btz_A* Back     alignment and structure
>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Back     alignment and structure
>1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16 Back     alignment and structure
>1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} Back     alignment and structure
>3kmh_A D-lyxose isomerase; cupin beta-barrel, structural genomics, montreal-kingston BA structural genomics initiative, BSGI; 1.58A {Escherichia coli O157} PDB: 3mpb_A* Back     alignment and structure
>3dkq_A PKHD-type hydroxylase SBAL_3634; putative oxygenase, structural genomics, JOI for structural genomics, JCSG; 2.26A {Shewanella baltica OS155} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 65
d1h2ka_335 b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibit 6e-11
d1vrba1319 b.82.2.11 (A:8-326) Putative asparaginyl hydroxyla 7e-11
d3bb6a1109 b.82.2.13 (A:1-109) Uncharacterized protein YeaR { 9e-05
d1sefa_250 b.82.1.11 (A:) Hypothetical protein EF2996 {Entero 0.003
d1j58a_ 372 b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B 0.003
d1rc6a_ 253 b.82.1.11 (A:) Hypothetical protein YlbA {Escheric 0.004
>d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: Clavaminate synthase-like
family: Hypoxia-inducible factor HIF ihhibitor (FIH1)
domain: Hypoxia-inducible factor HIF ihhibitor (FIH1)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 53.4 bits (127), Expect = 6e-11
 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 3/39 (7%)

Query: 30  HLIECTLNPGDMLYIPPKVWHHVRSL---STSISVSFWF 65
              E  + PGD+LYIP   WHH+ SL     +I+V+FW+
Sbjct: 245 VGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWY 283


>d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} Length = 319 Back     information, alignment and structure
>d3bb6a1 b.82.2.13 (A:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]} Length = 109 Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Length = 250 Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Length = 253 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query65
d1h2ka_335 Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum 99.77
d1vrba1319 Putative asparaginyl hydroxylase YxbC {Bacillus su 99.72
d1x82a_190 Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc 97.61
d3dl3a196 Tellurite resistance protein B, TehB {Vibrio fisch 97.45
d3bb6a1109 Uncharacterized protein YeaR {Escherichia coli [Ta 97.45
d1lr5a_160 Auxin binding protein {Maize (Zea mays) [TaxId: 45 97.1
d2bnma2122 Hydroxypropylphosphonic acid epoxidase Fom4, C-ter 96.91
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 96.88
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 96.82
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 96.67
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 96.64
d2et1a1201 Germin {Barley (Hordeum vulgare) [TaxId: 4513]} 96.48
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 96.47
d1j58a_ 372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 96.45
d2pyta1128 Ethanolamine utilization protein EutQ {Salmonella 96.43
d1uija1170 Seed storage 7S protein {Soybean (Glycine max), be 96.4
d1uika2185 Seed storage 7S protein {Soybean (Glycine max), be 96.36
d2phla2162 Seed storage 7S protein {French bean (Phaseolus vu 96.3
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 96.21
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 96.2
d2d40a1 308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 96.18
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 96.1
d1wlta1176 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo 96.01
d1y3ta1 330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 95.98
d2d40a1308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 95.95
d1dgwa_178 Seed storage 7S protein {Jack bean (Canavalia ensi 95.94
d1juha_ 348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 95.87
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 95.81
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 95.74
d1uika1203 Seed storage 7S protein {Soybean (Glycine max), be 95.73
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 95.66
d2phda1351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 95.48
d2pa7a1135 dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane 95.46
d2phda1 351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 95.45
d1y3ta1330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 95.38
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 94.99
d3bu7a1355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 94.99
d1oi6a_202 dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amyc 94.96
d1dzra_183 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone 94.91
d3bu7a1 355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 94.86
d1ep0a_183 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo 94.76
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 94.71
d1sfna_ 245 Hypothetical protein DR1152 {Deinococcus radiodura 94.69
d1zrra1179 Acireductone dioxygenase {Klebsiella pneumoniae [T 94.68
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 94.64
d2c0za1190 Novobiocin biosynthesis protein NovW {Streptomyces 94.53
d1sefa_ 250 Hypothetical protein EF2996 {Enterococcus faecalis 94.19
d1nxma_194 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto 94.08
d1vr3a1179 Acireductone dioxygenase {Mouse (Mus musculus) [Ta 93.99
d1juha_348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 93.94
d2ixha1184 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom 93.78
d2ixca1198 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac 93.55
d1rc6a_ 253 Hypothetical protein YlbA {Escherichia coli [TaxId 93.29
d1sq4a_ 273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 93.09
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 92.85
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 92.76
d2arca_161 Regulatory protein AraC {Escherichia coli [TaxId: 92.56
d1pmia_ 440 Phosphomannose isomerase {Yeast (Candida albicans) 92.43
d2phla1200 Seed storage 7S protein {French bean (Phaseolus vu 91.8
d1zx5a1 299 Putative mannosephosphate isomerase AF0035 {Archae 91.68
d1qwra_ 315 Mannose-6-phosphate isomerase ManA {Bacillus subti 90.17
d2iuwa1210 AlkB homolog 3 {Human (Homo sapiens) [TaxId: 9606] 88.13
d2gm6a1192 Cysteine dioxygenase type I {Ralstonia eutropha [T 87.34
d3elna1186 Cysteine dioxygenase type I {Rattus norvegicus [Ta 86.14
d1zvfa1175 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea 86.0
d2fcta1308 Syringomycin biosynthesis enzyme 2, SyrB2 {Pseudom 84.35
d1od5a1 245 Seed storage 7S protein {Soybean (Glycine max), gl 80.88
>d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: Clavaminate synthase-like
family: Hypoxia-inducible factor HIF ihhibitor (FIH1)
domain: Hypoxia-inducible factor HIF ihhibitor (FIH1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.77  E-value=2.2e-19  Score=121.25  Aligned_cols=57  Identities=32%  Similarity=0.568  Sum_probs=48.3

Q ss_pred             ceecccCCccccCccCCCCCCCCceEEEEECCCCEEEeCCCCeEEEEecCC---eEEEEEeC
Q psy12933          7 CETSQSNSKEEAQSSAPHNQTPGHLIECTLNPGDMLYIPPKVWHHVRSLST---SISVSFWF   65 (65)
Q Consensus         7 ~~s~~~~~~~d~~~~~~p~~~~~~~~~~~l~pGd~LyiP~~WwH~V~s~~~---sisvn~w~   65 (65)
                      .+|.++.+..|.  +.+|.+++++.++++|+|||+||||++|||+|++++.   +|||||||
T Consensus       224 ~~s~~d~~~~d~--~~~p~~~~~~~~~~~l~pGd~L~iP~~w~H~V~~~~~~~~sisvn~w~  283 (335)
T d1h2ka_         224 RQSQVDFDNPDY--ERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWY  283 (335)
T ss_dssp             TBBCCCTTSCCT--TTCGGGGGCCEEEEEECTTCEEEECTTCEEEEEECTTSCCEEEEEEEE
T ss_pred             cceeccccCcch--hhccchhcCCceEEEECCCCEEeeCCCCeEEEEEcCCCCeEEEEEeee
Confidence            345555555444  4699999999999999999999999999999999864   99999997



>d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3dl3a1 b.82.2.13 (A:5-100) Tellurite resistance protein B, TehB {Vibrio fischeri [TaxId: 668]} Back     information, alignment and structure
>d3bb6a1 b.82.2.13 (A:1-109) Uncharacterized protein YeaR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} Back     information, alignment and structure
>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2iuwa1 b.82.2.10 (A:70-279) AlkB homolog 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} Back     information, alignment and structure
>d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fcta1 b.82.2.9 (A:3-310) Syringomycin biosynthesis enzyme 2, SyrB2 {Pseudomonas syringae pv. syringae [TaxId: 321]} Back     information, alignment and structure
>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure