Psyllid ID: psy13010

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570---
MDNVRHAVEVEKQRSQQFGSTTPSFSTEVERPQPGLFRGNLKHYQLKGMNWLANLYDQGINGILADEMGLGKTVQSIAFLCHIAETYDVWGPFLIISPASTLHNWQQEMERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIKSSSSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDERHLSRLHMILKPFMLRRIKKDVENELSDKIEIMVYCPLTSRQKLLYSALKKKIKIEDLIHSSSGGSIQLSNNIASNLMNLVMQFRKVCNHPELFERRDAKAPLAMSCEDYHRLYRGRQMEREEGTILPEFPHVPRDPVILPQQPTYLPVCFFESTQNMVSPALKKKIKIEDLIHSSSGGSIQLSNNIASNLMNLVMQFRKVCNHPELFERRDAKAPLAMSCEDYVIPKLVFEEALLCHKLTLVYDAGKLSVLDDLLKRLKASGHRVLVYSQMTKMIDLLEEFMVYRKYRFMRLDGSSKISERRDMFAVPGILTHQSVGLLV
cccHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHccccccccccccEEEcHHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHccccccEEccccccccccHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHccccccHHHHHHHHHHHcHHHHHccHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHcHHHHHHHHHcHHHHHHHHHHHHHHcccEEEEEEHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHccccEEccccccccc
ccccHHHHHHHHHHHHHHccccccccccccccccHHHcccHHHHHHHHHHHHHHHHHccccEEEHHHcccHHHHHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHcccccccccccccEEEEEEHHHEHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccHHHHHHccccHHHHHHHHHHHHHHHHcHHHcccHHHHHHHHcccHHHHHHccccccHHHHHHHHHHHcHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHcccHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccHcccccccccccccccccccccccccHHccccccccccccccccHccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHEEEccHHHHHHHHHHHHHHHcccEEEEEHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHccccEccccccccc
MDNVRHAVEVEKqrsqqfgsttpsfsteverpqpglfrgnlkhYQLKGMNWLANLYDQGINgilademglgkTVQSIAFLCHIAetydvwgpfliispastlHNWQQEMERfvpdfkvvpywgspqeRKILRQFWDmknlhtkdasFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIKSSSSMRWKLLLGFScrnrlllsgtpiQNSMAELWALLHFImpsmfdshdEFNEWFSKDIESHaenktsideRHLSRLHMILKPFMLRRIKKDVENELSDKIEIMVYCPLTSRQKLLYSALKKKikiedlihsssggsiqlSNNIASNLMNLVMQFRKVcnhpelferrdakaplamscEDYHRLYRGrqmereegtilpefphvprdpvilpqqptylpvcffestqnmvspalkkkikiedlihsssggsiqlSNNIASNLMNLVMQFRKVcnhpelferrdakaplamscedyvipKLVFEEALLCHKLTLVYDAGKLSVLDDLLKRLKASGHRVLVYSQMTKMIDLLEEFMVYRKYRFMrldgsskiserrdmfavpgilthqsvgllv
mdnvrhavevekqrsqqfgsttpsfsteverpqpGLFRGNLKHYQLKGMNWLANLYDQGINGILADEMGLGKTVQSIAFLCHIAETYDVWGPFLIISPASTLHNWQQEMERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIKSSSSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIESHAEnktsiderhlSRLHMILKPFMLRRIKKDVENELSDKIEIMVYCPLTSRQKLLYSALKKKIKIEDLihsssggsiQLSNNIASNLMNLVMQFRKVCNHPELFerrdakaplamsCEDYHRLYRGRQMEREEGTILPEFPHVPRDPVILPQQPTYLPVCFFESTQNMVSPALKKKIKIEDLIHSSSGGSIQLSNNIASNLMNLVMQFRKVCNHPELFErrdakaplaMSCEDYVIPKLVFEEALLCHKLTLVYDAGKLSVLDDLLKRLKAsghrvlvysqMTKMIDLLEEFMVYRKYRFMRLdgsskiserrdmfavpgilthqsvgllv
MDNVRHAVEVEKQRSQQFGSTTPSFSTEVERPQPGLFRGNLKHYQLKGMNWLANLYDQGINGILADEMGLGKTVQSIAFLCHIAETYDVWGPFLIISPASTLHNWQQEMERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIKSSSSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDERHLSRLHMILKPFMLRRIKKDVENELSDKIEIMVYCPLTSRQKLLYSALKKKIKIEDLIHSSSGGSIQLSNNIASNLMNLVMQFRKVCNHPELFERRDAKAPLAMSCEDYHRLYRGRQMEREEGTILPEFPHVPRDPVILPQQPTYLPVCFFESTQNMVSPALKKKIKIEDLIHSSSGGSIQLSNNIASNLMNLVMQFRKVCNHPELFERRDAKAPLAMSCEDYVIPKLVFEEALLCHKLTLVYDAGKLSVLDDLLKRLKASGHRVLVYSQMTKMIDLLEEFMVYRKYRFMRLDGSSKISERRDMFAVPGILTHQSVGLLV
***********************************LFRGNLKHYQLKGMNWLANLYDQGINGILADEMGLGKTVQSIAFLCHIAETYDVWGPFLIISPASTLHNWQQEMERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIKSSSSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDI************RHLSRLHMILKPFMLRRIKKDVENELSDKIEIMVYCPLTSRQKLLYSALKKKIKIEDLIHSSSGGSIQLSNNIASNLMNLVMQFRKVCNHPELFERRDAKAPLAMSCEDYHRLYRGR******GTILPEFPHVPRDPVILPQQPTYLPVCFFESTQNMVSPALKKKIKIEDLIHSSSGGSIQLSNNIASNLMNLVMQFRKVCNHPELFERRDAKAPLAMSCEDYVIPKLVFEEALLCHKLTLVYDAGKLSVLDDLLKRLKASGHRVLVYSQMTKMIDLLEEFMVYRKYRFMRLDGSSKI**RRDMFAVPGILTH*******
**********************************GLFRGNLKHYQLKGMNWLANLYDQGINGILADEMGLGKTVQSIAFLCHIAETYDVWGPFLIISPASTLHNWQQEMERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIKSSSSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSK****************LSRLHMILKPFMLRRIKKDVENELSDKIEIMVYCPLTSRQKLLYSALKKKIKIEDLI***************SNLMNLVMQFRKVCNHPELFERRDAKAPLAMSCEDYHRLYRGRQMEREEGTILPE****PRD*VILPQQPTYLPVCFFESTQNMVSPALKKKIKIED*******************LMNLVMQFRKVCNHPELFERRDAKAPLAMSCEDYVIPKLVFEEALLCHKLTLVYDAGKLSVLDDLLKRLKASGHRVLVYSQMTKMIDLLEEFMVYRKYRFMRLDGSSKISERRDMFAVPGILTHQSVGLLV
*******************************PQPGLFRGNLKHYQLKGMNWLANLYDQGINGILADEMGLGKTVQSIAFLCHIAETYDVWGPFLIISPASTLHNWQQEMERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIKSSSSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDERHLSRLHMILKPFMLRRIKKDVENELSDKIEIMVYCPLTSRQKLLYSALKKKIKIEDLIHSSSGGSIQLSNNIASNLMNLVMQFRKVCNHPELFERRDAKAPLAMSCEDYHRLYRGRQMEREEGTILPEFPHVPRDPVILPQQPTYLPVCFFESTQNMVSPALKKKIKIEDLIHSSSGGSIQLSNNIASNLMNLVMQFRKVCNHPELFERRDAKAPLAMSCEDYVIPKLVFEEALLCHKLTLVYDAGKLSVLDDLLKRLKASGHRVLVYSQMTKMIDLLEEFMVYRKYRFMRLDGSSKISERRDMFAVPGILTHQSVGLLV
*****HAVEVEKQRSQQ*******FSTEVERPQPGLFRGNLKHYQLKGMNWLANLYDQGINGILADEMGLGKTVQSIAFLCHIAETYDVWGPFLIISPASTLHNWQQEMERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIKSSSSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDERHLSRLHMILKPFMLRRIKKDVENELSDKIEIMVYCPLTSRQKLLYSALKKKIKIEDLIHSSSG******NNIASNLMNLVMQFRKVCNHPELFERRDAKAPLAMSCEDYHRLYRGRQMEREEGTILPEFPHVPRDPVILPQQPTYLPVCFFESTQNMVSPALKKKIKIEDLIHSSSGGSIQLSNNIASNLMNLVMQFRKVCNHPELFERRDAKAPLAMSCEDYVIPKLVFEEALLCHKLTLVYDAGKLSVLDDLLKRLKASGHRVLVYSQMTKMIDLLEEFMVYRKYRFMRLDGSSKISERRDMFAVPGILT********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNVRHAVEVEKQRSQQFGSTTPSFSTEVERPQPGLFRGNLKHYQLKGMNWLANLYDQGINGILADEMGLGKTVQSIAFLCHIAETYDVWGPFLIISPASTLHNWQQEMERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIKSSSSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDERHLSRLHMILKPFMLRRIKKDVENELSDKIEIMVYCPLTSRQKLLYSALKKKIKIEDLIHSSSGGSIQLSNNIASNLMNLVMQFRKVCNHPELFERRDAKAPLAMSCEDYHRLYRGRQMEREEGTILPEFPHVPRDPVILPQQPTYLPVCFFESTQNMVSPALKKKIKIEDLIHSSSGGSIQLSNNIASNLMNLVMQFRKVCNHPELFERRDAKAPLAMSCEDYVIPKLVFEEALLCHKLTLVYDAGKLSVLDDLLKRLKASGHRVLVYSQMTKMIDLLEEFMVYRKYRFMRLDGSSKISERRDMFAVPGILTHQSVGLLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query573 2.2.26 [Sep-21-2011]
Q9VDY1 1638 Putative DNA helicase Ino yes N/A 0.530 0.185 0.845 1e-171
Q9ULG1 1556 DNA helicase INO80 OS=Hom yes N/A 0.607 0.223 0.730 1e-156
Q6ZPV2 1559 DNA helicase INO80 OS=Mus yes N/A 0.605 0.222 0.729 1e-156
Q4PGL2 1910 Putative DNA helicase INO N/A N/A 0.577 0.173 0.661 1e-140
Q6BGY8 1364 Putative DNA helicase INO yes N/A 0.610 0.256 0.618 1e-139
Q872I5 1997 Putative DNA helicase ino N/A N/A 0.574 0.164 0.662 1e-137
A4R227 1944 Putative DNA helicase INO N/A N/A 0.577 0.170 0.654 1e-137
Q2UTQ9 1444 Putative DNA helicase ino yes N/A 0.579 0.229 0.640 1e-135
A1C9W6 1707 Putative DNA helicase ino N/A N/A 0.579 0.194 0.637 1e-135
Q74Z27 1414 Putative DNA helicase INO yes N/A 0.642 0.260 0.6 1e-135
>sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 Back     alignment and function desciption
 Score =  603 bits (1554), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 280/331 (84%), Positives = 307/331 (92%)

Query: 32  PQPGLFRGNLKHYQLKGMNWLANLYDQGINGILADEMGLGKTVQSIAFLCHIAETYDVWG 91
           PQP +F+G LK YQ+KGM WLAN+YDQGI+GILADEMGLGKTVQSIAFLCHIAE Y VWG
Sbjct: 526 PQPKMFKGTLKGYQIKGMTWLANIYDQGISGILADEMGLGKTVQSIAFLCHIAEHYGVWG 585

Query: 92  PFLIISPASTLHNWQQEMERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVI 151
           PFL+ISPASTLHNWQQEM RFVPDFKVVPYWGSP ERKILRQFWD K+LHT+DASFHVVI
Sbjct: 586 PFLVISPASTLHNWQQEMSRFVPDFKVVPYWGSPAERKILRQFWDQKHLHTRDASFHVVI 645

Query: 152 TSYQLVVSDFKYFNRIKWQYLILDEAQAIKSSSSMRWKLLLGFSCRNRLLLSGTPIQNSM 211
           TSYQLVVSD+KYFNRIKWQY++LDEAQAIKS++S RWKLLLGFSCRNRLLLSGTPIQNSM
Sbjct: 646 TSYQLVVSDYKYFNRIKWQYMVLDEAQAIKSAASQRWKLLLGFSCRNRLLLSGTPIQNSM 705

Query: 212 AELWALLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDERHLSRLHMILKPFMLRRIK 271
           AELWALLHFIMP++FDSHDEFNEWFSKDIESHAENKT IDE+ +SRLHMILKPFMLRRIK
Sbjct: 706 AELWALLHFIMPTLFDSHDEFNEWFSKDIESHAENKTGIDEKQISRLHMILKPFMLRRIK 765

Query: 272 KDVENELSDKIEIMVYCPLTSRQKLLYSALKKKIKIEDLIHSSSGGSIQLSNNIASNLMN 331
           KDVENELSDKIEIMVYCPLT RQKLLY ALK+KI+IEDL+H +SG +   S++ ASNLMN
Sbjct: 766 KDVENELSDKIEIMVYCPLTIRQKLLYRALKQKIRIEDLLHLTSGSTTTSSSSSASNLMN 825

Query: 332 LVMQFRKVCNHPELFERRDAKAPLAMSCEDY 362
           LVMQFRKVCNHPELFERRDA++P  M C +Y
Sbjct: 826 LVMQFRKVCNHPELFERRDARSPFFMRCAEY 856
DNA helicase and probable main scaffold component of the chromatin remodeling Ino80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 Back     alignment and function description
>sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=2 SV=2 Back     alignment and function description
>sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 Back     alignment and function description
>sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 Back     alignment and function description
>sp|Q872I5|INO80_NEUCR Putative DNA helicase ino-80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ino-80 PE=3 SV=3 Back     alignment and function description
>sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 Back     alignment and function description
>sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 Back     alignment and function description
>sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 Back     alignment and function description
>sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query573
350408082 1634 PREDICTED: DNA helicase INO80-like isofo 0.628 0.220 0.810 1e-179
340721884 1631 PREDICTED: DNA helicase INO80-like [Bomb 0.628 0.220 0.810 1e-179
383848691 1633 PREDICTED: putative DNA helicase Ino80-l 0.628 0.220 0.810 1e-179
328786874 1636 PREDICTED: putative DNA helicase Ino80-l 0.628 0.220 0.807 1e-179
380016117 1496 PREDICTED: LOW QUALITY PROTEIN: putative 0.628 0.240 0.807 1e-179
307192391 1449 Putative DNA helicase Ino80 [Harpegnatho 0.630 0.249 0.8 1e-178
345491056 1590 PREDICTED: putative DNA helicase Ino80-l 0.624 0.225 0.813 1e-177
242012609 1570 predicted protein [Pediculus humanus cor 0.628 0.229 0.799 1e-176
157132188 1372 helicase [Aedes aegypti] gi|108871256|gb 0.628 0.262 0.777 1e-172
195062800 1659 GH22391 [Drosophila grimshawi] gi|193899 0.577 0.199 0.823 1e-172
>gi|350408082|ref|XP_003488295.1| PREDICTED: DNA helicase INO80-like isoform 1 [Bombus impatiens] gi|350408084|ref|XP_003488296.1| PREDICTED: DNA helicase INO80-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
 Score =  635 bits (1637), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 299/369 (81%), Positives = 325/369 (88%), Gaps = 9/369 (2%)

Query: 3   NVRHAVEVEKQRSQQFGSTTPS-------FSTEVERPQPGLFRGNLKHYQLKGMNWLANL 55
           N   A + EK R++QF + T S           +E PQP +F+GNLK YQLKGMNWLANL
Sbjct: 419 NATEAFDNEKARAKQFDTATASQELRLSDTPENLEHPQPSIFKGNLKGYQLKGMNWLANL 478

Query: 56  YDQGINGILADEMGLGKTVQSIAFLCHIAETYDVWGPFLIISPASTLHNWQQEMERFVPD 115
           YDQGI+GILADEMGLGKTVQSIAFLCH+AE Y VWGPFLIISPASTLHNWQQEM RFVP 
Sbjct: 479 YDQGISGILADEMGLGKTVQSIAFLCHVAEKYSVWGPFLIISPASTLHNWQQEMARFVPM 538

Query: 116 FKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILD 175
           FKVVPYWG+PQERKILRQFWD K+LHTK+ASFHVVITSYQLV++D+KYFNRIKWQY+ILD
Sbjct: 539 FKVVPYWGNPQERKILRQFWDTKDLHTKEASFHVVITSYQLVITDYKYFNRIKWQYMILD 598

Query: 176 EAQAIKSSSSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEW 235
           EAQAIKS+SSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMP++FDSHDEFNEW
Sbjct: 599 EAQAIKSTSSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPTLFDSHDEFNEW 658

Query: 236 FSKDIESHAENKTSIDERHLSRLHMILKPFMLRRIKKDVENELSDKIEIMVYCPLTSRQK 295
           FSKDIESHAENKT IDE+HLSRLHMILKPFMLRRIKKDVENELSDKIE+MVYCPLT+RQK
Sbjct: 659 FSKDIESHAENKTGIDEKHLSRLHMILKPFMLRRIKKDVENELSDKIEVMVYCPLTTRQK 718

Query: 296 LLYSALKKKIKIEDLIHSSSGGSIQLSN--NIASNLMNLVMQFRKVCNHPELFERRDAKA 353
           LLYSALKKKI+IEDL+H + GG    SN  N  SNLMNLVMQFRKVCNHPELFERRDAK+
Sbjct: 719 LLYSALKKKIRIEDLLHYTVGGGDTASNDKNFTSNLMNLVMQFRKVCNHPELFERRDAKS 778

Query: 354 PLAMSCEDY 362
           P  M  E Y
Sbjct: 779 PFFMHTEYY 787

Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340721884|ref|XP_003399343.1| PREDICTED: DNA helicase INO80-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383848691|ref|XP_003699981.1| PREDICTED: putative DNA helicase Ino80-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328786874|ref|XP_393832.4| PREDICTED: putative DNA helicase Ino80-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380016117|ref|XP_003692035.1| PREDICTED: LOW QUALITY PROTEIN: putative DNA helicase Ino80-like [Apis florea] Back     alignment and taxonomy information
>gi|307192391|gb|EFN75626.1| Putative DNA helicase Ino80 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345491056|ref|XP_001602268.2| PREDICTED: putative DNA helicase Ino80-like isoform 1 [Nasonia vitripennis] gi|345491058|ref|XP_003426518.1| PREDICTED: putative DNA helicase Ino80-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242012609|ref|XP_002427022.1| predicted protein [Pediculus humanus corporis] gi|212511267|gb|EEB14284.1| predicted protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|157132188|ref|XP_001662505.1| helicase [Aedes aegypti] gi|108871256|gb|EAT35481.1| AAEL012355-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|195062800|ref|XP_001996256.1| GH22391 [Drosophila grimshawi] gi|193899751|gb|EDV98617.1| GH22391 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query573
FB|FBgn0086613 1638 Ino80 "Ino80" [Drosophila mela 0.769 0.269 0.671 6.8e-184
ZFIN|ZDB-GENE-041014-72 1582 ino80 "INO80 homolog (S. cerev 0.603 0.218 0.717 6.6e-167
UNIPROTKB|Q9ULG1 1556 INO80 "DNA helicase INO80" [Ho 0.605 0.223 0.732 1.2e-166
MGI|MGI:1915392 1559 Ino80 "INO80 homolog (S. cerev 0.603 0.221 0.731 1e-165
UNIPROTKB|E1BAN8 1566 INO80 "Uncharacterized protein 0.603 0.220 0.729 3.5e-165
UNIPROTKB|F1SSV0 1566 INO80 "Uncharacterized protein 0.603 0.220 0.729 3.5e-165
UNIPROTKB|F1PKX5 1560 INO80 "Uncharacterized protein 0.603 0.221 0.729 3.5e-165
UNIPROTKB|F1NYY9 1564 INO80 "Uncharacterized protein 0.603 0.221 0.720 6.5e-164
RGD|1310969 1553 Ino80 "INO80 homolog (S. cerev 0.593 0.218 0.723 1.2e-160
POMBASE|SPAC29B12.01 1604 ino80 "SNF2 family helicase In 0.579 0.206 0.652 4.8e-144
FB|FBgn0086613 Ino80 "Ino80" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1539 (546.8 bits), Expect = 6.8e-184, Sum P(2) = 6.8e-184
 Identities = 309/460 (67%), Positives = 361/460 (78%)

Query:     9 EVEKQRSQQFGSTTPSFSTEV-ERPQPGLFRGNLKHYQLKGMNWLANLYDQGINGILADE 67
             E E+Q  +      P    E+ + PQP +F+G LK YQ+KGM WLAN+YDQGI+GILADE
Sbjct:   502 EEEEQAQESVEDIKPEPRPEMKDLPQPKMFKGTLKGYQIKGMTWLANIYDQGISGILADE 561

Query:    68 MGLGKTVQSIAFLCHIAETYDVWGPFLIISPASTLHNWQQEMERFVPDFKVVPYWGSPQE 127
             MGLGKTVQSIAFLCHIAE Y VWGPFL+ISPASTLHNWQQEM RFVPDFKVVPYWGSP E
Sbjct:   562 MGLGKTVQSIAFLCHIAEHYGVWGPFLVISPASTLHNWQQEMSRFVPDFKVVPYWGSPAE 621

Query:   128 RKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIKSSSSMR 187
             RKILRQFWD K+LHT+DASFHVVITSYQLVVSD+KYFNRIKWQY++LDEAQAIKS++S R
Sbjct:   622 RKILRQFWDQKHLHTRDASFHVVITSYQLVVSDYKYFNRIKWQYMVLDEAQAIKSAASQR 681

Query:   188 WKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIESHAENK 247
             WKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMP++FDSHDEFNEWFSKDIESHAENK
Sbjct:   682 WKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPTLFDSHDEFNEWFSKDIESHAENK 741

Query:   248 TSIDERHLSRLHMILKPFMLRRIKKDVENELSDKIEIMVYCPLTSRQKLLYSALKKKIKI 307
             T IDE+ +SRLHMILKPFMLRRIKKDVENELSDKIEIMVYCPLT RQKLLY ALK+KI+I
Sbjct:   742 TGIDEKQISRLHMILKPFMLRRIKKDVENELSDKIEIMVYCPLTIRQKLLYRALKQKIRI 801

Query:   308 EDLIHSSSGGSIQLSNNIASNLMNLVMQFRKVCNHPELFERRDAKAPLAMSCEDYHRLYR 367
             EDL+H +SG +   S++ ASNLMNLVMQFRKVCNHPELFERRDA++P  M C +Y  + R
Sbjct:   802 EDLLHLTSGSTTTSSSSSASNLMNLVMQFRKVCNHPELFERRDARSPFFMRCAEY-TIPR 860

Query:   368 GRQMEREEGTI---LPEFPHVPRDPVILPQQPTYLPVCFFESTQNMVSPALKKKIKIEDL 424
                +  EEG I   LP   H+  +   + +   Y+    FE     V+       ++ DL
Sbjct:   861 ---LIHEEGLIHRMLPSRKHLLYNRFNIFKSE-YIQRSLFEDVN--VNSCFGFT-RLCDL 913

Query:   425 IHSSSGGSIQLSNNIASNLMNLVMQFRKVCN-HPELFERR 463
                S G  ++++ N    L++ ++ +R+V   +P L  RR
Sbjct:   914 ---SVGDMVEVTLN---GLIDFLLHYRRVLEKYPLLAYRR 947
GO:0004386 "helicase activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0031011 "Ino80 complex" evidence=IDA
GO:0005700 "polytene chromosome" evidence=IDA
GO:0000975 "regulatory region DNA binding" evidence=IDA
GO:0010468 "regulation of gene expression" evidence=IMP
GO:0000790 "nuclear chromatin" evidence=IDA
ZFIN|ZDB-GENE-041014-72 ino80 "INO80 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ULG1 INO80 "DNA helicase INO80" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1915392 Ino80 "INO80 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BAN8 INO80 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SSV0 INO80 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PKX5 INO80 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NYY9 INO80 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1310969 Ino80 "INO80 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
POMBASE|SPAC29B12.01 ino80 "SNF2 family helicase Ino80" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8RXS6INO80_ARATH3, ., 6, ., 4, ., 1, 20.61300.57590.2189yesN/A
P0CO16INO80_CRYNJ3, ., 6, ., 4, ., 1, 20.61530.56360.1830yesN/A
Q74Z27INO80_ASHGO3, ., 6, ., 4, ., 1, 20.60.64220.2602yesN/A
Q6ZPV2INO80_MOUSE3, ., 6, ., 4, ., 1, 20.72980.60550.2225yesN/A
O14148INO80_SCHPO3, ., 6, ., 4, ., 1, 20.64490.58110.2076yesN/A
Q2UTQ9INO80_ASPOR3, ., 6, ., 4, ., 1, 20.64090.57940.2299yesN/A
Q6CNY4INO80_KLULA3, ., 6, ., 4, ., 1, 20.63200.57940.2229yesN/A
P53115INO80_YEAST3, ., 6, ., 4, ., 1, 20.62790.58980.2269yesN/A
Q9ULG1INO80_HUMAN3, ., 6, ., 4, ., 1, 20.73060.60730.2236yesN/A
A2R9H9INO80_ASPNC3, ., 6, ., 4, ., 1, 20.63500.57940.1956yesN/A
Q9VDY1INO80_DROME3, ., 6, ., 4, ., 1, 20.84590.53050.1855yesN/A
Q4WTV7INO80_ASPFU3, ., 6, ., 4, ., 1, 20.63500.57940.1943yesN/A
Q6BGY8INO80_DEBHA3, ., 6, ., 4, ., 1, 20.61890.61080.2565yesN/A
Q4IL82INO80_GIBZE3, ., 6, ., 4, ., 1, 20.64880.57760.1738yesN/A
Q5BAZ5INO80_EMENI3, ., 6, ., 4, ., 1, 20.5840.61780.2196yesN/A
Q6FV37INO80_CANGA3, ., 6, ., 4, ., 1, 20.60220.62470.2412yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.12LOW CONFIDENCE prediction!
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query573
pfam00176301 pfam00176, SNF2_N, SNF2 family N-terminal domain 1e-101
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 6e-81
COG0553866 COG0553, HepA, Superfamily II DNA/RNA helicases, S 3e-71
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 4e-25
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 4e-21
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 5e-21
COG0553866 COG0553, HepA, Superfamily II DNA/RNA helicases, S 7e-13
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 6e-06
pfam00176301 pfam00176, SNF2_N, SNF2 family N-terminal domain 3e-04
>gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain Back     alignment and domain information 
 Score =  307 bits (788), Expect = e-101
 Identities = 142/310 (45%), Positives = 193/310 (62%), Gaps = 16/310 (5%)

Query: 44  YQLKGMNWLANLYDQGINGILADEMGLGKTVQSIAFL-CHIAETYDVWGPFLIISPASTL 102
           YQL+G+NWL +L   G+ GILADEMGLGKT+Q+IA L  ++ E  D  GP L++ P STL
Sbjct: 1   YQLEGVNWLISLESNGLGGILADEMGLGKTLQTIALLATYLKEGKDRRGPTLVVCPLSTL 60

Query: 103 HNWQQEMERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFK 162
           HNW  E E++ P  +VV Y G  +ER  LRQ    K L T D    VVIT+Y+++  D K
Sbjct: 61  HNWLNEFEKWAPALRVVVYHGDGRERSKLRQS-MAKRLDTYD----VVITTYEVLRKDKK 115

Query: 163 Y---FNRIKWQYLILDEAQAIKSSSSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLH 219
                N+++W  ++LDEA  +K+S S  +K L     RNRLLL+GTPIQN++ ELWALL+
Sbjct: 116 LLSLLNKVEWDRVVLDEAHRLKNSKSKLYKALKKLKTRNRLLLTGTPIQNNLEELWALLN 175

Query: 220 FIMPSMFDSHDEFNEWFSKDIESHAENKTSIDERH---LSRLHMILKPFMLRRIKKDVEN 276
           F+ P  F S   F EWF+  I + A+NK    E+    ++RLH +LKPF+LRR K DVE 
Sbjct: 176 FLRPGPFGSFKVFEEWFNIPIANTADNKNKNLEKGKEGINRLHKLLKPFLLRRTKDDVEK 235

Query: 277 ELSDKIEIMVYCPLTSRQKLLYSALKKKIKIEDLIHSSSGGSIQLSNNIASNLMNLVMQF 336
            L  K E ++YC L+  Q+ LY    KK+  +  +  S        N   ++L+NL+MQ 
Sbjct: 236 SLPPKTEHVLYCNLSDEQRKLY----KKLLTKRRLALSFAVEGGEKNVGIASLLNLIMQL 291

Query: 337 RKVCNHPELF 346
           RK+CNHP LF
Sbjct: 292 RKICNHPYLF 301

This domain is found in proteins involved in a variety of processes including transcription regulation (e.g., SNF2, STH1, brahma, MOT1), DNA repair (e.g. ERCC6, RAD16, RAD5), DNA recombination (e.g. RAD54), and chromatin unwinding (e.g. ISWI) as well as a variety of other proteins with little functional information (e.g. lodestar, ETL1). Length = 301
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 573
KOG0385|consensus 971 100.0
KOG0387|consensus 923 100.0
KOG0388|consensus1185 100.0
KOG0389|consensus 941 100.0
KOG0391|consensus 1958 100.0
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 100.0
KOG0384|consensus 1373 100.0
KOG0392|consensus 1549 100.0
KOG1002|consensus791 100.0
KOG0386|consensus 1157 100.0
KOG1015|consensus 1567 100.0
KOG0390|consensus 776 100.0
KOG4439|consensus901 100.0
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 100.0
KOG1000|consensus 689 100.0
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 100.0
KOG1016|consensus 1387 100.0
KOG1001|consensus674 100.0
KOG0383|consensus696 100.0
PRK04914 956 ATP-dependent helicase HepA; Validated 100.0
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.97
KOG0298|consensus 1394 99.91
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.91
PRK13766 773 Hef nuclease; Provisional 99.9
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.89
PHA02558501 uvsW UvsW helicase; Provisional 99.86
KOG1123|consensus776 99.83
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.71
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.66
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.64
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.62
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.62
PTZ00110545 helicase; Provisional 99.62
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.61
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.6
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.59
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.59
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.59
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 99.59
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.59
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.58
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 99.58
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 99.58
KOG0354|consensus 746 99.57
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.57
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.56
PTZ00424401 helicase 45; Provisional 99.56
smart00487201 DEXDc DEAD-like helicases superfamily. 99.55
PRK106891147 transcription-repair coupling factor; Provisional 99.51
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.51
PRK02362 737 ski2-like helicase; Provisional 99.45
PRK13767 876 ATP-dependent helicase; Provisional 99.44
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.38
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.37
KOG0331|consensus519 99.36
PRK00254 720 ski2-like helicase; Provisional 99.35
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.34
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.34
PRK01172 674 ski2-like helicase; Provisional 99.33
PRK09401 1176 reverse gyrase; Reviewed 99.33
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.32
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.32
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.3
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.27
COG4096 875 HsdR Type I site-specific restriction-modification 99.26
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.24
KOG0330|consensus476 99.23
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.22
COG1205 851 Distinct helicase family with a unique C-terminal 99.21
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 99.18
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.18
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.18
PHA02653675 RNA helicase NPH-II; Provisional 99.16
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.08
COG1204 766 Superfamily II helicase [General function predicti 99.08
PRK14701 1638 reverse gyrase; Provisional 99.08
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.07
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 99.05
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 99.04
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.03
KOG0350|consensus620 99.01
KOG0328|consensus400 98.97
PRK05580679 primosome assembly protein PriA; Validated 98.96
COG4098441 comFA Superfamily II DNA/RNA helicase required for 98.95
COG4889 1518 Predicted helicase [General function prediction on 98.93
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 98.92
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 98.9
PRK13107 908 preprotein translocase subunit SecA; Reviewed 98.89
PRK12904 830 preprotein translocase subunit SecA; Reviewed 98.86
COG1202830 Superfamily II helicase, archaea-specific [General 98.85
KOG0343|consensus 758 98.84
PRK09694878 helicase Cas3; Provisional 98.84
KOG0345|consensus567 98.83
KOG0335|consensus482 98.83
KOG0333|consensus673 98.75
KOG4284|consensus 980 98.74
KOG0340|consensus 442 98.67
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 98.66
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 98.64
COG11971139 Mfd Transcription-repair coupling factor (superfam 98.62
KOG0338|consensus 691 98.59
KOG0342|consensus 543 98.56
KOG0339|consensus 731 98.54
PRK15483 986 type III restriction-modification system StyLTI en 98.54
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 98.51
KOG0336|consensus 629 98.51
PF11496 297 HDA2-3: Class II histone deacetylase complex subun 98.5
KOG0952|consensus 1230 98.47
KOG0334|consensus 997 98.47
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 98.45
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.44
KOG0348|consensus708 98.43
KOG0353|consensus695 98.39
COG0610 962 Type I site-specific restriction-modification syst 98.37
KOG0341|consensus 610 98.35
KOG1513|consensus 1300 98.34
PRK05298 652 excinuclease ABC subunit B; Provisional 98.32
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 98.29
KOG0346|consensus 569 98.28
KOG0332|consensus477 98.27
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 98.21
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 98.13
KOG0351|consensus 941 98.13
PRK12326 764 preprotein translocase subunit SecA; Reviewed 98.13
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 98.11
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 98.08
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 98.07
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 98.03
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.0
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.0
KOG0347|consensus 731 97.99
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.97
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 97.95
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 97.94
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 97.88
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 97.87
KOG0948|consensus 1041 97.82
KOG0947|consensus 1248 97.82
KOG0326|consensus459 97.77
COG1198730 PriA Primosomal protein N' (replication factor Y) 97.76
KOG0344|consensus 593 97.7
CHL00122 870 secA preprotein translocase subunit SecA; Validate 97.64
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 97.62
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 97.61
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 97.59
PRK14873665 primosome assembly protein PriA; Provisional 97.56
KOG0951|consensus 1674 97.5
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.46
PRK10536262 hypothetical protein; Provisional 97.44
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 97.43
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 97.33
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 97.3
KOG0327|consensus397 97.3
KOG0337|consensus 529 97.27
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.25
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.21
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 97.14
TIGR00376637 DNA helicase, putative. The gene product may repre 97.13
KOG0352|consensus641 97.07
KOG1802|consensus935 97.06
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 97.03
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 96.97
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 96.96
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.92
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 96.89
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 96.72
KOG1803|consensus649 96.7
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 96.68
KOG1805|consensus1100 96.6
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 96.58
PRK10875615 recD exonuclease V subunit alpha; Provisional 96.57
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 96.55
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.48
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 96.46
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 96.4
KOG0823|consensus230 96.38
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 96.37
KOG1132|consensus 945 96.25
PRK04296190 thymidine kinase; Provisional 96.22
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 96.21
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 96.03
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 95.98
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 95.88
KOG0949|consensus 1330 95.88
KOG0950|consensus 1008 95.86
PRK06526254 transposase; Provisional 95.86
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 95.86
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 95.86
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.8
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 95.73
smart00382148 AAA ATPases associated with a variety of cellular 95.7
PRK09112351 DNA polymerase III subunit delta'; Validated 95.7
smart0050463 Ubox Modified RING finger domain. Modified RING fi 95.69
PRK08181269 transposase; Validated 95.67
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 95.66
KOG0298|consensus 1394 95.61
PLN03025319 replication factor C subunit; Provisional 95.57
KOG0320|consensus187 95.5
PF1324576 AAA_19: Part of AAA domain 95.42
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 95.42
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 95.42
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 95.38
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 95.36
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 95.34
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 95.34
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 95.33
COG1484254 DnaC DNA replication protein [DNA replication, rec 95.24
PRK08084235 DNA replication initiation factor; Provisional 95.15
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 95.12
PRK07940394 DNA polymerase III subunit delta'; Validated 95.1
PRK05707328 DNA polymerase III subunit delta'; Validated 95.09
CHL00181287 cbbX CbbX; Provisional 95.04
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.04
PRK06871325 DNA polymerase III subunit delta'; Validated 94.99
PRK08058329 DNA polymerase III subunit delta'; Validated 94.94
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 94.93
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 94.92
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 94.89
PRK12402337 replication factor C small subunit 2; Reviewed 94.87
KOG0329|consensus387 94.74
KOG0951|consensus1674 94.74
PRK08116268 hypothetical protein; Validated 94.68
PRK06835329 DNA replication protein DnaC; Validated 94.68
KOG0738|consensus491 94.64
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 94.58
KOG2164|consensus 513 94.58
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 94.57
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 94.55
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 94.53
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 94.51
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 94.45
PRK08727233 hypothetical protein; Validated 94.44
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 94.42
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 94.33
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 94.3
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 94.29
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 94.28
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 94.28
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 94.26
PRK07993334 DNA polymerase III subunit delta'; Validated 94.22
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 94.19
PRK00149450 dnaA chromosomal replication initiation protein; R 94.18
KOG0926|consensus 1172 94.16
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 93.98
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 93.88
KOG0922|consensus 674 93.81
TIGR00362405 DnaA chromosomal replication initiator protein Dna 93.74
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 93.74
PRK06893229 DNA replication initiation factor; Validated 93.73
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 93.71
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 93.61
PRK14088440 dnaA chromosomal replication initiation protein; P 93.6
KOG0989|consensus346 93.6
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 93.55
PRK05642234 DNA replication initiation factor; Validated 93.54
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 93.46
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 93.46
PRK06090319 DNA polymerase III subunit delta'; Validated 93.38
TIGR02928365 orc1/cdc6 family replication initiation protein. M 93.37
PRK14087450 dnaA chromosomal replication initiation protein; P 93.33
KOG0287|consensus 442 93.31
PRK06921266 hypothetical protein; Provisional 93.28
PRK14974336 cell division protein FtsY; Provisional 93.25
PHA02929238 N1R/p28-like protein; Provisional 93.19
PRK14086617 dnaA chromosomal replication initiation protein; P 93.15
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 93.1
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 93.09
KOG0740|consensus428 93.05
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 93.03
PRK12422445 chromosomal replication initiation protein; Provis 93.02
PRK07471365 DNA polymerase III subunit delta'; Validated 92.99
PRK09183259 transposase/IS protein; Provisional 92.98
PHA02544316 44 clamp loader, small subunit; Provisional 92.96
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 92.89
KOG2879|consensus298 92.87
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 92.85
PRK07952244 DNA replication protein DnaC; Validated 92.82
smart0049082 HELICc helicase superfamily c-terminal domain. 92.81
KOG0920|consensus 924 92.78
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 92.63
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 92.61
KOG0317|consensus293 92.6
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 92.59
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 92.58
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 92.56
PRK08769319 DNA polymerase III subunit delta'; Validated 92.55
PHA02533534 17 large terminase protein; Provisional 92.54
cd01124187 KaiC KaiC is a circadian clock protein primarily f 92.52
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 92.47
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 92.45
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 92.45
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 92.42
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 92.21
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 92.15
PRK00411394 cdc6 cell division control protein 6; Reviewed 92.02
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 92.02
PRK06904472 replicative DNA helicase; Validated 92.01
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 91.97
PF00004132 AAA: ATPase family associated with various cellula 91.95
KOG0739|consensus439 91.88
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 91.63
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 91.54
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 91.54
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 91.49
PHA03372668 DNA packaging terminase subunit 1; Provisional 91.42
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 91.4
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 91.33
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 91.3
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 91.28
PHA03333752 putative ATPase subunit of terminase; Provisional 91.22
PRK08903227 DnaA regulatory inactivator Hda; Validated 91.19
KOG0737|consensus386 91.13
PRK00440319 rfc replication factor C small subunit; Reviewed 91.11
PTZ001121164 origin recognition complex 1 protein; Provisional 91.09
PRK12377248 putative replication protein; Provisional 91.05
PF13173128 AAA_14: AAA domain 90.95
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 90.75
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 90.7
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 90.66
PF1463444 zf-RING_5: zinc-RING finger domain 90.66
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 90.66
PRK08760476 replicative DNA helicase; Provisional 90.53
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 90.48
PRK13342413 recombination factor protein RarA; Reviewed 90.39
KOG1813|consensus313 90.37
PRK04195482 replication factor C large subunit; Provisional 90.34
PRK09376416 rho transcription termination factor Rho; Provisio 90.33
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 90.33
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 90.25
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 90.24
cd01128249 rho_factor Transcription termination factor rho is 90.23
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 90.07
CHL00095 821 clpC Clp protease ATP binding subunit 90.02
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 90.0
PRK08533230 flagellar accessory protein FlaH; Reviewed 89.96
PRK06964342 DNA polymerase III subunit delta'; Validated 89.96
KOG0733|consensus802 89.93
PRK08840464 replicative DNA helicase; Provisional 89.9
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 89.86
PHA03368738 DNA packaging terminase subunit 1; Provisional 89.63
PRK13889 988 conjugal transfer relaxase TraA; Provisional 89.54
TIGR02688449 conserved hypothetical protein TIGR02688. Members 89.3
PRK11823446 DNA repair protein RadA; Provisional 89.28
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 89.19
KOG0925|consensus 699 89.1
CHL00206 2281 ycf2 Ycf2; Provisional 89.07
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 89.04
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 89.03
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 89.01
PRK03992389 proteasome-activating nucleotidase; Provisional 88.92
PRK10865 857 protein disaggregation chaperone; Provisional 88.88
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 88.84
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 88.67
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 88.65
PRK07004460 replicative DNA helicase; Provisional 88.6
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 88.55
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 88.53
PF06564243 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p 88.49
PRK09165497 replicative DNA helicase; Provisional 88.35
PRK08006471 replicative DNA helicase; Provisional 88.2
CHL00176638 ftsH cell division protein; Validated 88.12
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 88.07
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 87.98
PTZ00293211 thymidine kinase; Provisional 87.94
PRK07276290 DNA polymerase III subunit delta'; Validated 87.94
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 87.92
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 87.87
COG5152259 Uncharacterized conserved protein, contains RING a 87.87
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 87.7
KOG0991|consensus333 87.53
PRK13341 725 recombination factor protein RarA/unknown domain f 87.46
PRK00771437 signal recognition particle protein Srp54; Provisi 87.43
KOG1131|consensus 755 87.42
KOG0978|consensus698 87.4
COG0470325 HolB ATPase involved in DNA replication [DNA repli 87.26
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 87.22
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 87.15
PRK05748448 replicative DNA helicase; Provisional 87.15
KOG0924|consensus 1042 87.09
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 87.06
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 86.86
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 86.84
PRK13826 1102 Dtr system oriT relaxase; Provisional 86.75
TIGR00665434 DnaB replicative DNA helicase. This model describe 86.68
COG2256436 MGS1 ATPase related to the helicase subunit of the 86.62
PRK06067234 flagellar accessory protein FlaH; Validated 86.57
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 86.51
PRK08939306 primosomal protein DnaI; Reviewed 86.51
KOG1785|consensus563 86.42
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 86.37
PRK08506472 replicative DNA helicase; Provisional 86.3
PRK05564313 DNA polymerase III subunit delta'; Validated 86.16
TIGR00767415 rho transcription termination factor Rho. Members 86.13
COG4626546 Phage terminase-like protein, large subunit [Gener 85.99
PF02456369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 85.9
PRK13894319 conjugal transfer ATPase TrbB; Provisional 85.88
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 85.85
KOG0952|consensus1230 85.8
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 85.66
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 85.64
PHA02926242 zinc finger-like protein; Provisional 85.58
cd03115173 SRP The signal recognition particle (SRP) mediates 85.5
COG4098 441 comFA Superfamily II DNA/RNA helicase required for 85.49
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 85.47
KOG1807|consensus 1025 85.4
PRK05636505 replicative DNA helicase; Provisional 85.36
PRK12608380 transcription termination factor Rho; Provisional 85.25
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 85.23
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 85.11
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 84.85
PHA00012361 I assembly protein 84.75
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 84.52
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 84.48
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 84.43
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 84.4
KOG4265|consensus349 84.4
COG3973747 Superfamily I DNA and RNA helicases [General funct 84.39
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 84.23
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 84.16
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 83.63
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 83.41
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 83.35
KOG0736|consensus953 83.32
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 83.28
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 83.24
PRK06321472 replicative DNA helicase; Provisional 83.2
CHL00195489 ycf46 Ycf46; Provisional 83.03
PRK08699325 DNA polymerase III subunit delta'; Validated 82.96
PRK10416318 signal recognition particle-docking protein FtsY; 82.88
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 82.57
TIGR00959428 ffh signal recognition particle protein. This mode 82.57
KOG0651|consensus388 82.57
COG0552340 FtsY Signal recognition particle GTPase [Intracell 82.4
PRK10867433 signal recognition particle protein; Provisional 82.28
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 82.14
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 81.94
PRK05595444 replicative DNA helicase; Provisional 81.92
PRK11054684 helD DNA helicase IV; Provisional 81.84
TIGR00064272 ftsY signal recognition particle-docking protein F 81.79
KOG0730|consensus693 81.79
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 81.71
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 81.66
COG0305435 DnaB Replicative DNA helicase [DNA replication, re 81.48
KOG4692|consensus489 81.41
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 81.26
PF02702211 KdpD: Osmosensitive K+ channel His kinase sensor d 80.8
PHA02542473 41 41 helicase; Provisional 80.73
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 80.61
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 80.39
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, 80.28
KOG1942|consensus456 80.12
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 80.07
>KOG0385|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.4e-72  Score=570.66  Aligned_cols=386  Identities=44%  Similarity=0.783  Sum_probs=341.3

Q ss_pred             CCCchhh-hccHHHHHHHHHHHHHHHhCCCCeEEeCCCCCCHHHHHHHHHHHHhhhcCCCCCEEEEcCcccHHHHHHHHH
Q psy13010         32 PQPGLFR-GNLKHYQLKGMNWLANLYDQGINGILADEMGLGKTVQSIAFLCHIAETYDVWGPFLIISPASTLHNWQQEME  110 (573)
Q Consensus        32 ~~p~~l~-~~L~~~Q~~~v~~l~~~~~~~~~~ll~de~G~GKT~~~ia~~~~~~~~~~~~~~~LIV~P~~l~~qW~~el~  110 (573)
                      .+|..++ ++|+|||.+|++||+.++..+.+||||||||+|||+++|+++.++....+..||+||+||.+.+.+|++||.
T Consensus       158 ~sP~~v~~g~lr~YQveGlnWLi~l~engingILaDEMGLGKTlQtIs~l~yl~~~~~~~GPfLVi~P~StL~NW~~Ef~  237 (971)
T KOG0385|consen  158 DSPSYVKGGELRDYQLEGLNWLISLYENGINGILADEMGLGKTLQTISLLGYLKGRKGIPGPFLVIAPKSTLDNWMNEFK  237 (971)
T ss_pred             CCchhhcCCccchhhhccHHHHHHHHhcCcccEeehhcccchHHHHHHHHHHHHHhcCCCCCeEEEeeHhhHHHHHHHHH
Confidence            3899998 699999999999999999999999999999999999999999999997788899999999999999999999


Q ss_pred             HHCCCceEEeecCChhHHHHHHHHhhhcccccCCCCceEEEeehHhHHhhHhhhhccCccEEEEcccccccCcchHHHHH
Q psy13010        111 RFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIKSSSSMRWKL  190 (573)
Q Consensus       111 ~~~~~~~v~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~i~i~sy~~~~~~~~~l~~~~~~~vIiDE~h~~kn~~s~~~~~  190 (573)
                      +|+|++++++|+|.+..+..+.+-.      -..+.|+|+||||+.+-++.+.|..+.|.++||||+|++||..|..++.
T Consensus       238 rf~P~l~~~~~~Gdk~eR~~~~r~~------~~~~~fdV~iTsYEi~i~dk~~lk~~~W~ylvIDEaHRiKN~~s~L~~~  311 (971)
T KOG0385|consen  238 RFTPSLNVVVYHGDKEERAALRRDI------MLPGRFDVCITSYEIAIKDKSFLKKFNWRYLVIDEAHRIKNEKSKLSKI  311 (971)
T ss_pred             HhCCCcceEEEeCCHHHHHHHHHHh------hccCCCceEeehHHHHHhhHHHHhcCCceEEEechhhhhcchhhHHHHH
Confidence            9999999999999998888776532      2225899999999999999999999999999999999999999999999


Q ss_pred             HHhcccCcEEEEeccCCCCCHHHHHHHHHhhCCCCCCChHHHHHHHhhhhhhhhcccccccHHHHHHHHHhhccceeecc
Q psy13010        191 LLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDERHLSRLHMILKPFMLRRI  270 (573)
Q Consensus       191 ~~~l~~~~~~lLTgTP~~n~~~el~~ll~~L~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~rr~  270 (573)
                      ++.+.+.+|+||||||++|+++|||++++||.|..|++...|..+|......+       +......|+.+|+||++||.
T Consensus       312 lr~f~~~nrLLlTGTPLQNNL~ELWaLLnFllPdiF~~~e~F~swF~~~~~~~-------~~e~v~~Lh~vL~pFlLRR~  384 (971)
T KOG0385|consen  312 LREFKTDNRLLLTGTPLQNNLHELWALLNFLLPDIFNSAEDFDSWFDFTNCEG-------DQELVSRLHKVLRPFLLRRI  384 (971)
T ss_pred             HHHhcccceeEeeCCcccccHHHHHHHHHhhchhhccCHHHHHHHHccccccc-------CHHHHHHHHhhhhHHHHHHH
Confidence            99999999999999999999999999999999999999999999997643222       33478889999999999999


Q ss_pred             ccchhccCCCceEEEEEcCCCHHHHHHHHHHHHHHHHHHhhhhcCCCccccchhhHHHHHHHHHHHHHhcCCcccccccc
Q psy13010        271 KKDVENELSDKIEIMVYCPLTSRQKLLYSALKKKIKIEDLIHSSSGGSIQLSNNIASNLMNLVMQFRKVCNHPELFERRD  350 (573)
Q Consensus       271 k~~~~~~LP~~~~~~v~v~ls~~q~~~Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~lr~~c~hp~l~~~~~  350 (573)
                      |.++...|||+.+..++|.||+.|++.|..++..-    +-.....+..     ....+++.+++||+||+||+|+..-+
T Consensus       385 K~dVe~sLppKkE~~iyvgms~mQkk~Y~~iL~kd----l~~~n~~~~~-----~k~kL~NI~mQLRKccnHPYLF~g~e  455 (971)
T KOG0385|consen  385 KSDVEKSLPPKKELIIYVGMSSMQKKWYKAILMKD----LDALNGEGKG-----EKTKLQNIMMQLRKCCNHPYLFDGAE  455 (971)
T ss_pred             HHhHhhcCCCcceeeEeccchHHHHHHHHHHHHhc----chhhcccccc-----hhhHHHHHHHHHHHhcCCccccCCCC
Confidence            99999999999999999999999999999987652    1111111111     24678999999999999999996411


Q ss_pred             ccCccccchhhhhhhhccchhhccccCCCCCCCCCCCCCcccCCCCCCCCcccccccccCCchhhhhhhhHhhhhccCCC
Q psy13010        351 AKAPLAMSCEDYHRLYRGRQMEREEGTILPEFPHVPRDPVILPQQPTYLPVCFFESTQNMVSPALKKKIKIEDLIHSSSG  430 (573)
Q Consensus       351 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~h~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~  430 (573)
                      .+.                                                                             
T Consensus       456 Pg~-----------------------------------------------------------------------------  458 (971)
T KOG0385|consen  456 PGP-----------------------------------------------------------------------------  458 (971)
T ss_pred             CCC-----------------------------------------------------------------------------
Confidence            110                                                                             


Q ss_pred             CccccchhHHHHHHHHHHHHHhhcCCchhhhhhcccCcccccccccccchhhHHHHhhccccccccccccHHHHHHHHHH
Q psy13010        431 GSIQLSNNIASNLMNLVMQFRKVCNHPELFERRDAKAPLAMSCEDYVIPKLVFEEALLCHKLTLVYDAGKLSVLDDLLKR  510 (573)
Q Consensus       431 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~Kl~~l~~li~~  510 (573)
                                                                              ....+..++..|+|+..|..++..
T Consensus       459 --------------------------------------------------------pyttdehLv~nSGKm~vLDkLL~~  482 (971)
T KOG0385|consen  459 --------------------------------------------------------PYTTDEHLVTNSGKMLVLDKLLPK  482 (971)
T ss_pred             --------------------------------------------------------CCCcchHHHhcCcceehHHHHHHH
Confidence                                                                    012245667889999999999999


Q ss_pred             HHhCCCeEEEEecchhHHHHHHHHHHhCCCeEEEecCCCCHHHHHHHHhCcCCCC-CceEEEe
Q psy13010        511 LKASGHRVLVYSQMTKMIDLLEEFMVYRKYRFMRLDGSSKISERRDMFAVPGILT-HQSVGLL  572 (573)
Q Consensus       511 ~~~~~~KvlIFsq~~~~l~~l~~~L~~~gi~~~~i~G~~~~~~R~~~i~~F~~~~-~~~v~Ll  572 (573)
                      +.++|.||||||||+.|||+|+.++..+|+.|+|+||+++.++|..+|+.||.++ ...||||
T Consensus       483 Lk~~GhRVLIFSQmt~mLDILeDyc~~R~y~ycRiDGSt~~eeR~~aI~~fn~~~s~~FiFlL  545 (971)
T KOG0385|consen  483 LKEQGHRVLIFSQMTRMLDILEDYCMLRGYEYCRLDGSTSHEEREDAIEAFNAPPSEKFIFLL  545 (971)
T ss_pred             HHhCCCeEEEeHHHHHHHHHHHHHHHhcCceeEeecCCCCcHHHHHHHHhcCCCCcceEEEEE
Confidence            9999999999999999999999999999999999999999999999999999887 4555554

>KOG0387|consensus Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PF11496 HDA2-3: Class II histone deacetylase complex subunits 2 and 3; InterPro: IPR021006 This entry contains the class II histone deacetylase complex subunits HDA2 and HDA3 is found in fungi Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG1513|consensus Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0740|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>KOG0737|consensus Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG1807|consensus Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PHA00012 I assembly protein Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>KOG0651|consensus Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4692|consensus Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PF02702 KdpD: Osmosensitive K+ channel His kinase sensor domain; InterPro: IPR003852 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1942|consensus Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query573
3mwy_W800 Crystal Structure Of The Chromodomain-atpase Portio 4e-53
3mwy_W 800 Crystal Structure Of The Chromodomain-atpase Portio 3e-14
1z6a_A500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN 2e-40
1z63_A500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COM 1e-38
1z3i_X644 Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMA 1e-20
>pdb|3MWY|W Chain W, Crystal Structure Of The Chromodomain-atpase Portion Of The Yeast Chd1 Chromatin Remodeler Length = 800 Back     alignment and structure 
Iteration: 1

 Score =  206 bits (523), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 118/352 (33%), Positives = 190/352 (53%), Gaps = 23/352 (6%)
Query: 5   RHAVEVEKQRSQQFGSTTPSFSTEVERPQPGLFRGNLKHYQLKGMNWLANLYDQGINGIL 64
           R   ++  Q S  + S  P F     +P P +  G L+ +QL G+NW+A L+ +G NGIL
Sbjct: 202 RENSKILPQYSSNYTSQRPRFEKLSVQP-PFIKGGELRDFQLTGINWMAFLWSKGDNGIL 260
Query: 65  ADEMGLGKTVQSIAFLCHIAETYDVWGPFLIISPASTLHNWQQEMERFVPDFKVVPYWGS 124
           ADEMGLGKTVQ++AF+  +       GP +I+ P ST+  W    E++ PD   + Y G+
Sbjct: 261 ADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGN 320
Query: 125 PQERKILRQFWDMKNLHTKDA---SFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIK 181
            + R  +R++    N   K      F+V++T+Y+ ++ D      IKWQ++ +DEA  +K
Sbjct: 321 QKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLK 380
Query: 182 SSSSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIE 241
           ++ S  ++ L  F   NR+L++GTP+QN++ EL AL++F+MP            F+ D E
Sbjct: 381 NAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGR----------FTIDQE 430
Query: 242 SHAENKTSIDERHLSRLHMILKPFMLRRIKKDVENELSDKIEIMVYCPLTSRQKLLYSAL 301
              EN+    E ++  LH  ++PF+LRR+KKDVE  L  K E ++   L+  Q   Y  +
Sbjct: 431 IDFENQDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNI 490
Query: 302 KKKIKIEDLIHSSSGGSIQLSNNIASNLMNLVMQFRKVCNHPELFERRDAKA 353
             K     L   + GG          +L+N++ + +K  NHP LF+  + + 
Sbjct: 491 LTK-NYSALTAGAKGGHF--------SLLNIMNELKKASNHPYLFDNAEERV 533
>pdb|3MWY|W Chain W, Crystal Structure Of The Chromodomain-atpase Portion Of The Yeast Chd1 Chromatin Remodeler Length = 800 Back     alignment and structure
>pdb|1Z6A|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN Length = 500 Back     alignment and structure
>pdb|1Z63|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COMPLEX With Dsdna Length = 500 Back     alignment and structure
>pdb|1Z3I|X Chain X, Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMAIN OF EUKARYOTIC Rad54 Length = 644 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query573
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 1e-128
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 2e-31
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 1e-100
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 5e-30
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 1e-98
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 1e-10
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 4e-46
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 3e-04
3hgt_A 328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 1e-25
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-17
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 8e-15
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 7e-11
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 6e-07
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 3e-06
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 7e-05
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 3e-04
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
 Score =  392 bits (1009), Expect = e-128
 Identities = 116/346 (33%), Positives = 187/346 (54%), Gaps = 23/346 (6%)

Query: 5   RHAVEVEKQRSQQFGSTTPSFSTEVERPQPGLFRGNLKHYQLKGMNWLANLYDQGINGIL 64
           R   ++  Q S  + S  P F     +P P +  G L+ +QL G+NW+A L+ +G NGIL
Sbjct: 202 RENSKILPQYSSNYTSQRPRFEKLSVQP-PFIKGGELRDFQLTGINWMAFLWSKGDNGIL 260

Query: 65  ADEMGLGKTVQSIAFLCHIAETYDVWGPFLIISPASTLHNWQQEMERFVPDFKVVPYWGS 124
           ADEMGLGKTVQ++AF+  +       GP +I+ P ST+  W    E++ PD   + Y G+
Sbjct: 261 ADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGN 320

Query: 125 PQERKILRQ---FWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIK 181
            + R  +R+   + + +    K   F+V++T+Y+ ++ D      IKWQ++ +DEA  +K
Sbjct: 321 QKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLK 380

Query: 182 SSSSMRWKLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIE 241
           ++ S  ++ L  F   NR+L++GTP+QN++ EL AL++F+MP  F    E +     D E
Sbjct: 381 NAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQ-DEE 439

Query: 242 SHAENKTSIDERHLSRLHMILKPFMLRRIKKDVENELSDKIEIMVYCPLTSRQKLLYSAL 301
                     E ++  LH  ++PF+LRR+KKDVE  L  K E ++   L+  Q   Y  +
Sbjct: 440 ---------QEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNI 490

Query: 302 KKKIKIEDLIHSSSGGSIQLSNNIASNLMNLVMQFRKVCNHPELFE 347
             K     L   + GG          +L+N++ + +K  NHP LF+
Sbjct: 491 LTK-NYSALTAGAKGGH--------FSLLNIMNELKKASNHPYLFD 527
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Length = 328 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Length = 271 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Length = 271 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query573
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 100.0
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 100.0
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 100.0
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.96
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.92
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.92
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.92
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.92
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.92
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.89
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.89
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.88
3h1t_A590 Type I site-specific restriction-modification syst 99.86
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.84
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.83
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.81
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.8
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.78
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.77
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.77
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.76
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.75
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.74
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.74
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.74
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 99.72
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.72
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.7
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.7
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.69
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.65
3hgt_A 328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 99.65
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.64
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.63
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.62
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.61
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.61
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.61
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.6
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.59
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.59
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.58
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.57
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.57
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.56
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.56
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.55
3bor_A237 Human initiation factor 4A-II; translation initiat 99.52
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.5
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.49
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.48
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.45
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.45
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.43
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.42
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.42
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.4
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.4
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.38
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.37
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.19
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.15
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.04
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.03
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 98.98
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 98.98
1yks_A 440 Genome polyprotein [contains: flavivirin protease 98.82
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 98.76
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 98.76
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.7
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 98.69
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 98.69
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 98.68
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 98.66
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 98.63
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.56
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 98.54
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.47
3jux_A 822 Protein translocase subunit SECA; protein transloc 98.46
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 98.39
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 98.27
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 98.2
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 98.07
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 98.04
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 98.0
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 97.98
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 97.88
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 97.83
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 97.82
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 97.78
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.77
3eaq_A 212 Heat resistant RNA dependent ATPase; DEAD box RNA 97.71
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 96.54
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 97.34
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 97.26
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 97.24
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.15
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 97.11
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.09
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 97.05
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 96.83
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 96.82
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 96.68
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 96.51
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 96.44
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 96.36
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 96.28
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 96.23
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 96.19
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 96.13
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 96.12
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.06
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 96.01
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 95.99
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 95.94
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 95.91
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 95.91
2ysl_A73 Tripartite motif-containing protein 31; ring-type 95.84
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.77
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 95.74
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 95.73
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 95.73
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 95.72
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 95.67
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 95.58
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 95.55
2ea5_A68 Cell growth regulator with ring finger domain prot 95.53
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.47
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 95.4
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 95.39
2ecw_A85 Tripartite motif-containing protein 30; metal bind 95.38
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 95.35
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 95.34
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 95.27
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 95.26
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 95.26
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 95.15
1z6u_A150 NP95-like ring finger protein isoform B; structura 95.09
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 95.09
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 95.08
2ysj_A63 Tripartite motif-containing protein 31; ring-type 95.06
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 95.05
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 95.05
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 94.98
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 94.75
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.73
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 94.73
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 94.72
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 94.7
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 94.68
2f42_A179 STIP1 homology and U-box containing protein 1; cha 94.59
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 94.57
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 94.47
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 94.45
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 94.32
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 94.29
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 94.18
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 94.11
3bos_A242 Putative DNA replication factor; P-loop containing 94.11
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 94.07
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 94.06
2ect_A78 Ring finger protein 126; metal binding protein, st 94.05
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 94.02
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 94.02
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 94.01
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 93.97
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 93.87
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 93.8
2chg_A226 Replication factor C small subunit; DNA-binding pr 93.8
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 93.76
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 93.76
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 93.64
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 93.61
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 93.59
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 93.54
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 93.33
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 93.24
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 93.23
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 93.01
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 92.93
2ecm_A55 Ring finger and CHY zinc finger domain- containing 92.88
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 92.81
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 92.75
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 92.72
3co5_A143 Putative two-component system transcriptional RES 92.55
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 92.55
2gno_A305 DNA polymerase III, gamma subunit-related protein; 92.4
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 92.39
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 92.37
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 92.35
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 92.34
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 92.14
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 92.12
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 92.1
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 91.84
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 91.84
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 91.8
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 91.74
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 91.65
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 91.63
3pvs_A447 Replication-associated recombination protein A; ma 91.4
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 91.3
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 91.18
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 90.88
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 90.86
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 90.85
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 90.67
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 90.52
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 90.4
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 90.4
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 89.75
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 89.59
2r6a_A454 DNAB helicase, replicative helicase; replication, 89.57
2v1u_A387 Cell division control protein 6 homolog; DNA repli 89.57
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 89.56
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 89.46
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 88.94
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 88.7
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 88.54
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 88.13
1ojl_A304 Transcriptional regulatory protein ZRAR; response 88.11
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 88.09
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 87.53
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 87.14
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 87.04
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 86.91
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 86.91
2cvh_A220 DNA repair and recombination protein RADB; filamen 86.65
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 86.52
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 86.47
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 86.18
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 86.11
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 85.89
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 85.51
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 85.42
2chq_A319 Replication factor C small subunit; DNA-binding pr 85.07
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 85.07
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 85.05
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 84.74
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 84.47
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 84.07
2kjq_A149 DNAA-related protein; solution structure, NESG, st 83.87
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 83.5
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 83.08
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 82.54
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 81.88
3hjh_A483 Transcription-repair-coupling factor; MFD, mutatio 81.58
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 81.35
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 81.23
1xp8_A366 RECA protein, recombinase A; recombination, radior 80.97
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 80.96
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 80.9
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 80.69
2l82_A 162 Designed protein OR32; structural genomics, northe 80.18
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=3.3e-56  Score=500.69  Aligned_cols=398  Identities=35%  Similarity=0.609  Sum_probs=316.6

Q ss_pred             CCchh-hhccHHHHHHHHHHHHHHHhCCCCeEEeCCCCCCHHHHHHHHHHHHhhhcCCCCCEEEEcCcccHHHHHHHHHH
Q psy13010         33 QPGLF-RGNLKHYQLKGMNWLANLYDQGINGILADEMGLGKTVQSIAFLCHIAETYDVWGPFLIISPASTLHNWQQEMER  111 (573)
Q Consensus        33 ~p~~l-~~~L~~~Q~~~v~~l~~~~~~~~~~ll~de~G~GKT~~~ia~~~~~~~~~~~~~~~LIV~P~~l~~qW~~el~~  111 (573)
                      +|+.+ ..+|+|||++|++||...+..+.+|||+|+||+|||+++++++..+....+..+|+|||||.+++.||.+||.+
T Consensus       228 ~p~~~~~~~Lr~yQ~egv~~l~~~~~~~~~~ILademGlGKT~~ai~~i~~l~~~~~~~~~~LIV~P~sll~qW~~E~~~  307 (800)
T 3mwy_W          228 QPPFIKGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEK  307 (800)
T ss_dssp             CCTTCCSSCCCTHHHHHHHHHHHHHTTTCCEEECCCTTSSTTHHHHHHHHHHHHHHSCCSCEEEECCTTTHHHHHHHHHH
T ss_pred             CCCccCCCCcCHHHHHHHHHHHHHhhcCCCEEEEeCCCcchHHHHHHHHHHHHHhcCCCCCEEEEECchHHHHHHHHHHH
Confidence            34443 45999999999999999999999999999999999999999999887666667899999999999999999999


Q ss_pred             HCCCceEEeecCChhHHHHHHHHhhhccc---ccCCCCceEEEeehHhHHhhHhhhhccCccEEEEcccccccCcchHHH
Q psy13010        112 FVPDFKVVPYWGSPQERKILRQFWDMKNL---HTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIKSSSSMRW  188 (573)
Q Consensus       112 ~~~~~~v~~~~g~~~~~~~~~~~~~~~~~---~~~~~~~~i~i~sy~~~~~~~~~l~~~~~~~vIiDE~h~~kn~~s~~~  188 (573)
                      |+|+.++++|.|....+..++.+....+.   ......++|+|+||+++..+...+..++|++||+||+|++||..+..+
T Consensus       308 ~~p~~~v~~~~g~~~~r~~~~~~~~~~~~~~~~~~~~~~dvvitTy~~l~~~~~~l~~~~w~~vIvDEaH~lkn~~s~~~  387 (800)
T 3mwy_W          308 WAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLY  387 (800)
T ss_dssp             HSTTCCEEECCCSSHHHHHHHHHHSCSCC-----CCCCCSEEEECTTHHHHTHHHHHTSEEEEEEETTGGGGCCSSSHHH
T ss_pred             HCCCceEEEEeCCHHHHHHHHHHHhhccccccccccccCCEEEecHHHHHhhHHHHhcCCcceeehhhhhhhcCchhHHH
Confidence            99999999999999888777665422211   134578899999999999999999999999999999999999999999


Q ss_pred             HHHHhcccCcEEEEeccCCCCCHHHHHHHHHhhCCCCCCChHHHHHHHhhhhhhhhcccccccHHHHHHHHHhhccceee
Q psy13010        189 KLLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDERHLSRLHMILKPFMLR  268 (573)
Q Consensus       189 ~~~~~l~~~~~~lLTgTP~~n~~~el~~ll~~L~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~r  268 (573)
                      +++..+++.++|+|||||++|++.|||++++||.|+.+.....|.-...          ..........|+.+++++++|
T Consensus       388 ~~l~~l~~~~rl~LTgTPiqN~l~el~~ll~fL~p~~~~~~~~~~~~~~----------~~~~~~~~~~L~~~l~p~~lR  457 (800)
T 3mwy_W          388 ESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEIDFENQ----------DEEQEEYIHDLHRRIQPFILR  457 (800)
T ss_dssp             HHHTTSEEEEEEEECSCCCSSCSHHHHHHHHHHCSCCC---------CC----------TTHHHHHHHHHHHTTGGGEEE
T ss_pred             HHHHHhhhccEEEeeCCcCCCCHHHHHHHHHHhCccccCchhhhccccc----------chhHHHHHHHHHHHHhHHHhh
Confidence            9999999999999999999999999999999999999977655532111          111345678899999999999


Q ss_pred             ccccchhccCCCceEEEEEcCCCHHHHHHHHHHHHHHHHHHhhhhcCCCccccchhhHHHHHHHHHHHHHhcCCcccccc
Q psy13010        269 RIKKDVENELSDKIEIMVYCPLTSRQKLLYSALKKKIKIEDLIHSSSGGSIQLSNNIASNLMNLVMQFRKVCNHPELFER  348 (573)
Q Consensus       269 r~k~~~~~~LP~~~~~~v~v~ls~~q~~~Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~lr~~c~hp~l~~~  348 (573)
                      |++.++...||++.+..+.|+||+.|++.|+.+........    ..+.     ......++..++.||++|+||.++..
T Consensus       458 R~k~dv~~~LP~k~~~~v~v~ls~~q~~~Y~~i~~~~~~~l----~~~~-----~~~~~~~l~~l~~Lrk~~~hp~l~~~  528 (800)
T 3mwy_W          458 RLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSAL----TAGA-----KGGHFSLLNIMNELKKASNHPYLFDN  528 (800)
T ss_dssp             CCGGGGTTTSCCEEEEEEEECCCHHHHHHHHHHHHHCCC-------------------CTHHHHHHHHHHHHHCGGGSSS
T ss_pred             hhHHhhhhccCCcEEEEEEeCCCHHHHHHHHHHHHHHHHHH----hhcc-----ccchhhHHHHHHHHHHHhcChhhhcc
Confidence            99999999999999999999999999999999876532110    0000     11123578899999999999999853


Q ss_pred             ccccCccccchhhhhhhhccchhhccccCCCCCCCCCCCCCcccCCCCCCCCcccccccccCCchhhhhhhhHhhhhccC
Q psy13010        349 RDAKAPLAMSCEDYHRLYRGRQMEREEGTILPEFPHVPRDPVILPQQPTYLPVCFFESTQNMVSPALKKKIKIEDLIHSS  428 (573)
Q Consensus       349 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~h~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~  428 (573)
                      ........                         ..+                                            
T Consensus       529 ~~~~~~~~-------------------------~~~--------------------------------------------  539 (800)
T 3mwy_W          529 AEERVLQK-------------------------FGD--------------------------------------------  539 (800)
T ss_dssp             HHHHHCCC-------------------------C----------------------------------------------
T ss_pred             hHHHHHHh-------------------------ccc--------------------------------------------
Confidence            11100000                         000                                            


Q ss_pred             CCCccccchhHHHHHHHHHHHHHhhcCCchhhhhhcccCcccccccccccchhhHHHHhhccccccccccccHHHHHHHH
Q psy13010        429 SGGSIQLSNNIASNLMNLVMQFRKVCNHPELFERRDAKAPLAMSCEDYVIPKLVFEEALLCHKLTLVYDAGKLSVLDDLL  508 (573)
Q Consensus       429 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~Kl~~l~~li  508 (573)
                        +                                             .....       ......+..|+|+.+|.+++
T Consensus       540 --~---------------------------------------------~~~~~-------~~~~~l~~~s~K~~~L~~lL  565 (800)
T 3mwy_W          540 --G---------------------------------------------KMTRE-------NVLRGLIMSSGKMVLLDQLL  565 (800)
T ss_dssp             -------------------------------------------------CCSH-------HHHHHHHHTCHHHHHHHHHH
T ss_pred             --c---------------------------------------------cccHH-------HHHHHhhhcChHHHHHHHHH
Confidence              0                                             00000       00011234689999999999


Q ss_pred             HHHHhCCCeEEEEecchhHHHHHHHHHHhCCCeEEEecCCCCHHHHHHHHhCcCCCCC-ceEEEe
Q psy13010        509 KRLKASGHRVLVYSQMTKMIDLLEEFMVYRKYRFMRLDGSSKISERRDMFAVPGILTH-QSVGLL  572 (573)
Q Consensus       509 ~~~~~~~~KvlIFsq~~~~l~~l~~~L~~~gi~~~~i~G~~~~~~R~~~i~~F~~~~~-~~v~Ll  572 (573)
                      ..+...|.||||||||+.++++|+..|...|+.+.+++|+++.++|++++++|++++. ..|||+
T Consensus       566 ~~~~~~g~kvLIFsq~~~~ld~L~~~L~~~g~~~~~i~G~~~~~eR~~~i~~F~~~~~~~~v~Ll  630 (800)
T 3mwy_W          566 TRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLL  630 (800)
T ss_dssp             HHHTTTTCCEEEEESCHHHHHHHHHHHHHHTCCCEEESTTSCHHHHHHHHHTTSSTTCSCCCEEE
T ss_pred             HHHhhCCCeEEEEechHHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHhhCCCCCceEEEE
Confidence            9998899999999999999999999999999999999999999999999999998654 345554
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 573
d1z63a1230 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 h 4e-46
d1z3ix2298 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis 1e-43
d1z3ix1346 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi 2e-09
d1z3ix1 346 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi 9e-09
d2fz4a1206 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc 5e-08
d1z5za1244 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 h 9e-06
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 8e-04
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 0.002
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 230 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Helicase of the SNF2/Rad54 hamily
species: Sulfolobus solfataricus [TaxId: 2287]

 Score =  160 bits (404), Expect = 4e-46
 Identities = 72/246 (29%), Positives = 128/246 (52%), Gaps = 23/246 (9%)

Query: 33  QPGLFRGNLKHYQLKGMNWLANLYDQGINGILADEMGLGKTVQSIAFLCHIAETYDVWGP 92
           +P   + NL+ YQ+KG +W+  +   G    LAD+MGLGKT+Q+IA     A+  +   P
Sbjct: 5   EPYNIKANLRPYQIKGFSWMRFMNKLGFGICLADDMGLGKTLQTIAV-FSDAKKENELTP 63

Query: 93  FLIISPASTLHNWQQEMERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVIT 152
            L+I P S L NW++E+ +F P  +   +     + K+                + +++T
Sbjct: 64  SLVICPLSVLKNWEEELSKFAPHLRFAVFHEDRSKIKL--------------EDYDIILT 109

Query: 153 SYQLVVSDFKYFNRIKWQYLILDEAQAIKSSSSMRWKLLLGFSCRNRLLLSGTPIQNSMA 212
           +Y +++ D +    ++W+Y+++DEAQ IK+  +  +K +     + R+ L+GTPI+N + 
Sbjct: 110 TYAVLLRDTR-LKEVEWKYIVIDEAQNIKNPQTKIFKAVKELKSKYRIALTGTPIENKVD 168

Query: 213 ELWALLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDERHLSRLHMILKPFMLRRIKK 272
           +LW+++ F+ P +  S+ EF   F+  I+         D      L  I+ PF+LRR K 
Sbjct: 169 DLWSIMTFLNPGLLGSYSEFKSKFATPIKKG-------DNMAKEELKAIISPFILRRTKY 221

Query: 273 DVENEL 278
           D     
Sbjct: 222 DKAIIN 227
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298 Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 244 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query573
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 100.0
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 100.0
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.83
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.82
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.78
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.77
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.72
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.54
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.45
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.43
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.41
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.4
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.36
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.33
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.15
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.01
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 98.99
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 98.93
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 98.93
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 98.85
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 98.81
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.8
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 98.74
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 98.69
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.35
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 98.29
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 98.05
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.01
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 97.93
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 97.85
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 97.81
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 97.78
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 97.68
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 97.64
d1oywa3 200 RecQ helicase domain {Escherichia coli [TaxId: 562 97.52
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.02
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 97.02
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 97.0
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.94
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 96.86
d2c2la280 STIP1 homology and U box-containing protein 1, STU 96.62
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 96.57
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.53
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 96.47
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 96.32
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 96.3
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 96.2
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 95.79
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 95.45
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 95.34
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 95.25
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 94.98
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 94.44
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 94.39
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.33
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 93.8
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 93.79
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 93.79
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 93.7
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 93.68
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 93.62
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 93.19
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.13
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 93.09
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 92.9
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 92.78
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 92.59
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 92.5
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 92.42
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 92.31
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 91.9
d2qy9a2211 GTPase domain of the signal recognition particle r 91.79
d2eyqa5 211 Transcription-repair coupling factor, TRCF {Escher 91.54
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 91.33
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 90.68
d1nkta4 219 Translocation ATPase SecA, nucleotide-binding doma 90.17
d1okkd2207 GTPase domain of the signal recognition particle r 90.1
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 89.54
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 89.34
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 89.09
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 88.54
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 88.07
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 87.41
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 86.79
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 86.49
d1vmaa2213 GTPase domain of the signal recognition particle r 85.69
d1gm5a4 206 RecG helicase domain {Thermotoga maritima [TaxId: 85.36
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 84.89
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 84.6
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 84.52
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 84.4
d1j8yf2211 GTPase domain of the signal sequence recognition p 83.76
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 83.53
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 83.13
d1ls1a2207 GTPase domain of the signal sequence recognition p 82.51
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 81.56
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 80.83
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Helicase of the SNF2/Rad54 hamily
species: Sulfolobus solfataricus [TaxId: 2287]

Probab=100.00  E-value=5.6e-44  Score=340.03  Aligned_cols=227  Identities=32%  Similarity=0.673  Sum_probs=203.1

Q ss_pred             cCCCCchhhhccHHHHHHHHHHHHHHHhCCCCeEEeCCCCCCHHHHHHHHHHHHhhhcCCCCCEEEEcCcccHHHHHHHH
Q psy13010         30 ERPQPGLFRGNLKHYQLKGMNWLANLYDQGINGILADEMGLGKTVQSIAFLCHIAETYDVWGPFLIISPASTLHNWQQEM  109 (573)
Q Consensus        30 ~~~~p~~l~~~L~~~Q~~~v~~l~~~~~~~~~~ll~de~G~GKT~~~ia~~~~~~~~~~~~~~~LIV~P~~l~~qW~~el  109 (573)
                      ++.+|++++.+|+|||++|+.||+.....+.|||||||||+|||+++++++..+..... .+++|||||.+++.+|.+|+
T Consensus         2 ~~~~P~~~~~~L~~yQ~~~v~~~~~~~~~~~g~iLaDe~GlGKT~~~i~~~~~~~~~~~-~~~~LIv~p~~l~~~W~~e~   80 (230)
T d1z63a1           2 QLLEPYNIKANLRPYQIKGFSWMRFMNKLGFGICLADDMGLGKTLQTIAVFSDAKKENE-LTPSLVICPLSVLKNWEEEL   80 (230)
T ss_dssp             CCCCCCSCSSCCCHHHHHHHHHHHHHHHTTCCEEECCCTTSCHHHHHHHHHHHHHHTTC-CSSEEEEECSTTHHHHHHHH
T ss_pred             CCcCchhhhcchhHHHHHHHHHHHHhhhcCCCEEEEeCCCCChHHHHHHhhhhhhhccc-ccccceecchhhhhHHHHHH
Confidence            46789999999999999999999999999999999999999999999999998887644 46999999999999999999


Q ss_pred             HHHCCCceEEeecCChhHHHHHHHHhhhcccccCCCCceEEEeehHhHHhhHhhhhccCccEEEEcccccccCcchHHHH
Q psy13010        110 ERFVPDFKVVPYWGSPQERKILRQFWDMKNLHTKDASFHVVITSYQLVVSDFKYFNRIKWQYLILDEAQAIKSSSSMRWK  189 (573)
Q Consensus       110 ~~~~~~~~v~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~i~i~sy~~~~~~~~~l~~~~~~~vIiDE~h~~kn~~s~~~~  189 (573)
                      .+|.+...+..+.+.....              ...++++++++|+.+.+. ..+..++|++||+||+|+++|..+.+++
T Consensus        81 ~~~~~~~~~~~~~~~~~~~--------------~~~~~~vvi~~~~~~~~~-~~l~~~~~~~vI~DEah~~k~~~s~~~~  145 (230)
T d1z63a1          81 SKFAPHLRFAVFHEDRSKI--------------KLEDYDIILTTYAVLLRD-TRLKEVEWKYIVIDEAQNIKNPQTKIFK  145 (230)
T ss_dssp             HHHCTTSCEEECSSSTTSC--------------CGGGSSEEEEEHHHHTTC-HHHHTCCEEEEEEETGGGGSCTTSHHHH
T ss_pred             Hhhcccccceeeccccchh--------------hccCcCEEEeeHHHHHhH-HHHhcccceEEEEEhhhcccccchhhhh
Confidence            9999888888776543321              225678999999999765 5577889999999999999999999999


Q ss_pred             HHHhcccCcEEEEeccCCCCCHHHHHHHHHhhCCCCCCChHHHHHHHhhhhhhhhcccccccHHHHHHHHHhhccceeec
Q psy13010        190 LLLGFSCRNRLLLSGTPIQNSMAELWALLHFIMPSMFDSHDEFNEWFSKDIESHAENKTSIDERHLSRLHMILKPFMLRR  269 (573)
Q Consensus       190 ~~~~l~~~~~~lLTgTP~~n~~~el~~ll~~L~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~rr  269 (573)
                      ++..++++++|+|||||++|++.|+|+++.||+|+.++++..|.+.|+.+...+       +..+..+|+.+++++++||
T Consensus       146 ~~~~l~a~~r~~LTgTPi~n~~~dl~~ll~~l~p~~~~~~~~F~~~~~~~~~~~-------~~~~~~~L~~~l~~~~lRr  218 (230)
T d1z63a1         146 AVKELKSKYRIALTGTPIENKVDDLWSIMTFLNPGLLGSYSEFKSKFATPIKKG-------DNMAKEELKAIISPFILRR  218 (230)
T ss_dssp             HHHTSCEEEEEEECSSCSTTCHHHHHHHHHHHSTTTTCCHHHHHTTTHHHHHTT-------CHHHHHHHHHHHTTTEECC
T ss_pred             hhhhhccceEEEEecchHHhHHHHHHHHHHhhCCCcCCCHHHHHHHHhhhhhcc-------CHHHHHHHHHHhhccEEEE
Confidence            999999999999999999999999999999999999999999999999887654       4567888999999999999


Q ss_pred             cccc--hhccCC
Q psy13010        270 IKKD--VENELS  279 (573)
Q Consensus       270 ~k~~--~~~~LP  279 (573)
                      +|.|  +..+||
T Consensus       219 ~K~d~~v~~dLP  230 (230)
T d1z63a1         219 TKYDKAIINDLP  230 (230)
T ss_dssp             CTTCHHHHTTSC
T ss_pred             ecCCccHhhcCC
Confidence            9999  556787
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure