Psyllid ID: psy13030
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1218 | 2.2.26 [Sep-21-2011] | |||||||
| Q27971 | 700 | Calpain-2 catalytic subun | no | N/A | 0.334 | 0.581 | 0.386 | 2e-81 | |
| Q11002 | 828 | Calpain-A OS=Drosophila m | no | N/A | 0.339 | 0.498 | 0.375 | 2e-81 | |
| Q9VT65 | 925 | Calpain-B OS=Drosophila m | no | N/A | 0.339 | 0.446 | 0.371 | 2e-80 | |
| O08529 | 700 | Calpain-2 catalytic subun | yes | N/A | 0.342 | 0.595 | 0.373 | 2e-80 | |
| Q92177 | 810 | Calpain-3 OS=Gallus gallu | no | N/A | 0.376 | 0.566 | 0.320 | 1e-79 | |
| Q9GLG1 | 700 | Calpain-2 catalytic subun | N/A | N/A | 0.334 | 0.581 | 0.375 | 1e-79 | |
| P17655 | 700 | Calpain-2 catalytic subun | no | N/A | 0.334 | 0.581 | 0.375 | 2e-79 | |
| P34308 | 780 | Calpain clp-1 OS=Caenorha | no | N/A | 0.362 | 0.565 | 0.375 | 3e-79 | |
| Q07009 | 700 | Calpain-2 catalytic subun | yes | N/A | 0.334 | 0.581 | 0.375 | 1e-78 | |
| Q9UMQ6 | 739 | Calpain-11 OS=Homo sapien | no | N/A | 0.377 | 0.622 | 0.349 | 4e-78 |
| >sp|Q27971|CAN2_BOVIN Calpain-2 catalytic subunit OS=Bos taurus GN=CAPN2 PE=2 SV=2 | Back alignment and function desciption |
|---|
Score = 305 bits (780), Expect = 2e-81, Method: Compositional matrix adjust.
Identities = 166/429 (38%), Positives = 245/429 (57%), Gaps = 22/429 (5%)
Query: 179 RFDFEAGRLGDAWFLAAISSLTLTPKFLDRVIPPEQSFDPATNYCGLFRFRFWHFGEWKE 238
R D G LGD W LAAI+SLTL + L RV+P +QSF NY G+F F+FW +GEW E
Sbjct: 94 RTDICQGALGDCWLLAAIASLTLNEEILARVVPLDQSFQE--NYAGIFHFQFWQYGEWVE 151
Query: 239 ILVDDRLPTFQGRLVYLHSTNPTEFWAALLEKAYAKFYGCYENLTHGGSTTRALQDLTGG 298
++VDDRLPT G L+++HS +EFW+ALLEKAYAK GCYE L+ GG+TT +D TGG
Sbjct: 152 VVVDDRLPTKDGELLFVHSAEGSEFWSALLEKAYAKINGCYEALS-GGATTEGFEDFTGG 210
Query: 299 IVQSFALTNQDRYLTFQVLNSAVPRSSLLISSIKLEKEQKRQLRLRNGLITQHAYSVTGL 358
I + + L L F+++ A+ + SLL SI + + L+ HAYSVTG
Sbjct: 211 IAEWYELRKAPPNL-FRIIQKALQKGSLLGCSIDITSAADSEAITFQKLVKGHAYSVTGA 269
Query: 359 ARVRGPLGETPLVRLRNPWARGEWTGPWSERSWEWDGLSERDKELLSIRVSNDGEFWMSF 418
V L+R+RNPW EWTG W++ W+ + +E L+ R DGEFWMSF
Sbjct: 270 EEVESRGSLQKLIRIRNPWGEVEWTGQWNDNCPNWNTVDPEVRETLT-RQHEDGEFWMSF 328
Query: 419 EDFAKHFTHLDLVHVGPDDWMAEPALQSKQPWRAVLARRRWRTGYNAGGGPNFVETTSVN 478
DF +H++ L++ ++ PD ++ S + W+ WR G AGG N+ T +N
Sbjct: 329 NDFLRHYSRLEICNLTPDTLTSD----SYKKWKLTKMDGNWRRGSTAGGCRNYPNTFWMN 384
Query: 479 PQFHIQI------PRSSNNKCHVVVSVTQYYETQVDEKQKRTLYAIGFAVYEISSSMT-- 530
PQ+ I++ + C +V + Q + + K ++ IGF +YE+ +T
Sbjct: 385 PQYLIKLEEEDEDQEDGESGCTFLVGLIQKHRRR-QRKMGEDMHTIGFGIYEVPEELTGQ 443
Query: 531 ---RLTPQFVAHTKPLDVTNHSVA-REVVTFFTLPPGDFIVVPQTNVPDCDGKFLLRIFT 586
L+ +F T+ + ++ + REV+ F LPPG++IVVP T P+ DG F +R+F+
Sbjct: 444 TNIHLSKKFFLTTRARERSDTFINLREVLNRFKLPPGEYIVVPSTFEPNKDGDFCIRVFS 503
Query: 587 DEQRDFIVV 595
+++ D+ VV
Sbjct: 504 EKKADYQVV 512
|
Calcium-regulated non-lysosomal thiol-protease which catalyze limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. Bos taurus (taxid: 9913) EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: 5EC: 3 |
| >sp|Q11002|CANA_DROME Calpain-A OS=Drosophila melanogaster GN=CalpA PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9VT65|CANB_DROME Calpain-B OS=Drosophila melanogaster GN=CalpB PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O08529|CAN2_MOUSE Calpain-2 catalytic subunit OS=Mus musculus GN=Capn2 PE=2 SV=4 | Back alignment and function description |
|---|
| >sp|Q92177|CAN3_CHICK Calpain-3 OS=Gallus gallus GN=CAPN3 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9GLG1|CAN2_MACFA Calpain-2 catalytic subunit OS=Macaca fascicularis GN=CAPN2 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|P17655|CAN2_HUMAN Calpain-2 catalytic subunit OS=Homo sapiens GN=CAPN2 PE=1 SV=6 | Back alignment and function description |
|---|
| >sp|P34308|CAN_CAEEL Calpain clp-1 OS=Caenorhabditis elegans GN=clp-1 PE=3 SV=4 | Back alignment and function description |
|---|
| >sp|Q07009|CAN2_RAT Calpain-2 catalytic subunit OS=Rattus norvegicus GN=Capn2 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q9UMQ6|CAN11_HUMAN Calpain-11 OS=Homo sapiens GN=CAPN11 PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1218 | ||||||
| 328711398 | 791 | PREDICTED: calpain-1 catalytic subunit-l | 0.484 | 0.745 | 0.677 | 0.0 | |
| 242012016 | 745 | Calpain A, putative [Pediculus humanus c | 0.444 | 0.726 | 0.652 | 0.0 | |
| 91087981 | 693 | PREDICTED: similar to calpain [Tribolium | 0.394 | 0.694 | 0.739 | 0.0 | |
| 270011904 | 697 | hypothetical protein TcasGA2_TC005995 [T | 0.394 | 0.690 | 0.733 | 0.0 | |
| 321470736 | 660 | hypothetical protein DAPPUDRAFT_303364 [ | 0.344 | 0.634 | 0.623 | 1e-170 | |
| 357623312 | 745 | putative calpain [Danaus plexippus] | 0.485 | 0.793 | 0.379 | 1e-111 | |
| 157120993 | 587 | calpain [Aedes aegypti] gi|108874740|gb| | 0.334 | 0.693 | 0.460 | 1e-108 | |
| 170064830 | 570 | calpain [Culex quinquefasciatus] gi|1678 | 0.329 | 0.703 | 0.457 | 1e-105 | |
| 312385088 | 2524 | hypothetical protein AND_01192 [Anophele | 0.328 | 0.158 | 0.458 | 1e-105 | |
| 158300323 | 505 | AGAP012264-PA [Anopheles gambiae str. PE | 0.376 | 0.906 | 0.408 | 1e-101 |
| >gi|328711398|ref|XP_001944347.2| PREDICTED: calpain-1 catalytic subunit-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 881 bits (2277), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 437/645 (67%), Positives = 496/645 (76%), Gaps = 55/645 (8%)
Query: 33 HATRPDDKQSTLSR-YWTVERPRQTANYHAIKRACREKGILYEDPDFPPGPKLLFRNKKA 91
+ RP++K ST+SR YWTVERPRQ NYHA++R+CRE+G L+EDPDF GPK L++NK+
Sbjct: 64 NGVRPEEKISTVSRGYWTVERPRQQPNYHAVRRSCRERGALFEDPDFAAGPKCLYKNKRP 123
Query: 92 PVQSLVWMRPHEMCQRPKFYSEDSLQGRFDFEAGRLGDAWFLAAISSLTLTPKFLDRVIP 151
VQ +VWMRPHEMCQRPK F ++ RL +S+
Sbjct: 124 AVQPIVWMRPHEMCQRPK----------FMVDSTRLVSQGN-GVVSTGAGGGSGGSAGGE 172
Query: 152 PEQSFDPATNYCGLFRPKFYSEDSLQGRFDFEAGRLGDAWFLAAISSLTLTPKFLDRVIP 211
P ++ GR E G LGD FLAA+SSLTLTPKFLDRV+P
Sbjct: 173 PTRNG--------------TIGGGGGGRCGVEPGELGDHSFLAAVSSLTLTPKFLDRVVP 218
Query: 212 PEQSFDPATNYCGLFRFRFWHFGEWKEILVDDRLPTFQGRLVYLHSTNPTEFWAALLEKA 271
+QSFDP T+YCGLFRFRFW+FGEWKE+LVDD+LPT++GRLVY+ STNPTEFWAALLEKA
Sbjct: 219 LDQSFDPTTSYCGLFRFRFWYFGEWKEVLVDDKLPTYRGRLVYMRSTNPTEFWAALLEKA 278
Query: 272 YAKFYGCYENLTH-GGSTTRALQDLTGGIVQSFALTNQDRYLTFQVLNSAVPRSSLLISS 330
YAK YGCYEN++ G STTRALQDLTGGIVQSF L+NQDR+LT+QVLNSAVPRSSLLIS+
Sbjct: 279 YAKLYGCYENISGPGCSTTRALQDLTGGIVQSFGLSNQDRFLTYQVLNSAVPRSSLLIST 338
Query: 331 IKLEKEQKRQLRLRNGLITQHAYSVTGLARVRGPLGETPLVRLRNPWARGEWTGPWSERS 390
I L KE KRQLRLRNGL+TQHAYSVTGLARVRGPLG+TPLVRLRNPW GEWTGPWSERS
Sbjct: 339 ITL-KENKRQLRLRNGLMTQHAYSVTGLARVRGPLGDTPLVRLRNPWGEGEWTGPWSERS 397
Query: 391 WEWDGLSERDKELLSIRVSNDGEFWMSFEDFAKHFTHLDLVHVGPDDWMAEPALQSKQPW 450
WEWDGLS RDKELLS+RV NDGEFWMSFEDFA+HFT LD+VHV PDDWM EPAL SKQPW
Sbjct: 398 WEWDGLSGRDKELLSVRVRNDGEFWMSFEDFARHFTQLDIVHVSPDDWMTEPALHSKQPW 457
Query: 451 RAVLARRRWRTGYNAGGGPNFVETTSVNPQFHIQIPRSSNNKCHVVVSVTQYYETQVDEK 510
RAVLARRRWR+GYNAGGGP ETT++NPQFHI IPR+S NKCHVVVSV Q YET + K
Sbjct: 458 RAVLARRRWRSGYNAGGGPGHPETTAMNPQFHIGIPRTSGNKCHVVVSVVQQYETDPEAK 517
Query: 511 QKRTLYAIGFAVYEISSSMTRLTPQFVAHTKPLDVTNHSVAREVVTFFTLPPGDFIVVPQ 570
R L+AIGFAVYE+ S +RLTPQFVA +PLDVTNHSVAREVVTFFTLPPGD+IVVPQ
Sbjct: 518 GARPLFAIGFAVYEVPHSTSRLTPQFVAQQQPLDVTNHSVAREVVTFFTLPPGDYIVVPQ 577
Query: 571 TNVPDCDGKFLLRIFTDEQRDFIVVPQTNVPDCDGKFLLRIFTDEQSNIWEVNEDNMVFR 630
TNVP+CD KFLLRI TDEQSNIWEVN+DNMVF+
Sbjct: 578 TNVPNCDAKFLLRI---------------------------LTDEQSNIWEVNDDNMVFK 610
Query: 631 NISTEFLENTVVLPDGKSLVAKLLVKYPLEVDVSQFQKILRSHWK 675
NIS EFLE+TV+LPDGK L+ KL+VKYP E+DV Q QKILR+HWK
Sbjct: 611 NISAEFLEDTVILPDGKPLLTKLMVKYPPELDVIQLQKILRAHWK 655
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242012016|ref|XP_002426739.1| Calpain A, putative [Pediculus humanus corporis] gi|212510910|gb|EEB14001.1| Calpain A, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|91087981|ref|XP_973375.1| PREDICTED: similar to calpain [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270011904|gb|EFA08352.1| hypothetical protein TcasGA2_TC005995 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|321470736|gb|EFX81711.1| hypothetical protein DAPPUDRAFT_303364 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|357623312|gb|EHJ74516.1| putative calpain [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|157120993|ref|XP_001659815.1| calpain [Aedes aegypti] gi|108874740|gb|EAT38965.1| AAEL009196-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|170064830|ref|XP_001867691.1| calpain [Culex quinquefasciatus] gi|167882064|gb|EDS45447.1| calpain [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|312385088|gb|EFR29668.1| hypothetical protein AND_01192 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|158300323|ref|XP_320276.4| AGAP012264-PA [Anopheles gambiae str. PEST] gi|157013104|gb|EAA00526.4| AGAP012264-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1218 | ||||||
| MGI|MGI:88264 | 700 | Capn2 "calpain 2" [Mus musculu | 0.341 | 0.594 | 0.362 | 1.1e-110 | |
| ZFIN|ZDB-GENE-040426-1263 | 704 | capn1a "calpain 1, (mu/I) larg | 0.327 | 0.566 | 0.379 | 5.9e-110 | |
| UNIPROTKB|F1MXQ5 | 741 | CAPN11 "Uncharacterized protei | 0.333 | 0.547 | 0.394 | 1.3e-109 | |
| UNIPROTKB|P17655 | 700 | CAPN2 "Calpain-2 catalytic sub | 0.334 | 0.581 | 0.363 | 8.1e-109 | |
| UNIPROTKB|P00789 | 705 | P00789 "Calpain-1 catalytic su | 0.330 | 0.571 | 0.381 | 8.3e-109 | |
| RGD|2268 | 700 | Capn2 "calpain 2, (m/II) large | 0.334 | 0.581 | 0.363 | 1.8e-107 | |
| UNIPROTKB|F5GX91 | 739 | CAPN11 "Calpain-11" [Homo sapi | 0.334 | 0.550 | 0.385 | 2.3e-107 | |
| UNIPROTKB|Q9UMQ6 | 739 | CAPN11 "Calpain-11" [Homo sapi | 0.334 | 0.550 | 0.383 | 8.9e-107 | |
| ZFIN|ZDB-GENE-040912-97 | 725 | capn3 "calpain 3, (p94)" [Dani | 0.330 | 0.554 | 0.367 | 1e-105 | |
| UNIPROTKB|F1RQU6 | 709 | CAPN11 "Uncharacterized protei | 0.334 | 0.575 | 0.363 | 5.2e-105 |
| MGI|MGI:88264 Capn2 "calpain 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Score = 762 (273.3 bits), Expect = 1.1e-110, Sum P(4) = 1.1e-110
Identities = 160/441 (36%), Positives = 241/441 (54%)
Query: 179 RFDFEAGRLGDAWFLAAISSLTLTPKFLDRVIPPEQSFDPATNYCGLFRFRFWHFGEWKE 238
R D G LGD W LAAI+SLTL + L RV+PP+QSF NY G+F F+FW +GEW E
Sbjct: 94 RTDICQGALGDCWLLAAIASLTLNEEILARVVPPDQSFQE--NYAGIFHFQFWQYGEWVE 151
Query: 239 ILVDDRLPTFQGRLVYLHSTNPTEFWAALLEKAYAKFYGCYENLTHGGSTTRALQDLTGG 298
++VDDRLPT G L+++HS +EFW+ALLEKAYAK GCYE L+ GG+TT +D TGG
Sbjct: 152 VVVDDRLPTKDGELLFVHSAEGSEFWSALLEKAYAKINGCYEALS-GGATTEGFEDFTGG 210
Query: 299 IVQSFALTNQDRYLTFQVLNSAVPRXXXXXXXXXXXXXQKRQLRLRNGLITQHAYSVTGL 358
I + + L L F+++ A+ + + L+ HAYSVTG
Sbjct: 211 IAEWYELRKPPPNL-FKIIQKALEKGSLLGCSIDITSAADSEAVTYQKLVKGHAYSVTGA 269
Query: 359 ARVRGPLGETPLVRLRNPWARGEWTGPWSERSWEWDGLSERDKELLSIRVSNDGEFWMSF 418
V L+R+RNPW + EWTG W++ W+ + + L+ R DGEFWMSF
Sbjct: 270 EEVESSGSLQKLIRIRNPWGQVEWTGKWNDNCPSWNTVDPEVRANLTER-QEDGEFWMSF 328
Query: 419 EDFAKHFTHLDLVHVGPDDWMAEPALQSKQPWRAVLARRRWRTGYNAGGGPNFVETTSVN 478
DF +H++ L++ ++ PD + S + W+ WR G AGG N+ T +N
Sbjct: 329 SDFLRHYSRLEICNLTPDTLTCD----SYKKWKLTKMDGNWRRGSTAGGCRNYPNTFWMN 384
Query: 479 PQFHIQIPRSSNNK------CHVVVSVTQYYETQVDEKQKRTLYAIGFAVYEISSSMT-- 530
PQ+ I++ ++ C +V + Q + + K ++ IGF +YE+ +T
Sbjct: 385 PQYLIKLEEEDEDEEDGERGCTFLVGLIQKHRRR-QRKMGEDMHTIGFGIYEVPEELTGQ 443
Query: 531 ---RLTPQFVAHTKPLDVTNHSV-AREVVTFFTLPPGDFIVVPQTNVPDCDGKFLLRIFT 586
L F T+ + ++ + REV+ F LPPG++++VP T P DG F +R+F+
Sbjct: 444 TNIHLGKNFFLTTRARERSDTFINLREVLNRFKLPPGEYVLVPSTFEPHKDGDFCIRVFS 503
Query: 587 DEQRDFIVVP---QTNVPDCD 604
+++ D+ V + N+ + D
Sbjct: 504 EKKADYQAVDDEIEANIEEID 524
|
|
| ZFIN|ZDB-GENE-040426-1263 capn1a "calpain 1, (mu/I) large subunit a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MXQ5 CAPN11 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P17655 CAPN2 "Calpain-2 catalytic subunit" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P00789 P00789 "Calpain-1 catalytic subunit" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|2268 Capn2 "calpain 2, (m/II) large subunit" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5GX91 CAPN11 "Calpain-11" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UMQ6 CAPN11 "Calpain-11" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040912-97 capn3 "calpain 3, (p94)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RQU6 CAPN11 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.4.22 | 0.691 |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1218 | |||
| smart00230 | 318 | smart00230, CysPc, Calpain-like thiol protease fam | 3e-99 | |
| cd00044 | 315 | cd00044, CysPc, Calpains, domains IIa, IIb; calciu | 1e-91 | |
| pfam00648 | 302 | pfam00648, Peptidase_C2, Calpain family cysteine p | 2e-90 | |
| cd00044 | 315 | cd00044, CysPc, Calpains, domains IIa, IIb; calciu | 4e-48 | |
| smart00230 | 318 | smart00230, CysPc, Calpain-like thiol protease fam | 9e-48 | |
| pfam00648 | 302 | pfam00648, Peptidase_C2, Calpain family cysteine p | 1e-45 | |
| pfam01067 | 142 | pfam01067, Calpain_III, Calpain large subunit, dom | 2e-31 | |
| pfam00648 | 302 | pfam00648, Peptidase_C2, Calpain family cysteine p | 4e-26 | |
| smart00230 | 318 | smart00230, CysPc, Calpain-like thiol protease fam | 2e-25 | |
| cd00214 | 150 | cd00214, Calpain_III, Calpain, subdomain III | 7e-25 | |
| smart00720 | 143 | smart00720, calpain_III, calpain_III domain | 4e-24 | |
| cd00044 | 315 | cd00044, CysPc, Calpains, domains IIa, IIb; calciu | 1e-19 | |
| cd00044 | 315 | cd00044, CysPc, Calpains, domains IIa, IIb; calciu | 1e-06 | |
| smart00230 | 318 | smart00230, CysPc, Calpain-like thiol protease fam | 7e-06 | |
| pfam00648 | 302 | pfam00648, Peptidase_C2, Calpain family cysteine p | 2e-05 |
| >gnl|CDD|128526 smart00230, CysPc, Calpain-like thiol protease family | Back alignment and domain information |
|---|
Score = 318 bits (816), Expect = 3e-99
Identities = 149/385 (38%), Positives = 202/385 (52%), Gaps = 71/385 (18%)
Query: 59 YHAIKRACREKGILYEDPDFPPGPKLLFRNKKAPVQSLVWMRPHEMCQRPKFYSEDSLQG 118
Y A+++ C+E G L+EDP FP LF + + +VW +RP E+
Sbjct: 1 YEALRQYCKESGTLFEDPLFPANNGSLF-FSQRQRKFVVW-------KRPHEIFENPP-- 50
Query: 119 RFDFEAGRLGDAWFLAAISSLTLTPKFLDRVIPPEQSFDPATNYCGLFRPKFYSEDSLQG 178
+ + S
Sbjct: 51 ------------FIVGGAS----------------------------------------- 57
Query: 179 RFDFEAGRLGDAWFLAAISSLTLTPKFLDRVIPPEQSFDPATNYCGLFRFRFWHFGEWKE 238
R D G LGD W LAA++SLTL K LDRVIP +Q F NY G+F FRFW FG+W +
Sbjct: 58 RTDICQGVLGDCWLLAALASLTLREKLLDRVIPHDQEFSE--NYAGIFHFRFWRFGKWVD 115
Query: 239 ILVDDRLPTFQGRLVYLHSTNPTEFWAALLEKAYAKFYGCYENLTHGGSTTRALQDLTGG 298
+++DDRLPT+ G LV++HS + EFW+ALLEKAYAK GCYE L GGSTT AL+DLTGG
Sbjct: 116 VVIDDRLPTYNGELVFMHSNSRNEFWSALLEKAYAKLNGCYEAL-KGGSTTEALEDLTGG 174
Query: 299 IVQSFALTN--QDRYLTFQVLNSAVPRSSLLISSIKLEKEQKRQLRLRNGLITQHAYSVT 356
+ +S L +D F+ L A R SL+ SI + + + GL+ HAYSVT
Sbjct: 175 VAESIDLKEASKDPDNLFEDLFKAFERGSLMGCSIGAGTAVEEEEQKDCGLVKGHAYSVT 234
Query: 357 GLARVRGPLGETPLVRLRNPWARGEWTGPWSERSWEWDGLSERDKELLSIRVSNDGEFWM 416
+ V+G L+RLRNPW + EW GPWS+ S EW +S +K+ L + +DGEFWM
Sbjct: 235 DVREVQG--RRQELLRLRNPWGQVEWNGPWSDDSPEWRSVSASEKKNLGLTFDDDGEFWM 292
Query: 417 SFEDFAKHFTHLDLVHVGPDDWMAE 441
SFEDF +HF +++ ++ P D + E
Sbjct: 293 SFEDFLRHFDKVEICNLNP-DSLEE 316
|
Calpain-like thiol protease family (peptidase family C2). Calcium activated neutral protease (large subunit). Length = 318 |
| >gnl|CDD|238004 cd00044, CysPc, Calpains, domains IIa, IIb; calcium-dependent cytoplasmic cysteine proteinases, papain-like | Back alignment and domain information |
|---|
| >gnl|CDD|216041 pfam00648, Peptidase_C2, Calpain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|238004 cd00044, CysPc, Calpains, domains IIa, IIb; calcium-dependent cytoplasmic cysteine proteinases, papain-like | Back alignment and domain information |
|---|
| >gnl|CDD|128526 smart00230, CysPc, Calpain-like thiol protease family | Back alignment and domain information |
|---|
| >gnl|CDD|216041 pfam00648, Peptidase_C2, Calpain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|216279 pfam01067, Calpain_III, Calpain large subunit, domain III | Back alignment and domain information |
|---|
| >gnl|CDD|216041 pfam00648, Peptidase_C2, Calpain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|128526 smart00230, CysPc, Calpain-like thiol protease family | Back alignment and domain information |
|---|
| >gnl|CDD|238132 cd00214, Calpain_III, Calpain, subdomain III | Back alignment and domain information |
|---|
| >gnl|CDD|214786 smart00720, calpain_III, calpain_III domain | Back alignment and domain information |
|---|
| >gnl|CDD|238004 cd00044, CysPc, Calpains, domains IIa, IIb; calcium-dependent cytoplasmic cysteine proteinases, papain-like | Back alignment and domain information |
|---|
| >gnl|CDD|238004 cd00044, CysPc, Calpains, domains IIa, IIb; calcium-dependent cytoplasmic cysteine proteinases, papain-like | Back alignment and domain information |
|---|
| >gnl|CDD|128526 smart00230, CysPc, Calpain-like thiol protease family | Back alignment and domain information |
|---|
| >gnl|CDD|216041 pfam00648, Peptidase_C2, Calpain family cysteine protease | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1218 | |||
| KOG0045|consensus | 612 | 100.0 | ||
| smart00230 | 318 | CysPc Calpain-like thiol protease family. Calpain- | 100.0 | |
| PF00648 | 298 | Peptidase_C2: Calpain family cysteine protease Thi | 100.0 | |
| cd00044 | 315 | CysPc Calpains, domains IIa, IIb; calcium-dependen | 100.0 | |
| smart00230 | 318 | CysPc Calpain-like thiol protease family. Calpain- | 100.0 | |
| PF00648 | 298 | Peptidase_C2: Calpain family cysteine protease Thi | 100.0 | |
| cd00044 | 315 | CysPc Calpains, domains IIa, IIb; calcium-dependen | 100.0 | |
| KOG0045|consensus | 612 | 100.0 | ||
| cd00214 | 150 | Calpain_III Calpain, subdomain III. Calpains are c | 99.96 | |
| smart00720 | 143 | calpain_III calpain_III. | 99.95 | |
| PF01067 | 147 | Calpain_III: Calpain large subunit, domain III; In | 99.91 | |
| KOG0037|consensus | 221 | 99.86 | ||
| KOG0037|consensus | 221 | 99.65 | ||
| KOG0027|consensus | 151 | 99.35 | ||
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 99.34 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 99.33 | |
| KOG0027|consensus | 151 | 99.3 | ||
| KOG0028|consensus | 172 | 99.14 | ||
| KOG0028|consensus | 172 | 99.12 | ||
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 99.01 | |
| KOG0030|consensus | 152 | 98.96 | ||
| PTZ00183 | 158 | centrin; Provisional | 98.92 | |
| PTZ00184 | 149 | calmodulin; Provisional | 98.89 | |
| KOG0031|consensus | 171 | 98.88 | ||
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 98.85 | |
| PTZ00183 | 158 | centrin; Provisional | 98.72 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 98.7 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 98.68 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 98.67 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 98.67 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 98.66 | |
| PTZ00184 | 149 | calmodulin; Provisional | 98.64 | |
| KOG0030|consensus | 152 | 98.63 | ||
| PLN02964 | 644 | phosphatidylserine decarboxylase | 98.53 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 98.53 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 98.52 | |
| KOG0031|consensus | 171 | 98.51 | ||
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 98.48 | |
| KOG0034|consensus | 187 | 98.39 | ||
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 98.39 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 98.3 | |
| KOG0036|consensus | 463 | 98.24 | ||
| KOG0044|consensus | 193 | 98.21 | ||
| PF14658 | 66 | EF-hand_9: EF-hand domain | 98.14 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 98.12 | |
| KOG0044|consensus | 193 | 98.12 | ||
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 98.07 | |
| KOG0038|consensus | 189 | 97.89 | ||
| PLN02964 | 644 | phosphatidylserine decarboxylase | 97.64 | |
| KOG0041|consensus | 244 | 97.64 | ||
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 97.62 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 97.56 | |
| KOG0036|consensus | 463 | 97.55 | ||
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 97.55 | |
| KOG0034|consensus | 187 | 97.4 | ||
| KOG4223|consensus | 325 | 97.36 | ||
| KOG2643|consensus | 489 | 97.36 | ||
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 97.19 | |
| KOG0751|consensus | 694 | 97.04 | ||
| KOG4223|consensus | 325 | 97.0 | ||
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 96.94 | |
| KOG0040|consensus | 2399 | 96.88 | ||
| KOG0377|consensus | 631 | 96.81 | ||
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 96.27 | |
| KOG2562|consensus | 493 | 96.25 | ||
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 96.24 | |
| KOG0046|consensus | 627 | 95.98 | ||
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 95.86 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 95.52 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 95.43 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 95.33 | |
| KOG2643|consensus | 489 | 95.28 | ||
| PRK12309 | 391 | transaldolase/EF-hand domain-containing protein; P | 95.25 | |
| PF12763 | 104 | EF-hand_4: Cytoskeletal-regulatory complex EF hand | 95.21 | |
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 95.1 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 94.94 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 94.88 | |
| PF14788 | 51 | EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA | 94.88 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 94.58 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 94.4 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 94.23 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 94.14 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 93.68 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 93.57 | |
| KOG4065|consensus | 144 | 93.24 | ||
| PRK12309 | 391 | transaldolase/EF-hand domain-containing protein; P | 92.93 | |
| smart00054 | 29 | EFh EF-hand, calcium binding motif. EF-hands are c | 92.84 | |
| KOG4666|consensus | 412 | 92.82 | ||
| KOG0377|consensus | 631 | 92.05 | ||
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 91.56 | |
| PF10591 | 113 | SPARC_Ca_bdg: Secreted protein acidic and rich in | 90.84 | |
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 90.58 | |
| PF09279 | 83 | EF-hand_like: Phosphoinositide-specific phospholip | 88.49 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 87.98 | |
| KOG0038|consensus | 189 | 86.0 | ||
| PF14788 | 51 | EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA | 85.84 | |
| KOG4251|consensus | 362 | 84.56 | ||
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 83.46 | |
| PF09149 | 104 | DUF1935: Domain of unknown function (DUF1935); Int | 81.49 | |
| KOG2562|consensus | 493 | 81.18 | ||
| KOG0041|consensus | 244 | 80.07 |
| >KOG0045|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.5e-96 Score=888.54 Aligned_cols=515 Identities=37% Similarity=0.699 Sum_probs=466.0
Q ss_pred CCCHHHHHHHHHHcCCCeeCCCCCCCCCCCCCCCCCCC---CcceeecCcccccCCcccccCccccccccccCcCcchhh
Q psy13030 56 TANYHAIKRACREKGILYEDPDFPPGPKLLFRNKKAPV---QSLVWMRPHEMCQRPKFYSEDSLQGRFDFEAGRLGDAWF 132 (1218)
Q Consensus 56 ~~~~~~l~~~c~~~~~~f~D~~Fp~~~~Sl~~~~~~~~---~~~~W~Rp~e~~~~p~~~~~~~~~~~~~~~~~~~~~~~~ 132 (1218)
.++|+++++.|++++.+|+||.|||.++||+++...|. ..+.|+||+||+.+|+++.++ .
T Consensus 10 ~~~~~~~~~~cl~~~~~F~D~~FP~~~~Sl~~~~~~p~~~~~~i~W~RP~ei~~~p~~i~~~---------------~-- 72 (612)
T KOG0045|consen 10 MKDFERLRRDCLPAKSLFVDALFPAADSSLFYKLSTPLAQFSDIVWKRPQEICANPRLIVDG---------------P-- 72 (612)
T ss_pred hhhHHHHHHHHhhcCCcccccCCCCCCccccccccCCCcccccceecCcccccCCCCeecCC---------------C--
Confidence 56899999999999999999999999999999876564 689999999999999999887 3
Q ss_pred HHhhcccccCccccccCCCCCCCCCCCcccccccCCcccccCCCCCccccccCCCCCchHHHHHHHhccCcccccccccC
Q psy13030 133 LAAISSLTLTPKFLDRVIPPEQSFDPATNYCGLFRPKFYSEDSLQGRFDFEAGRLGDAWFLAAISSLTLTPKFLDRVIPP 212 (1218)
Q Consensus 133 ~~~~~~~~~~~~~~~r~~p~~~~~~~~~~~~~lf~~~~~~~~~~~~~~dI~QG~lGDCwllaAl~~La~~~~ll~~v~~~ 212 (1218)
+++||+||.|||||||||+|+||.+++++.+|+|+
T Consensus 73 ---------------------------------------------~~~di~Qg~lgdCw~laA~a~la~~~~ll~~vip~ 107 (612)
T KOG0045|consen 73 ---------------------------------------------SRFDVKQGLLGDCWFLAACAALALRPELLDKVIPQ 107 (612)
T ss_pred ---------------------------------------------CcceeEEeeecchHHHHHHHHhhcCHHHHHhccCC
Confidence 79999999999999999999999999999999999
Q ss_pred CCCCCCCCCCCceEEEeeeeCCeEEEEEecccccccCCcEEEEecCCCCchhHHHHHHHhhcccCCcccccCCCChHHHH
Q psy13030 213 EQSFDPATNYCGLFRFRFWHFGEWKEILVDDRLPTFQGRLVYLHSTNPTEFWAALLEKAYAKFYGCYENLTHGGSTTRAL 292 (1218)
Q Consensus 213 ~q~~~~~~~~~G~y~~r~~~~G~w~~VvVDD~lP~~~g~~~f~~s~~~~e~W~~LLEKAyAKl~GsY~~l~~gg~~~~al 292 (1218)
+|+|+ ++|+|+||||||++|+|++|+|||+|||.+|++.|++++..||||+|||||||||++|||++| .||.+.+||
T Consensus 108 ~~~~~--~~yaGif~f~~w~~G~W~~VvIDD~LP~~~~~~~~~~s~~~~efW~aLlEKAyaKl~GsY~~l-~gg~~~~a~ 184 (612)
T KOG0045|consen 108 DQSFQ--ENYAGIFHFRFWQNGEWVEVVIDDRLPTSNGGLLFSHSSGKNEFWAALLEKAYAKLLGSYEAL-HGGSTIDAL 184 (612)
T ss_pred Ccccc--cccceEEEEEEEeCCeEEEEEeeeecceEcCCEEEEeecCCceeHHHHHHHHHHHHhCcccCC-CCCchhhHH
Confidence 99998 899999999999999999999999999999999999999889999999999999999999999 999999999
Q ss_pred hhccCCeeEEEEccCCCc----cchHHHHHhhcCCCCeEEEecccchhHH--HHHhhhcCccccceeeeeeeEEEcCCCC
Q psy13030 293 QDLTGGIVQSFALTNQDR----YLTFQVLNSAVPRSSLLISSIKLEKEQK--RQLRLRNGLITQHAYSVTGLARVRGPLG 366 (1218)
Q Consensus 293 ~dlTG~~~~~~~l~~~~~----~l~~~~l~~~~~~g~l~~~~~~~~~~~~--~~~~~~~GLv~~HaYsV~~v~~v~~~~~ 366 (1218)
++|||+++|.+.+.+.+. ++ +..+.++.++|++++|++......+ .+....+||+++|||+|+++++++++++
T Consensus 185 ~~lTG~~~e~~~l~~~~~~~~~~l-~~~~~~~~~~~~~l~c~~~~~~~~~~~~~~~~~~gL~~~HaYsit~~~~~~~~~~ 263 (612)
T KOG0045|consen 185 VDLTGGVTEPFDLNKTPKSFKNNL-VWALLKSAHRGSLLLCSIESKDPTEEEEEAKLRNGLVKGHAYAITDVREVQGRGG 263 (612)
T ss_pred HhccCCccceeEcccCcchhHHHH-HHHHHHhhhccCceeeeccccccchhHHHHHhhcCccccccEEEEEEEEeecccc
Confidence 999999999999998877 77 7888889999999999986512222 2667999999999999999999999888
Q ss_pred cccEEEEECCCCCCcccCCCCCCCcccCCCCHHHHHHhCCccCCCCeeccchHHHHhhccccceeeeCCCCCCCcccccC
Q psy13030 367 ETPLVRLRNPWARGEWTGPWSERSWEWDGLSERDKELLSIRVSNDGEFWMSFEDFAKHFTHLDLVHVGPDDWMAEPALQS 446 (1218)
Q Consensus 367 ~~~LvrLrNPWG~~eW~G~wsd~s~~W~~~~~~~~~~l~~~~~~dG~FWMs~~Df~~~F~~l~ic~~~p~~~~~~~~~~~ 446 (1218)
.++|||||||||..||+|+|||.+++|..+.+..++.+..+..+||+|||+++||+++|+.++||++.|+.+... .
T Consensus 264 ~~~lirlrNPwg~~~W~G~wsd~~~~W~~v~~~~~~~~~~~~~~dGeFWms~~dF~~~F~~~~vC~~~~~~~~~~----~ 339 (612)
T KOG0045|consen 264 KHRLIRLRNPWGESEWNGPWSDGSEEWHLVDKSKLSELGRQPLDDGEFWMSFDDFLREFDSLTVCRLRPDWLESR----N 339 (612)
T ss_pred cceeEEecCCcCCceeccccccCCcchhhhCHHHHhhcccccccCCCeeeeHHHHHhhCCeEeecCCCcchhhhh----h
Confidence 999999999999999999999999999999999999998886799999999999999999999999999877544 3
Q ss_pred CCCcEEEeeeeee--eecccCCCCCCccCCccCCCeEEEEeccCCCCceEEEEEEeecccchhhhhccCceeeEEEEEEE
Q psy13030 447 KQPWRAVLARRRW--RTGYNAGGGPNFVETTSVNPQFHIQIPRSSNNKCHVVVSVTQYYETQVDEKQKRTLYAIGFAVYE 524 (1218)
Q Consensus 447 ~~~W~~~~~~G~W--~~g~taGG~~n~~~Tf~~NPQy~l~l~~~~~~~~~V~VsL~Q~~~R~~~~~~~~~~~~Igf~V~k 524 (1218)
...|....++|+| .++.++|||+|+.+||++||||.|.+..+....|.+++.|+|+++|. .++.+.+..+|||+||+
T Consensus 340 ~~~~~~~~~~~~w~~~~~~t~ggc~~~~~tF~~npq~~~~~~~~~~~~~~~v~~~~q~~~~~-~~~~~~~~~~ig~~i~~ 418 (612)
T KOG0045|consen 340 QLQWVKLSLDGEWELARGVTAGGCRNSVDTFDRNPQYILAVRKPTKSLCAVVLALFQKTRRG-ERSFGANILDIGFHIYE 418 (612)
T ss_pred eeeeeeeecCCccceeecccCCCCccCcccccCCceEEEEecCCCccceEEEEEeecccccc-cccccceeeecceEEEE
Confidence 3589999999999 89999999999999999999999999865556799999999999998 67777799999999999
Q ss_pred EcCCCcccCcccccccCCCccCCccc-eeeeEEEEEecCCCeEEeeccCCCCCCcceeEEEecccccceeeecCCCCCCC
Q psy13030 525 ISSSMTRLTPQFVAHTKPLDVTNHSV-AREVVTFFTLPPGDFIVVPQTNVPDCDGKFLLRIFTDEQRDFIVVPQTNVPDC 603 (1218)
Q Consensus 525 v~~~~~~l~~~~f~~~~~~~~s~~~~-~ReVs~r~~L~PG~YvIIPsT~~p~~~~~f~l~~~~~~~~~~~~~~~~~~~~~ 603 (1218)
++.+ ...++..+.+.+.+..++ .|+|+.++.+|||.|++|||||+|+ +
T Consensus 419 v~~~----~~~~~~~~~~~~~~~~~i~~r~v~~~~~~P~~~y~~~pst~~~~---------------------------~ 467 (612)
T KOG0045|consen 419 VPLE----GKYFVLDNAPIASSSSFINNREVSVRFRLPPGTYVIVPSTFEPG---------------------------E 467 (612)
T ss_pred ecCC----CCceEecccchhcccccccceeEEEEecCCCcceeecccCCCCC---------------------------C
Confidence 9754 456677778899999999 9999999999999999999999999 9
Q ss_pred CCCeeeeeeccCcccccccCccccccccccccccccCccChhhHHHHHHHhcCCCCccCHHHHHHHHhhhccCcccccCC
Q psy13030 604 DGKFLLRIFTDEQSNIWEVNEDNMVFRNISTEFLENTVVLPDGKSLVAKLLVKYPLEVDVSQFQKILRSHWKENTVVLPD 683 (1218)
Q Consensus 604 e~~F~LRVfS~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~lF~~~ag~~d~ei~a~eLq~~Ln~~~~~~~~~~~~ 683 (1218)
+++|+|||||+......+ +++|...+++..++....+ +|+.+.
T Consensus 468 ~~~f~lrvfs~~~~~~~~------------------------------------~~~i~~~~~~~~~~~~~~~-~~~~~~ 510 (612)
T KOG0045|consen 468 EGEFLLRVFSNVKVKSEE------------------------------------DMEISLDETKRSTNIIVMK-GFSLGE 510 (612)
T ss_pred CccEEEEEeecccccCcc------------------------------------ceEEeecccccceeeeeec-ceehhh
Confidence 999999999987654332 2355555555555544433 799999
Q ss_pred CceeeeeeccCCCCccChHHHHHHHHHHHH
Q psy13030 684 GKSLVAKLLVKYPLEVDVSQFQKILRSHWK 713 (1218)
Q Consensus 684 crs~v~~~d~~~~g~l~~~ef~~l~~~~w~ 713 (1218)
|+.|+++++.+.+++++..+|..+ |.
T Consensus 511 ~~~~~~~~~~~~~~k~s~~~~~~~----~~ 536 (612)
T KOG0045|consen 511 CGDKWKLSSTLVNTKVSRSSEFIL----TV 536 (612)
T ss_pred hchhhhccccccccccchhhceee----ee
Confidence 999999999999999999999999 77
|
|
| >smart00230 CysPc Calpain-like thiol protease family | Back alignment and domain information |
|---|
| >PF00648 Peptidase_C2: Calpain family cysteine protease This is family C2 in the peptidase classification | Back alignment and domain information |
|---|
| >cd00044 CysPc Calpains, domains IIa, IIb; calcium-dependent cytoplasmic cysteine proteinases, papain-like | Back alignment and domain information |
|---|
| >smart00230 CysPc Calpain-like thiol protease family | Back alignment and domain information |
|---|
| >PF00648 Peptidase_C2: Calpain family cysteine protease This is family C2 in the peptidase classification | Back alignment and domain information |
|---|
| >cd00044 CysPc Calpains, domains IIa, IIb; calcium-dependent cytoplasmic cysteine proteinases, papain-like | Back alignment and domain information |
|---|
| >KOG0045|consensus | Back alignment and domain information |
|---|
| >cd00214 Calpain_III Calpain, subdomain III | Back alignment and domain information |
|---|
| >smart00720 calpain_III calpain_III | Back alignment and domain information |
|---|
| >PF01067 Calpain_III: Calpain large subunit, domain III; InterPro: IPR022682 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG0037|consensus | Back alignment and domain information |
|---|
| >KOG0037|consensus | Back alignment and domain information |
|---|
| >KOG0027|consensus | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >KOG0027|consensus | Back alignment and domain information |
|---|
| >KOG0028|consensus | Back alignment and domain information |
|---|
| >KOG0028|consensus | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >KOG0030|consensus | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >KOG0031|consensus | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >KOG0030|consensus | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >KOG0031|consensus | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >KOG0034|consensus | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >KOG0036|consensus | Back alignment and domain information |
|---|
| >KOG0044|consensus | Back alignment and domain information |
|---|
| >PF14658 EF-hand_9: EF-hand domain | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >KOG0044|consensus | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >KOG0038|consensus | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >KOG0041|consensus | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >KOG0036|consensus | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >KOG0034|consensus | Back alignment and domain information |
|---|
| >KOG4223|consensus | Back alignment and domain information |
|---|
| >KOG2643|consensus | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >KOG0751|consensus | Back alignment and domain information |
|---|
| >KOG4223|consensus | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >KOG0040|consensus | Back alignment and domain information |
|---|
| >KOG0377|consensus | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >KOG2562|consensus | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >KOG0046|consensus | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >KOG2643|consensus | Back alignment and domain information |
|---|
| >PRK12309 transaldolase/EF-hand domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >KOG4065|consensus | Back alignment and domain information |
|---|
| >PRK12309 transaldolase/EF-hand domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >smart00054 EFh EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >KOG4666|consensus | Back alignment and domain information |
|---|
| >KOG0377|consensus | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >KOG0038|consensus | Back alignment and domain information |
|---|
| >PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A | Back alignment and domain information |
|---|
| >KOG4251|consensus | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >PF09149 DUF1935: Domain of unknown function (DUF1935); InterPro: IPR015232 This entry represents a conserved region found in various bacterial and eukaryotic hypothetical proteins, as well as in the cysteine protease calpain | Back alignment and domain information |
|---|
| >KOG2562|consensus | Back alignment and domain information |
|---|
| >KOG0041|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1218 | ||||
| 1kfx_L | 699 | Crystal Structure Of Human M-Calpain Form I Length | 4e-77 | ||
| 1kfx_L | 699 | Crystal Structure Of Human M-Calpain Form I Length | 2e-26 | ||
| 3df0_A | 714 | Calcium-Dependent Complex Between M-Calpain And Cal | 1e-76 | ||
| 3df0_A | 714 | Calcium-Dependent Complex Between M-Calpain And Cal | 7e-27 | ||
| 1df0_A | 700 | Crystal Structure Of M-Calpain Length = 700 | 1e-76 | ||
| 1df0_A | 700 | Crystal Structure Of M-Calpain Length = 700 | 7e-27 | ||
| 1u5i_A | 700 | Crystal Structure Analysis Of Rat M-Calpain Mutant | 2e-76 | ||
| 1u5i_A | 700 | Crystal Structure Analysis Of Rat M-Calpain Mutant | 7e-27 | ||
| 1qxp_A | 900 | Crystal Structure Of A Mu-Like Calpain Length = 900 | 1e-75 | ||
| 1qxp_A | 900 | Crystal Structure Of A Mu-Like Calpain Length = 900 | 3e-24 | ||
| 1qxp_A | 900 | Crystal Structure Of A Mu-Like Calpain Length = 900 | 5e-04 | ||
| 2p0r_A | 333 | Structure Of Human Calpain 9 In Complex With Leupep | 2e-58 | ||
| 2p0r_A | 333 | Structure Of Human Calpain 9 In Complex With Leupep | 4e-28 | ||
| 1ziv_A | 339 | Catalytic Domain Of Human Calpain-9 Length = 339 | 2e-58 | ||
| 1ziv_A | 339 | Catalytic Domain Of Human Calpain-9 Length = 339 | 3e-28 | ||
| 1mdw_A | 328 | Crystal Structure Of Calcium-bound Protease Core Of | 1e-56 | ||
| 1mdw_A | 328 | Crystal Structure Of Calcium-bound Protease Core Of | 8e-27 | ||
| 2nqa_A | 326 | Catalytic Domain Of Human Calpain 8 Length = 326 | 6e-56 | ||
| 2nqa_A | 326 | Catalytic Domain Of Human Calpain 8 Length = 326 | 2e-24 | ||
| 1kxr_A | 339 | Crystal Structure Of Calcium-Bound Protease Core Of | 3e-55 | ||
| 1kxr_A | 339 | Crystal Structure Of Calcium-Bound Protease Core Of | 5e-24 | ||
| 1tl9_A | 339 | High Resolution Crystal Structure Of Calpain I Prot | 3e-55 | ||
| 1tl9_A | 339 | High Resolution Crystal Structure Of Calpain I Prot | 6e-24 | ||
| 2ary_A | 351 | Catalytic Domain Of Human Calpain-1 Length = 351 | 3e-54 | ||
| 2ary_A | 351 | Catalytic Domain Of Human Calpain-1 Length = 351 | 2e-23 | ||
| 1zcm_A | 321 | Human Calpain Protease Core Inhibited By Zllych2f L | 7e-54 | ||
| 1zcm_A | 321 | Human Calpain Protease Core Inhibited By Zllych2f L | 4e-24 |
| >pdb|1KFX|L Chain L, Crystal Structure Of Human M-Calpain Form I Length = 699 | Back alignment and structure |
|
| >pdb|1KFX|L Chain L, Crystal Structure Of Human M-Calpain Form I Length = 699 | Back alignment and structure |
| >pdb|3DF0|A Chain A, Calcium-Dependent Complex Between M-Calpain And Calpastatin Length = 714 | Back alignment and structure |
| >pdb|3DF0|A Chain A, Calcium-Dependent Complex Between M-Calpain And Calpastatin Length = 714 | Back alignment and structure |
| >pdb|1DF0|A Chain A, Crystal Structure Of M-Calpain Length = 700 | Back alignment and structure |
| >pdb|1DF0|A Chain A, Crystal Structure Of M-Calpain Length = 700 | Back alignment and structure |
| >pdb|1U5I|A Chain A, Crystal Structure Analysis Of Rat M-Calpain Mutant Lys10 Thr Length = 700 | Back alignment and structure |
| >pdb|1U5I|A Chain A, Crystal Structure Analysis Of Rat M-Calpain Mutant Lys10 Thr Length = 700 | Back alignment and structure |
| >pdb|1QXP|A Chain A, Crystal Structure Of A Mu-Like Calpain Length = 900 | Back alignment and structure |
| >pdb|1QXP|A Chain A, Crystal Structure Of A Mu-Like Calpain Length = 900 | Back alignment and structure |
| >pdb|1QXP|A Chain A, Crystal Structure Of A Mu-Like Calpain Length = 900 | Back alignment and structure |
| >pdb|2P0R|A Chain A, Structure Of Human Calpain 9 In Complex With Leupeptin Length = 333 | Back alignment and structure |
| >pdb|2P0R|A Chain A, Structure Of Human Calpain 9 In Complex With Leupeptin Length = 333 | Back alignment and structure |
| >pdb|1ZIV|A Chain A, Catalytic Domain Of Human Calpain-9 Length = 339 | Back alignment and structure |
| >pdb|1ZIV|A Chain A, Catalytic Domain Of Human Calpain-9 Length = 339 | Back alignment and structure |
| >pdb|1MDW|A Chain A, Crystal Structure Of Calcium-bound Protease Core Of Calpain Ii Reveals The Basis For Intrinsic Inactivation Length = 328 | Back alignment and structure |
| >pdb|1MDW|A Chain A, Crystal Structure Of Calcium-bound Protease Core Of Calpain Ii Reveals The Basis For Intrinsic Inactivation Length = 328 | Back alignment and structure |
| >pdb|2NQA|A Chain A, Catalytic Domain Of Human Calpain 8 Length = 326 | Back alignment and structure |
| >pdb|2NQA|A Chain A, Catalytic Domain Of Human Calpain 8 Length = 326 | Back alignment and structure |
| >pdb|1KXR|A Chain A, Crystal Structure Of Calcium-Bound Protease Core Of Calpain I Length = 339 | Back alignment and structure |
| >pdb|1KXR|A Chain A, Crystal Structure Of Calcium-Bound Protease Core Of Calpain I Length = 339 | Back alignment and structure |
| >pdb|1TL9|A Chain A, High Resolution Crystal Structure Of Calpain I Protease Core In Complex With Leupeptin Length = 339 | Back alignment and structure |
| >pdb|1TL9|A Chain A, High Resolution Crystal Structure Of Calpain I Protease Core In Complex With Leupeptin Length = 339 | Back alignment and structure |
| >pdb|2ARY|A Chain A, Catalytic Domain Of Human Calpain-1 Length = 351 | Back alignment and structure |
| >pdb|2ARY|A Chain A, Catalytic Domain Of Human Calpain-1 Length = 351 | Back alignment and structure |
| >pdb|1ZCM|A Chain A, Human Calpain Protease Core Inhibited By Zllych2f Length = 321 | Back alignment and structure |
| >pdb|1ZCM|A Chain A, Human Calpain Protease Core Inhibited By Zllych2f Length = 321 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 | Back alignment and structure |
|---|
Score = 372 bits (956), Expect = e-114
Identities = 184/624 (29%), Positives = 275/624 (44%), Gaps = 83/624 (13%)
Query: 30 MNGHATRPDDKQSTLSRYWTVERPRQTAN--YHAIKRACREKGILYEDPDFPPGPKLLFR 87
M G A + + + ER + N Y ++ C E G L++DP FP
Sbjct: 1 MAGIAMKLAKDREAAEGLGSHERAIKYLNQDYETLRNECLEAGALFQDPSFPA------- 53
Query: 88 NKKAPVQSLVWMRPHEMCQRPKFYSEDSLQGRFDFEAGRLGDAWFLAAISSLTLTPKFLD 147
+ E + ++
Sbjct: 54 -----------------LPSSLGFKELGPYSSK----------------------TRGIE 74
Query: 148 RVIPPEQSFDPATNYCGLFRPKFYSEDSLQGRFDFEAGRLGDAWFLAAISSLTLTPKFLD 207
P E DP +F + R D G LGD+W LAAI+SLTL + L
Sbjct: 75 WKRPTEICADP----------QFIIGGA--TRTDICQGALGDSWLLAAIASLTLNEEILA 122
Query: 208 RVIPPEQSFDPATNYCGLFRFRFWHFGEWKEILVDDRLPTFQGRLVYLHSTNPTEFWAAL 267
RV+P +QSF NY G+F F+FW +GEW E++VDDRLPT G L+++HS +EFW+AL
Sbjct: 123 RVVPLDQSFQE--NYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSAL 180
Query: 268 LEKAYAKFYGCYENLTHGGSTTRALQDLTGGIVQSFALTNQDRYLTFQVLNSAVPRSSLL 327
LEKAYAK GCYE L GG+TT +D TGGI + + L L F+++ A+ + SLL
Sbjct: 181 LEKAYAKINGCYEAL-SGGATTEGFEDFTGGIAEWYELRKPPPNL-FKIIQKALEKGSLL 238
Query: 328 ISSIKLEKEQKRQLRLRNGLITQHAYSVTGLARVRGPLGETPLVRLRNPWARGEWTGPWS 387
SI + + L+ HAYSVTG V L+R+RNPW + EWTG W+
Sbjct: 239 GCSIDITSAADSEAVTYQKLVKGHAYSVTGAEEVESSGSLQKLIRIRNPWGQVEWTGKWN 298
Query: 388 ERSWEWDGLSERDKELLSIRVSNDGEFWMSFEDFAKHFTHLDLVHVGPDDWMAEPALQSK 447
+ W+ + + L+ R DGEFWMSF DF +H++ L++ ++ PD S
Sbjct: 299 DNCPSWNTVDPEVRANLTER-QEDGEFWMSFSDFLRHYSRLEICNLTPDTL----TCDSY 353
Query: 448 QPWRAVLARRRWRTGYNAGGGPNFVETTSVNPQFHIQI------PRSSNNKCHVVVSVTQ 501
+ W+ WR G AGG N+ T +NPQ+ I++ C +V + Q
Sbjct: 354 KKWKLTKMDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDDEDGERGCTFLVGLIQ 413
Query: 502 YYETQVDEKQKRTLYAIGFAVYEISSSMTRLTPQ------FVAHTKPLDVTNHSVAREVV 555
+ + K ++ IGF +YE+ +T T F+ REV+
Sbjct: 414 KHRRR-QRKMGEDMHTIGFGIYEVPEELTGQTNIHLSKNFFLTTRARERSDTFINLREVL 472
Query: 556 TFFTLPPGDFIVVPQTNVPDCDGKFLLRIFTDEQRDFIVVPQTNVPDCDGKFLLRIFTDE 615
F LPPG++++VP T P +G F +R+F++++ D+ V + + +
Sbjct: 473 NRFKLPPGEYVLVPSTFEPHKNGDFCIRVFSEKKADYQTVDDEIEANIEEIEANEEDIGD 532
Query: 616 QSNIWEVNEDNMVFRNISTEFLEN 639
IS L+
Sbjct: 533 GFRRLFAQLAGE-DAEISAFELQT 555
|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 | Back alignment and structure |
|---|
| >2nqa_A Calpain 8; calpain, calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC; HET: AR7; 2.20A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >2nqa_A Calpain 8; calpain, calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC; HET: AR7; 2.20A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >2nqa_A Calpain 8; calpain, calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC; HET: AR7; 2.20A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >2nqa_A Calpain 8; calpain, calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC; HET: AR7; 2.20A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >2r9f_A Calpain-1 catalytic subunit; protease, peptidase, inhibitor, alpha-ketoamide, hydrolase, thiol protease; HET: K2Z; 1.60A {Rattus norvegicus} SCOP: d.3.1.3 PDB: 1tlo_A* 2g8e_A* 1tl9_A* 2nqg_A* 2nqi_A* 2r9c_A* 2g8j_A* 1kxr_A 2ary_A 1zcm_A* 1mdw_A Length = 339 | Back alignment and structure |
|---|
| >2r9f_A Calpain-1 catalytic subunit; protease, peptidase, inhibitor, alpha-ketoamide, hydrolase, thiol protease; HET: K2Z; 1.60A {Rattus norvegicus} SCOP: d.3.1.3 PDB: 1tlo_A* 2g8e_A* 1tl9_A* 2nqg_A* 2nqi_A* 2r9c_A* 2g8j_A* 1kxr_A 2ary_A 1zcm_A* 1mdw_A Length = 339 | Back alignment and structure |
|---|
| >2r9f_A Calpain-1 catalytic subunit; protease, peptidase, inhibitor, alpha-ketoamide, hydrolase, thiol protease; HET: K2Z; 1.60A {Rattus norvegicus} SCOP: d.3.1.3 PDB: 1tlo_A* 2g8e_A* 1tl9_A* 2nqg_A* 2nqi_A* 2r9c_A* 2g8j_A* 1kxr_A 2ary_A 1zcm_A* 1mdw_A Length = 339 | Back alignment and structure |
|---|
| >2r9f_A Calpain-1 catalytic subunit; protease, peptidase, inhibitor, alpha-ketoamide, hydrolase, thiol protease; HET: K2Z; 1.60A {Rattus norvegicus} SCOP: d.3.1.3 PDB: 1tlo_A* 2g8e_A* 1tl9_A* 2nqg_A* 2nqi_A* 2r9c_A* 2g8j_A* 1kxr_A 2ary_A 1zcm_A* 1mdw_A Length = 339 | Back alignment and structure |
|---|
| >1ziv_A Calpain 9; cysteine protease, papain, calcium-dependent, thiol protease, structural genomics consortium, SGC, hydrolase; 2.31A {Homo sapiens} SCOP: d.3.1.3 PDB: 2p0r_A* Length = 339 | Back alignment and structure |
|---|
| >1ziv_A Calpain 9; cysteine protease, papain, calcium-dependent, thiol protease, structural genomics consortium, SGC, hydrolase; 2.31A {Homo sapiens} SCOP: d.3.1.3 PDB: 2p0r_A* Length = 339 | Back alignment and structure |
|---|
| >1ziv_A Calpain 9; cysteine protease, papain, calcium-dependent, thiol protease, structural genomics consortium, SGC, hydrolase; 2.31A {Homo sapiens} SCOP: d.3.1.3 PDB: 2p0r_A* Length = 339 | Back alignment and structure |
|---|
| >1ziv_A Calpain 9; cysteine protease, papain, calcium-dependent, thiol protease, structural genomics consortium, SGC, hydrolase; 2.31A {Homo sapiens} SCOP: d.3.1.3 PDB: 2p0r_A* Length = 339 | Back alignment and structure |
|---|
| >1ziv_A Calpain 9; cysteine protease, papain, calcium-dependent, thiol protease, structural genomics consortium, SGC, hydrolase; 2.31A {Homo sapiens} SCOP: d.3.1.3 PDB: 2p0r_A* Length = 339 | Back alignment and structure |
|---|
| >2qfe_A Calpain-7; C2-like domain, hydrolase, nuclear protein, protease, thiol protease; 1.45A {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Length = 174 | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1218 | |||
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 100.0 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 100.0 | |
| 2r9f_A | 339 | Calpain-1 catalytic subunit; protease, peptidase, | 100.0 | |
| 1ziv_A | 339 | Calpain 9; cysteine protease, papain, calcium-depe | 100.0 | |
| 2nqa_A | 326 | Calpain 8; calpain, calcium-dependent cytoplasmic | 100.0 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 100.0 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 100.0 | |
| 1ziv_A | 339 | Calpain 9; cysteine protease, papain, calcium-depe | 100.0 | |
| 2r9f_A | 339 | Calpain-1 catalytic subunit; protease, peptidase, | 100.0 | |
| 2nqa_A | 326 | Calpain 8; calpain, calcium-dependent cytoplasmic | 100.0 | |
| 2qfe_A | 148 | Calpain-7; C2-like domain, hydrolase, nuclear prot | 99.92 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 99.68 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 99.57 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 99.57 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 99.55 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 99.54 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 99.53 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 99.53 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 99.53 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 99.42 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 99.36 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 99.34 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 99.3 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 99.3 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 99.29 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 99.28 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 99.27 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 99.26 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 99.25 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 99.24 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 99.24 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 99.23 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 99.23 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 99.23 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 99.23 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 99.23 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 99.23 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 99.22 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 99.21 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 99.21 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 99.2 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.2 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 99.19 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 99.19 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 99.19 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 99.18 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 99.17 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 99.17 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 99.17 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 99.17 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 99.15 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 99.15 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 99.15 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 99.14 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.14 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 99.14 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 99.14 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 99.14 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 99.13 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 99.13 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 99.12 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 99.12 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 99.12 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 99.12 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 99.11 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 99.11 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 99.11 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 99.1 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 99.1 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 99.09 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 99.09 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 99.09 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 99.09 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 99.09 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 99.09 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 99.08 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 99.07 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 99.06 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 99.06 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 99.06 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 99.06 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 99.06 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 99.06 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 99.05 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 99.05 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 99.05 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 99.05 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 99.05 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 99.04 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 99.04 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 99.04 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.04 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.03 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 99.03 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 99.03 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 99.02 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 99.02 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 99.02 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 99.02 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 99.01 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 99.01 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 99.01 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 99.01 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 99.01 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 99.0 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 99.0 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 99.0 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 99.0 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 99.0 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 98.99 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 98.99 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 98.98 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 98.98 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 98.98 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 98.98 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 98.98 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 98.98 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 98.97 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 98.97 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 98.97 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 98.96 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 98.96 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 98.96 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 98.96 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 98.95 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 98.95 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 98.95 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 98.94 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 98.94 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 98.94 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 98.94 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 98.94 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 98.94 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 98.94 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 98.94 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 98.93 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 98.93 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 98.93 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 98.93 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 98.93 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 98.92 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 98.92 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 98.92 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 98.92 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 98.92 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 98.91 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 98.91 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 98.91 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 98.91 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 98.91 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 98.91 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 98.91 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 98.91 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 98.9 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 98.9 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 98.89 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 98.89 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 98.89 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 98.89 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 98.88 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 98.88 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 98.88 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 98.88 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 98.88 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 98.87 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 98.87 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 98.87 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 98.86 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 98.86 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 98.86 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 98.86 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 98.86 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 98.86 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 98.86 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 98.85 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 98.85 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 98.85 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 98.85 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 98.85 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 98.84 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 98.84 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 98.84 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 98.84 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 98.84 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 98.84 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 98.84 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 98.83 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 98.83 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 98.83 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 98.82 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 98.82 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 98.81 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 98.81 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 98.81 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 98.8 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 98.8 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 98.8 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 98.8 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 98.8 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 98.79 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 98.78 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 98.78 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 98.78 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 98.78 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 98.76 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 98.76 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 98.75 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 98.75 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 98.74 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 98.73 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 98.72 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 98.71 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 98.71 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 98.71 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 98.7 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 98.7 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 98.7 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 98.7 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 98.7 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 98.7 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 98.69 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 98.69 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 98.68 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 98.68 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 98.67 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 98.67 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 98.67 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 98.66 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 98.66 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 98.64 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 98.63 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 98.61 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 98.58 | |
| 1h8b_A | 75 | ACT-EF34, alpha-actinin 2, skeletal muscle isoform | 98.58 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 98.58 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 98.58 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 98.53 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 98.52 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 98.47 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 98.44 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 98.39 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 98.38 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 98.33 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 98.26 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 98.23 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 98.16 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 98.11 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 98.04 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 97.93 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 97.9 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 97.86 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 97.81 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 97.72 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 97.69 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 97.68 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 97.68 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 97.6 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 97.59 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 97.58 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 97.56 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 97.45 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 97.44 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 97.15 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 97.01 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 96.76 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 96.74 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 96.72 | |
| 1sra_A | 151 | Sparc; extracellular matrix protein, calcium-bindi | 96.72 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 96.62 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 96.57 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 96.54 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 96.48 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 96.41 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 96.4 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 96.36 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 96.29 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 96.27 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 96.24 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 96.22 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 96.2 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 96.17 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 96.14 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 96.06 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 96.03 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 96.02 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 96.01 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 95.89 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 95.85 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 95.83 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 95.81 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 95.73 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 95.65 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 95.56 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 95.54 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 95.47 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 95.46 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 95.43 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 95.41 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 95.39 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 95.35 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 95.32 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 95.17 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 95.06 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 95.02 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 94.89 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 94.88 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 94.86 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 94.79 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 94.62 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 94.57 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 94.4 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 94.39 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 94.27 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 94.21 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 94.2 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 93.82 | |
| 1tuz_A | 118 | Diacylglycerol kinase alpha; transferase, HR532, n | 93.73 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 93.43 | |
| 1tuz_A | 118 | Diacylglycerol kinase alpha; transferase, HR532, n | 92.68 | |
| 2fe0_A | 136 | SMP-1, small myristoylated protein 1; beta sheet, | 89.89 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 88.65 | |
| 1sra_A | 151 | Sparc; extracellular matrix protein, calcium-bindi | 88.22 |
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
Probab=100.00 E-value=2.5e-125 Score=1229.06 Aligned_cols=858 Identities=28% Similarity=0.532 Sum_probs=620.3
Q ss_pred CccccCCccccccccccccccCCCC--CCCHHHHHHHHHHcCCCeeCCCCCCCCCCCCCCCCCC----CCcceeecCccc
Q psy13030 31 NGHATRPDDKQSTLSRYWTVERPRQ--TANYHAIKRACREKGILYEDPDFPPGPKLLFRNKKAP----VQSLVWMRPHEM 104 (1218)
Q Consensus 31 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~l~~~c~~~~~~f~D~~Fp~~~~Sl~~~~~~~----~~~~~W~Rp~e~ 104 (1218)
.|+++.+...+....+.|+..++.+ +|+|++|++.|+++|.+|+||+|||+.+||+++..+| ...++|+||+||
T Consensus 2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~c~~~~~~f~D~~Fp~~~~sl~~~~~~~~~~~~~~~~W~Rp~e~ 81 (900)
T 1qxp_A 2 AGIAMKLAKDREAAEGLGSHERAIKYLNQDYETLRNECLEAGALFQDPAFPPVSHSLGFKELGPNSSKTYGIKWKRPTEL 81 (900)
T ss_dssp CCTHHHHHHHHHHTTTTTSSTTCBCGGGCCHHHHHHHHHTTTCCCCCSSSCSSSGGGCSSSSSSSCGGGCSCCCBCGGGS
T ss_pred cchhhhhhhccccccCCCCCcccccccccCHHHHHHHHHHcCCeeECcCCCCCccccccCCCCcccccccCceEEChHHH
Confidence 4667777788888888898888765 8999999999999999999999999999999887665 245999999999
Q ss_pred ccCCcccccCccccccccccCcCcchhhHHhhcccccCccccccCCCCCCCCCCCcccccccCCcccccCCCCCcccccc
Q psy13030 105 CQRPKFYSEDSLQGRFDFEAGRLGDAWFLAAISSLTLTPKFLDRVIPPEQSFDPATNYCGLFRPKFYSEDSLQGRFDFEA 184 (1218)
Q Consensus 105 ~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~p~~~~~~~~~~~~~lf~~~~~~~~~~~~~~dI~Q 184 (1218)
+++|+|+.++ + +|.||+|
T Consensus 82 ~~~~~~~~~~---------------~-----------------------------------------------~~~di~Q 99 (900)
T 1qxp_A 82 LSNPQFIVDG---------------A-----------------------------------------------TRTDICQ 99 (900)
T ss_dssp SSSCBSCCCC---------------C-----------------------------------------------SSCCCCC
T ss_pred ccCCeeeeCC---------------C-----------------------------------------------CcccccC
Confidence 9999998776 3 7899999
Q ss_pred CCCCCchHHHHHHHhccCcccccccccCCCCCCCCCCCCceEEEeeeeCCeEEEEEecccccccCCcEEEEecCCCCchh
Q psy13030 185 GRLGDAWFLAAISSLTLTPKFLDRVIPPEQSFDPATNYCGLFRFRFWHFGEWKEILVDDRLPTFQGRLVYLHSTNPTEFW 264 (1218)
Q Consensus 185 G~lGDCwllaAl~~La~~~~ll~~v~~~~q~~~~~~~~~G~y~~r~~~~G~w~~VvVDD~lP~~~g~~~f~~s~~~~e~W 264 (1218)
|.+||||||||||+||.+|++|++|||++|++. .+|+|+|+||||++|+|+.|+|||+|||.+|+|+|++|++++|+|
T Consensus 100 g~lgdcw~laal~~l~~~~~~~~~~~~~~~~~~--~~~~G~y~~~~~~~G~w~~V~vDD~lP~~~g~~~f~~s~~~~e~W 177 (900)
T 1qxp_A 100 GALGDSWLLAAIASLTLNETILHRVVPYGQSFQ--EGYAGIFHFQLWQFGEWVDVVVDDLLPTKDGKLVFVHSAQGNEFW 177 (900)
T ss_dssp CTTSCSTTHHHHHHHHTCHHHHHTTSCSSCCSS--TTCSSEEEEEEEETTEEEEEEEESCBCEETTEESSSCCSSSCBCH
T ss_pred CCcccHHHHHHHHHHhhCHHHHHhhcCCCcccc--cccCceEEEEEeECCEEEEEEECCcccccCCceeeeecCCCCcch
Confidence 999999999999999999999999999999887 789999999999999999999999999999999999999999999
Q ss_pred HHHHHHHhhcccCCcccccCCCChHHHHhhccCCeeEEEEccCCCccchHHHHHhhcCCCCeEEEecccchhHHHHHhhh
Q psy13030 265 AALLEKAYAKFYGCYENLTHGGSTTRALQDLTGGIVQSFALTNQDRYLTFQVLNSAVPRSSLLISSIKLEKEQKRQLRLR 344 (1218)
Q Consensus 265 ~~LLEKAyAKl~GsY~~l~~gg~~~~al~dlTG~~~~~~~l~~~~~~l~~~~l~~~~~~g~l~~~~~~~~~~~~~~~~~~ 344 (1218)
++||||||||+||||++| .||++.+||+||||++++.|.+++.+.++ |+.|.+++++|++|+|++..++....+....
T Consensus 178 ~~LlEKAyaK~~G~Y~~l-~gg~~~~~l~~lTG~~~~~~~~~~~~~~~-~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~ 255 (900)
T 1qxp_A 178 SALLEKAYAKVNGSYEAL-SGGCTSEAFEDFTGGVTEWYDLQKAPSDL-YQIILKALERGSLLGCSINISDIRDLEAITF 255 (900)
T ss_dssp HHHHHHHHHHHHSSSGGG-SSCCHHHHHHHTTSCBCCEEEGGGCCTTH-HHHHHHHHTTTCEEEEECCC---------CC
T ss_pred HHHHHHHHHHHhCCchhc-CCCCHHHHHHHhhCCCeEEEecCCChHHH-HHHHHHHHhCCCEEEEEecCCCccccchhhc
Confidence 999999999999999999 99999999999999999999999888889 9999999999999999986544333455688
Q ss_pred cCccccceeeeeeeEEEcCCCCcccEEEEECCCCCCcccCCCCCCCcccCCCCHHHHHHhCCccCCCCeeccchHHHHhh
Q psy13030 345 NGLITQHAYSVTGLARVRGPLGETPLVRLRNPWARGEWTGPWSERSWEWDGLSERDKELLSIRVSNDGEFWMSFEDFAKH 424 (1218)
Q Consensus 345 ~GLv~~HaYsV~~v~~v~~~~~~~~LvrLrNPWG~~eW~G~wsd~s~~W~~~~~~~~~~l~~~~~~dG~FWMs~~Df~~~ 424 (1218)
.||+.+|||+|+++.++..+++.++|||||||||+.||+|+|||+|++|+.++++++++|+... +||+|||+|+||+++
T Consensus 256 ~gl~~~haY~v~~~~~~~~~~~~~~lv~lrNPwg~~ew~G~wsd~s~~W~~~~~~~~~~l~~~~-~dg~Fwm~~~df~~~ 334 (900)
T 1qxp_A 256 KNLVRGHAYSVTDAKQVTYQGQRVNLIRMRNPWGEVEWKGPWSDNSYEWNKVDPYEREQLRVKM-EDGEFWMSFRDFIRE 334 (900)
T ss_dssp CCC---CCCEEEEEEECCCSSSCCEEEEEECTTCCCCCSCSCC-CCSCSSSSCCTHHHHTTCCC-CSSCCCCBSTTSSSC
T ss_pred CCCCCCceEEEeEEEEEecCCCceEEEEEeCCCCCCCcCCCCCCCCcccccCCHHHHHHhCCCC-CCCeEEeEHHHHHhh
Confidence 9999999999999999987677899999999999999999999999999999889999998875 999999999999999
Q ss_pred ccccceeeeCCCCCCCcccccCCCCcEEEeeeeeeeecccCCCCCCccCCccCCCeEEEEeccCC--------CCceEEE
Q psy13030 425 FTHLDLVHVGPDDWMAEPALQSKQPWRAVLARRRWRTGYNAGGGPNFVETTSVNPQFHIQIPRSS--------NNKCHVV 496 (1218)
Q Consensus 425 F~~l~ic~~~p~~~~~~~~~~~~~~W~~~~~~G~W~~g~taGG~~n~~~Tf~~NPQy~l~l~~~~--------~~~~~V~ 496 (1218)
|+.|+||+++|+.+.+. ...+|+...++|+|++|.|||||+|+++|||+||||.|+|.++. ..+|+|+
T Consensus 335 F~~~~ic~~~~~~~~~~----~~~~w~~~~~~g~W~~g~taGG~~~~~~tf~~NPqf~l~v~~~~~~~~~~~~~~~~~v~ 410 (900)
T 1qxp_A 335 FTKLEICNLTPDALKSR----TLRNWNTTFYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEEVDDADDYDSRESGCSFL 410 (900)
T ss_dssp SEEEEEBCCCC--CCSS----CSCCCBCCEEEEEECTTTTCCCCTTCTTTGGGSCBCEEEECSCCC-----CCSSCCEEE
T ss_pred CCeEEEEEecchhhccc----cCCceEEEeccccccCCCCCCCCCCcccccccCceEEEEEccCCccccccccCCCcEEE
Confidence 99999999999988644 34789999999999999999999999999999999999998533 2469999
Q ss_pred EEEeecccchhhhhccCceeeEEEEEEEEcCC----CcccCcccccccCCCccCCccc-eeeeEEEEEecCCCeEEeecc
Q psy13030 497 VSVTQYYETQVDEKQKRTLYAIGFAVYEISSS----MTRLTPQFVAHTKPLDVTNHSV-AREVVTFFTLPPGDFIVVPQT 571 (1218)
Q Consensus 497 VsL~Q~~~R~~~~~~~~~~~~Igf~V~kv~~~----~~~l~~~~f~~~~~~~~s~~~~-~ReVs~r~~L~PG~YvIIPsT 571 (1218)
|+|+|+++|. .++.+..+.+|||+||+++.. ..++++.||..+.+++.+..|. .|||++++.|+||+|+|||+|
T Consensus 411 i~L~Q~~~r~-~~~~~~~~~~igf~v~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~Rev~~~~~L~pG~Y~IVPst 489 (900)
T 1qxp_A 411 LALMQKHRRR-ERRFGRDMETIGFAVYQVPRELAGQPVHLKRDFFLANASRAQSEHFINLREVSNRIRLPPGEYIVVPST 489 (900)
T ss_dssp EEEEEC-----------CCCCEEEEEEECCSCC----CCCCHHHHTTSCCCSBCSSCBSSSCEEEEEECCSEEEEEEEEE
T ss_pred EEeeeccccc-ccccCCCceeeEEEEEEeccccccccccCChhhhccCCCccccCCccccCceeEeEEeCCCCEEEEeec
Confidence 9999999998 666777889999999999652 2478889999888888999999 999999999999999999999
Q ss_pred CCCCCCcceeEEEecccccceeeecCCCCCCCCCCeeeeeeccCcccccccCccccccccccc-cccccCccChhhHHHH
Q psy13030 572 NVPDCDGKFLLRIFTDEQRDFIVVPQTNVPDCDGKFLLRIFTDEQSNIWEVNEDNMVFRNIST-EFLENTVVLPDGKSLV 650 (1218)
Q Consensus 572 ~~p~~~~~f~l~~~~~~~~~~~~~~~~~~~~~e~~F~LRVfS~~~~~~~e~~~~~~~~~~~~~-~~~~~~~~~~~~~~lF 650 (1218)
|+|+ ++++|+|||||.++....++++ .+....++ ....+.++..+++.+|
T Consensus 490 ~~p~---------------------------~e~~F~Lrv~s~~~~~~~eld~--~~~~~~~~~~~l~~~e~~~~l~~~F 540 (900)
T 1qxp_A 490 FEPN---------------------------KEGDFLLRFFSEKKAGTQELDD--QIQANLPDEKVLSEEEIDDNFKTLF 540 (900)
T ss_dssp SSSS---------------------------CCEEEEEEEEESSCEEECCBCC--CCEESCC------------------
T ss_pred CCCC---------------------------CCCCceEEEeccCCcceeecCc--cccccCCcccCCCcchHHHHHHHHH
Confidence 9999 9999999999999999888877 44443332 1233444467899999
Q ss_pred HHHhcCCCCccCHHHHHHHHhhhcc------CcccccCCCceeeeeeccCCCCccChHHHHHHHHHHHHHhhhccccceE
Q psy13030 651 AKLLVKYPLEVDVSQFQKILRSHWK------ENTVVLPDGKSLVAKLLVKYPLEVDVSQFQKILRSHWKEKLEGIKNNVL 724 (1218)
Q Consensus 651 ~~~ag~~d~ei~a~eLq~~Ln~~~~------~~~~~~~~crs~v~~~d~~~~g~l~~~ef~~l~~~~w~~~~~~~~~~~~ 724 (1218)
.++++. ++.|++.||+.+|+.... ...++.+.|+.|++++|.+++|++++.||..+ |. .+..++.-|-
T Consensus 541 ~~~D~~-dG~Is~~El~~~L~~~~~~~~~~~~~~~s~~~~~~l~~~~D~d~~G~I~~~EF~~~----~~-~~~~l~~~F~ 614 (900)
T 1qxp_A 541 SKLAGD-DMEISVKELQTILNRIISKHKDLRTNGFSLESCRSMVNLMDRDGNGKLGLVEFNIL----WN-RIRNYLTIFR 614 (900)
T ss_dssp CCCCCS-SSSCCCSCTTTTTCC---------CCCCCHHHHHHHHHHHCC--CCCCCSSSHHHH----HH-HHHHHHHHHG
T ss_pred HHHcCC-CCcCCHHHHHHHHHHhhcccccccCCCCCHHHHHHHHHHhCCCCCCcCCHHHHHHH----HH-HHHHHHHHHH
Confidence 999977 899999999999998653 23577888999999999999999999999999 55 2233333333
Q ss_pred EEEecCCchhHHHhhhhcCCceecchhhhccceeeeCCCCCcceeeecCCCCcCcccccCCCCCcccccCCHHHHHhhcc
Q psy13030 725 TVLILPDGKSLVAKLLVKYPLEVDHAYSVTGLARVRGPLGETPLVRLRNPWARGEWTGPWSERSWEWDGLSERDKELLSI 804 (1218)
Q Consensus 725 ~~~~~~~~~~~~~~~~~~~~~~~~hays~~~~~~~~~~~~~~~l~~lrnp~g~~~w~G~wsd~s~~w~~~~~~~~~~l~~ 804 (1218)
.++.+.+|.....++ +...... | ..++++..+.|..
T Consensus 615 ~~D~d~~G~Is~~El--------------------------------~~~l~~~---g---------~~l~~~~~~~l~~ 650 (900)
T 1qxp_A 615 KFDLDKSGSMSAYEM--------------------------------RMAIEAA---G---------FKLPCQLHQVIVA 650 (900)
T ss_dssp GGCTTCCSCCBHHHH--------------------------------HHHHHHT---T---------EECCHHHHHHHHH
T ss_pred hhCCCCCCeECHHHH--------------------------------HHHHHHh---C---------CCCCHHHHHHHHH
Confidence 444444444443333 3322222 3 3455666677777
Q ss_pred eecCCCccccCHHHHHhhcceeeeeecccCccccccccccCcCCccccccCCCCcccccccccccccccccccCCCCccc
Q psy13030 805 RVSNDGEFWMSFEDFAKHFTHLDLVHVQMTGWRSLRYNQNNLGELSWLAEDGGPVTMLEAARISFYGCYENLTHGGSTTR 884 (1218)
Q Consensus 805 ~~~~~g~f~m~f~df~~~~~~~~~~~~~~~~w~sl~~~~~~~g~~~W~r~~~~p~e~~~~~~~~~~~~~~~~~~~~s~~d 884 (1218)
++. ||..-|+|++|+.++.+++..+- ... .++.+..|.+.
T Consensus 651 ~~d-d~dg~I~~~eF~~~~~~~~~l~~---~F~--~~D~d~~G~It---------------------------------- 690 (900)
T 1qxp_A 651 RFA-DDELIIDFDNFVRCLVRLEILFK---IFK--QLDPENTGTIQ---------------------------------- 690 (900)
T ss_dssp HTS-CSSSBCCHHHHHHHHHHHHHHHH---HHH--HSCSSCCSCEE----------------------------------
T ss_pred HhC-CCCCeEcHHHHHHHHHHHHHHHH---HHH--hhCCCCCceEE----------------------------------
Confidence 776 77889999999998876521110 000 01111001000
Q ss_pred ccchhhhHHHHHhhcccCccccceecccCCCCcceEEEccCCeEEEEEecCCCCCCCCcEEEEccCCCCchHHHHHHHhh
Q psy13030 885 ALQDLTGGIVQSFALTNQDRYLTFQVLNSAVPRSSLLISSIKLWKEILVDDRLPTFQGRLVYLHSTNPTEFWAALLEKAY 964 (1218)
Q Consensus 885 i~Qg~lGd~vAsla~~a~~~~~~~~~~~~~~~~~~v~l~~~G~w~~V~IDD~lP~~~g~~~f~~s~~~~e~W~~LlEKAy 964 (1218)
+ ..-++++................ . ... ......... -...-++++|
T Consensus 691 ~---~~~efl~~~~~~~~~~~~~~~~~------------------~------~~~-~~~~~~~~~-----~~~~~l~~~F 737 (900)
T 1qxp_A 691 L---DLISWLSFSVLGKLAAAIEHHHH------------------H------HMH-YSNIEANES-----EEERQFRKLF 737 (900)
T ss_dssp E---EHHHHHHHTCC--------------------------------------CC-CCCC-------------------C
T ss_pred e---cHHHHHHHhhhcccccccccccc------------------c------ccc-ccCCCCCCh-----HHHHHHHHHH
Confidence 0 00011111100000000000000 0 000 000000000 0000122223
Q ss_pred hcccCCcccccCCCChHHHHhhccCCeeEEEECcCcChhhHHHHHHHhCCCCCEEEEcccCchHHHHhhhhcCCCccCCc
Q psy13030 965 AKFYGCYENLTHGGSTTRALQDLTGGIVQSFALTNQDRYLTFQVLNSAVPRSSLLISSIKLEKEQKRQLRLRNGLITQHA 1044 (1218)
Q Consensus 965 AKl~G~Y~~l~~gg~~~~aL~~LTG~~~~~~~l~~~~~~~~~~~l~~~~~~~~li~~~~~~~~~~~~~~~~~~GLv~~Ha 1044 (1218)
.++-.. . | .++ . ..+.+.+.. .|
T Consensus 738 ~~~D~~----~-G------------~Is---------~----~El~~~L~~---------------------~~------ 760 (900)
T 1qxp_A 738 VQLAGD----D-M------------EVS---------A----TELMNILNK---------------------VV------ 760 (900)
T ss_dssp CCCTTC----S-S------------CBC---------H----HHHTTTSCC-----------------------------
T ss_pred HHhcCC----C-C------------ccC---------H----HHHHHHHHH---------------------hc------
Confidence 222110 0 0 000 0 001111110 00
Q ss_pred eeeccEEEEccCCCeeeEEEEeCCCCCCccCCccccccccchhhhccCCcccccceeeeeeccCCCcccccccHHHHHHH
Q psy13030 1045 YSVTGLARVRGPLGETPLVRLRNPWARGEWTGPWSEFFLNFSAYLLEKPSLDMCKSLIMLRDTNISGRLNLLDIPLLMHM 1124 (1218)
Q Consensus 1045 YsVl~~~~~~~~~~~~rlv~LrNPWg~~ew~G~ws~fwm~~~df~~~f~sl~icr~li~~~D~d~~G~i~f~eF~~l~~~ 1124 (1218)
. ++-. ....-.+.+.|+.|+..+|.|++|.|+|+||..+|..
T Consensus 761 --------------------~-~~~~-----------------~~~~~~s~~~~~~l~~~~D~d~dG~Is~~EF~~l~~~ 802 (900)
T 1qxp_A 761 --------------------T-RHPD-----------------LKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNN 802 (900)
T ss_dssp -----------------------CCS-----------------CC--CCCHHHHHHHHHHHCCSSSSSBCSHHHHHHHHH
T ss_pred --------------------c-cccc-----------------cccCCCCHHHHHHHHHHHCCCCCCeECHHHHHHHHHH
Confidence 0 0000 0001124457888999999999999999999999999
Q ss_pred hHHHHHHHHhccCCCCCcCCHhhHHHHHHhcCCCCCHHHHHHHHHHhC-CCCCcCHHHHHHHHHHHHHhcCCCchhhhHh
Q psy13030 1125 LQFWRIAFQKFEKGARSRLSSYSLRPLLWEAGSTVSNKVLECLVLRFT-KNKVLTWENFIMAMVRLHLAHGHPNDYLFLT 1203 (1218)
Q Consensus 1125 ~~~~~~~F~~fD~d~~G~I~~~EL~~aL~~lG~~ls~~ei~~li~~~d-~dG~i~f~eFv~~~~~l~~~~~~~~~~~~~~ 1203 (1218)
+..++.+|+.||+|++|+|+..||+.+|+.+|..+++++++.|+.++| +||.|+|+||+.++.++...
T Consensus 803 ~~~l~~~F~~~D~d~dG~Is~~El~~~l~~~g~~ls~~~~~~l~~~~dd~dg~Is~~EF~~~~~~l~~~----------- 871 (900)
T 1qxp_A 803 IKKWQGIYKRFETDRSGTIGSNELPGAFEAAGFHLNQHIYSMIIRRYSDETGNMDFDNFISCLVRLDAM----------- 871 (900)
T ss_dssp HHHHSSCC----CCSCC-------CCTTGGGTCCCCSCCCC--------CCSCCCHHHHHHHHHHHHHH-----------
T ss_pred HHHHHHHHHHhCCCCCCccCHHHHHHHHHhcCCCCCHHHHHHHHHHhcCCCCeECHHHHHHHHHHHHHH-----------
Confidence 999999999999999999999999999999999999999999999999 88999999999999887654
Q ss_pred hhccccccCCCCCcC
Q psy13030 1204 LFMFKKTDVDQIGEV 1218 (1218)
Q Consensus 1204 ~~~F~~~D~d~~G~I 1218 (1218)
.++|+.+|++++|.|
T Consensus 872 ~~~F~~~D~~~~G~i 886 (900)
T 1qxp_A 872 FRAFRSLDKNGTGQI 886 (900)
T ss_dssp HHHHHHHTTTCCSEE
T ss_pred HHHHHHhCcCCCCeE
Confidence 788999999999975
|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >2r9f_A Calpain-1 catalytic subunit; protease, peptidase, inhibitor, alpha-ketoamide, hydrolase, thiol protease; HET: K2Z; 1.60A {Rattus norvegicus} SCOP: d.3.1.3 PDB: 1tlo_A* 2g8e_A* 1tl9_A* 2nqg_A* 2nqi_A* 2r9c_A* 2g8j_A* 1kxr_A 2ary_A 1zcm_A* 1mdw_A | Back alignment and structure |
|---|
| >1ziv_A Calpain 9; cysteine protease, papain, calcium-dependent, thiol protease, structural genomics consortium, SGC, hydrolase; 2.31A {Homo sapiens} SCOP: d.3.1.3 PDB: 2p0r_A* | Back alignment and structure |
|---|
| >2nqa_A Calpain 8; calpain, calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC; HET: AR7; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >1ziv_A Calpain 9; cysteine protease, papain, calcium-dependent, thiol protease, structural genomics consortium, SGC, hydrolase; 2.31A {Homo sapiens} SCOP: d.3.1.3 PDB: 2p0r_A* | Back alignment and structure |
|---|
| >2r9f_A Calpain-1 catalytic subunit; protease, peptidase, inhibitor, alpha-ketoamide, hydrolase, thiol protease; HET: K2Z; 1.60A {Rattus norvegicus} SCOP: d.3.1.3 PDB: 1tlo_A* 2g8e_A* 1tl9_A* 2nqg_A* 2nqi_A* 2r9c_A* 2g8j_A* 1kxr_A 2ary_A 1zcm_A* 1mdw_A | Back alignment and structure |
|---|
| >2nqa_A Calpain 8; calpain, calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC; HET: AR7; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2qfe_A Calpain-7; C2-like domain, hydrolase, nuclear protein, protease, thiol protease; 1.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2fe0_A SMP-1, small myristoylated protein 1; beta sheet, protein transport, membrane protein; NMR {Leishmania major} SCOP: b.134.1.1 | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1218 | ||||
| d1ziva1 | 310 | d.3.1.3 (A:28-337) Calpain large subunit, catalyti | 9e-82 | |
| d1ziva1 | 310 | d.3.1.3 (A:28-337) Calpain large subunit, catalyti | 2e-38 | |
| d1ziva1 | 310 | d.3.1.3 (A:28-337) Calpain large subunit, catalyti | 1e-26 | |
| d1ziva1 | 310 | d.3.1.3 (A:28-337) Calpain large subunit, catalyti | 0.002 | |
| d2r9fa1 | 322 | d.3.1.3 (A:33-354) Calpain large subunit, catalyti | 3e-76 | |
| d2r9fa1 | 322 | d.3.1.3 (A:33-354) Calpain large subunit, catalyti | 1e-38 | |
| d2r9fa1 | 322 | d.3.1.3 (A:33-354) Calpain large subunit, catalyti | 3e-26 | |
| d2r9fa1 | 322 | d.3.1.3 (A:33-354) Calpain large subunit, catalyti | 0.001 | |
| d1mdwa_ | 323 | d.3.1.3 (A:) Calpain large subunit, catalytic doma | 7e-76 | |
| d1mdwa_ | 323 | d.3.1.3 (A:) Calpain large subunit, catalytic doma | 5e-40 | |
| d1mdwa_ | 323 | d.3.1.3 (A:) Calpain large subunit, catalytic doma | 7e-26 | |
| d1mdwa_ | 323 | d.3.1.3 (A:) Calpain large subunit, catalytic doma | 4e-05 | |
| d1qxpa3 | 159 | b.14.1.1 (A:356-514) Calpain large subunit, middle | 2e-29 | |
| d1df0a2 | 159 | b.14.1.1 (A:356-514) Calpain large subunit, middle | 9e-29 | |
| d1k94a_ | 165 | a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta | 6e-14 | |
| d1qxpa2 | 188 | a.39.1.8 (A:515-702) Calpain large subunit, C-term | 5e-12 | |
| d1juoa_ | 172 | a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: | 4e-10 | |
| d1df0a1 | 186 | a.39.1.8 (A:515-700) Calpain large subunit, C-term | 3e-07 |
| >d1ziva1 d.3.1.3 (A:28-337) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), calpain 9 [TaxId: 9606]} Length = 310 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Calpain large subunit, catalytic domain (domain II) domain: Calpain large subunit, catalytic domain (domain II) species: Human (Homo sapiens), calpain 9 [TaxId: 9606]
Score = 267 bits (684), Expect = 9e-82
Identities = 131/376 (34%), Positives = 188/376 (50%), Gaps = 67/376 (17%)
Query: 58 NYHAIKRACREKGILYEDPDFPPGPKLLFRNKKAPVQSLVWMRPHEMCQRPKFYSEDSLQ 117
++ +++ C ++G L+ED DFP LF +++ + VW RP ++
Sbjct: 1 SFEQMRQECLQRGTLFEDADFPASNSSLFYSERPQIP-FVWK-------RPGEIVKN--- 49
Query: 118 GRFDFEAGRLGDAWFLAAISSLTLTPKFLDRVIPPEQSFDPATNYCGLFRPKFYSEDSLQ 177
P+F+
Sbjct: 50 -------------------------PEFILGGATR------------------------- 59
Query: 178 GRFDFEAGRLGDAWFLAAISSLTLTPKFLDRVIPPEQSFDPATNYCGLFRFRFWHFGEWK 237
D G LGD W LAAI+SLTL K L RVIP +QSF P Y G+F F+FW EW
Sbjct: 60 --TDICQGELGDCWLLAAIASLTLNQKALARVIPQDQSFGP--GYAGIFHFQFWQHSEWL 115
Query: 238 EILVDDRLPTFQGRLVYLHSTNPTEFWAALLEKAYAKFYGCYENLTHGGSTTRALQDLTG 297
++++DDRLPTF+ RLV+LHS + EFW+ALLEKAYAK G YE L GGS A++D TG
Sbjct: 116 DVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEAL-KGGSAIEAMEDFTG 174
Query: 298 GIVQSFALTNQDRYLTFQVLNSAVPRSSLLISSIKLEKEQKRQLRLRNGLITQHAYSVTG 357
G+ ++F +++L A+ R SLL I + + R GLI HAYSVTG
Sbjct: 175 GVAETFQTKEAPENF-YEILEKALKRGSLLGCFIDTRSAAESEARTPFGLIKGHAYSVTG 233
Query: 358 LARVRGPLGETPLVRLRNPWARGEWTGPWSERSWEWDGLSERDKELLSIRVSNDGEFWMS 417
+ +V L+R+RNPW + EW G WS+ S EW + +++ L +DGEFWM+
Sbjct: 234 IDQVSFRGQRIELIRIRNPWGQVEWNGSWSDSSPEWRSVGPAEQKRLCHTALDDGEFWMA 293
Query: 418 FEDFAKHFTHLDLVHV 433
F+DF HF +++ ++
Sbjct: 294 FKDFKAHFDKVEICNL 309
|
| >d1ziva1 d.3.1.3 (A:28-337) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), calpain 9 [TaxId: 9606]} Length = 310 | Back information, alignment and structure |
|---|
| >d1ziva1 d.3.1.3 (A:28-337) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), calpain 9 [TaxId: 9606]} Length = 310 | Back information, alignment and structure |
|---|
| >d1ziva1 d.3.1.3 (A:28-337) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), calpain 9 [TaxId: 9606]} Length = 310 | Back information, alignment and structure |
|---|
| >d2r9fa1 d.3.1.3 (A:33-354) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 322 | Back information, alignment and structure |
|---|
| >d2r9fa1 d.3.1.3 (A:33-354) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 322 | Back information, alignment and structure |
|---|
| >d2r9fa1 d.3.1.3 (A:33-354) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 322 | Back information, alignment and structure |
|---|
| >d2r9fa1 d.3.1.3 (A:33-354) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 322 | Back information, alignment and structure |
|---|
| >d1mdwa_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 323 | Back information, alignment and structure |
|---|
| >d1mdwa_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 323 | Back information, alignment and structure |
|---|
| >d1mdwa_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 323 | Back information, alignment and structure |
|---|
| >d1mdwa_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 323 | Back information, alignment and structure |
|---|
| >d1qxpa3 b.14.1.1 (A:356-514) Calpain large subunit, middle domain (domain III) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
| >d1df0a2 b.14.1.1 (A:356-514) Calpain large subunit, middle domain (domain III) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1218 | |||
| d2r9fa1 | 322 | Calpain large subunit, catalytic domain (domain II | 100.0 | |
| d1mdwa_ | 323 | Calpain large subunit, catalytic domain (domain II | 100.0 | |
| d1ziva1 | 310 | Calpain large subunit, catalytic domain (domain II | 100.0 | |
| d1ziva1 | 310 | Calpain large subunit, catalytic domain (domain II | 100.0 | |
| d2r9fa1 | 322 | Calpain large subunit, catalytic domain (domain II | 100.0 | |
| d1mdwa_ | 323 | Calpain large subunit, catalytic domain (domain II | 100.0 | |
| d1df0a2 | 159 | Calpain large subunit, middle domain (domain III) | 99.96 | |
| d1qxpa3 | 159 | Calpain large subunit, middle domain (domain III) | 99.95 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 99.81 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 99.76 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 99.68 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 99.67 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 99.65 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 99.54 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 99.51 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 99.39 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.38 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 99.22 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 99.21 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.21 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.2 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 99.2 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.2 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 99.19 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 99.19 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 99.19 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 99.19 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.18 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.17 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 99.16 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 99.16 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.15 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 99.14 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 99.14 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 99.13 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 99.13 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 99.13 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 99.13 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 99.12 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.12 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 99.12 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 99.1 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.1 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 99.09 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 99.03 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 99.03 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 99.02 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 99.02 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 98.94 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.94 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 98.93 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 98.9 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 98.89 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 98.88 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 98.88 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 98.87 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 98.87 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 98.87 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 98.86 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 98.86 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 98.84 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 98.84 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.83 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.82 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 98.81 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 98.79 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 98.79 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 98.79 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 98.79 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.78 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 98.77 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 98.76 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 98.75 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 98.74 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 98.72 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 98.71 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 98.7 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 98.69 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 98.67 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 98.67 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 98.66 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 98.64 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 98.64 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 98.61 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 98.59 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 98.58 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 98.56 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 98.56 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 98.56 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 98.55 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 98.54 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 98.53 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 98.52 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 98.51 | |
| d1xk4a1 | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.5 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 98.49 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 98.47 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 98.44 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 98.43 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 98.42 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 98.41 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 98.38 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 98.34 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.32 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 98.28 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 98.27 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 98.27 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 98.26 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 98.24 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 98.2 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 98.2 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 98.17 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 98.16 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 98.12 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 98.11 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 98.03 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 97.93 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 97.85 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 97.83 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 97.76 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 97.67 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 97.55 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 97.54 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 97.37 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 97.34 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 97.34 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 97.31 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 97.16 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 97.1 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 97.0 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 97.0 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 96.95 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 96.91 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 96.88 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 96.87 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 96.81 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 96.79 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 96.77 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 96.72 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 96.71 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 96.66 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 96.51 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 96.5 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 96.45 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 96.41 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 96.38 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 96.35 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 96.34 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 96.29 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 96.24 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 96.23 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 96.12 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 96.1 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 96.09 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 96.08 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 95.95 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 95.92 | |
| d1xk4a1 | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 95.83 | |
| d1tuza_ | 118 | Diacylglycerol kinase alpha, N-terminal domain {Hu | 94.81 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 94.58 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 93.99 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 93.99 | |
| d1tuza_ | 118 | Diacylglycerol kinase alpha, N-terminal domain {Hu | 93.94 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 93.54 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 93.21 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 93.09 | |
| d1j7qa_ | 86 | Calcium vector protein {Amphioxus (Branchiostoma l | 92.25 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 91.92 | |
| d2fe0a1 | 131 | Small myristoylated protein 1, Smp-1 {Leishmania m | 88.15 | |
| d1qasa1 | 94 | Phosphoinositide-specific phospholipase C, isozyme | 84.41 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 83.61 | |
| d1sraa_ | 151 | C-terminal (EC) domain of BM-40/SPARC/osteonectin | 80.51 | |
| d1r75a_ | 121 | Unnamed hypothetical protein {Leishmania major [Ta | 80.13 |
| >d2r9fa1 d.3.1.3 (A:33-354) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Calpain large subunit, catalytic domain (domain II) domain: Calpain large subunit, catalytic domain (domain II) species: Rat (Rattus norvegicus), mu-type [TaxId: 10116]
Probab=100.00 E-value=3.5e-76 Score=674.56 Aligned_cols=312 Identities=42% Similarity=0.830 Sum_probs=288.8
Q ss_pred CCCHHHHHHHHHHcCCCeeCCCCCCCCCCCCCCCCCC----CCcceeecCcccccCCcccccCccccccccccCcCcchh
Q psy13030 56 TANYHAIKRACREKGILYEDPDFPPGPKLLFRNKKAP----VQSLVWMRPHEMCQRPKFYSEDSLQGRFDFEAGRLGDAW 131 (1218)
Q Consensus 56 ~~~~~~l~~~c~~~~~~f~D~~Fp~~~~Sl~~~~~~~----~~~~~W~Rp~e~~~~p~~~~~~~~~~~~~~~~~~~~~~~ 131 (1218)
+|+|++|++.|+++|.+|+||+|||+..||+..+..+ ...++|+||+||+++|+|+.++ +
T Consensus 7 ~q~~~~i~~~c~~~~~~f~D~~Fpp~~~Sl~~~~~~~~~~~~~~i~W~Rp~e~~~~~~~~~~~---------------~- 70 (322)
T d2r9fa1 7 GQDYENLRARCLQNGVLFQDDAFPPVSHSLGFKELGPNSSKTYGIKWKRPTELLSNPQFIVDG---------------A- 70 (322)
T ss_dssp GCCHHHHHHHHHHTTCCCCCTTSCSSHHHHCSSTTSTTSHHHHHCEEECHHHHCSSCBSCSSC---------------S-
T ss_pred CcCHHHHHHHHHHcCCeeECcCCcCCccccccCcCCccccccCCcEEECcHHhcCCCeEEeCC---------------C-
Confidence 7999999999999999999999999999999876544 3458999999999999887665 3
Q ss_pred hHHhhcccccCccccccCCCCCCCCCCCcccccccCCcccccCCCCCccccccCCCCCchHHHHHHHhccCccccccccc
Q psy13030 132 FLAAISSLTLTPKFLDRVIPPEQSFDPATNYCGLFRPKFYSEDSLQGRFDFEAGRLGDAWFLAAISSLTLTPKFLDRVIP 211 (1218)
Q Consensus 132 ~~~~~~~~~~~~~~~~r~~p~~~~~~~~~~~~~lf~~~~~~~~~~~~~~dI~QG~lGDCwllaAl~~La~~~~ll~~v~~ 211 (1218)
++.||+||.+|||||||||++||++|.++.++||
T Consensus 71 ----------------------------------------------~~~di~QG~lgDC~llsal~~la~~~~~~~~i~~ 104 (322)
T d2r9fa1 71 ----------------------------------------------TRTDICQGALGDCWLLAAIASLTLNETILHRVVP 104 (322)
T ss_dssp ----------------------------------------------CGGGCBCCSSSCHHHHHHHHHHTTCHHHHHHHSC
T ss_pred ----------------------------------------------CcccccCCCcCCEEHHHHHHHHHcChhhhhccCC
Confidence 7889999999999999999999999999999999
Q ss_pred CCCCCCCCCCCCceEEEeeeeCCeEEEEEecccccccCCcEEEEecCCCCchhHHHHHHHhhcccCCcccccCCCChHHH
Q psy13030 212 PEQSFDPATNYCGLFRFRFWHFGEWKEILVDDRLPTFQGRLVYLHSTNPTEFWAALLEKAYAKFYGCYENLTHGGSTTRA 291 (1218)
Q Consensus 212 ~~q~~~~~~~~~G~y~~r~~~~G~w~~VvVDD~lP~~~g~~~f~~s~~~~e~W~~LLEKAyAKl~GsY~~l~~gg~~~~a 291 (1218)
..+++. +++.|+|+|+||.+|+|+.|+|||+|||.+|+++|++|.+++|+|++||||||||+||||++| .||++.+|
T Consensus 105 ~~~~~~--~~~~G~y~v~l~~~G~w~~V~VDD~lP~~~g~~~~~~~~~~~e~W~~LlEKAyAKl~GsY~~l-~gG~~~~a 181 (322)
T d2r9fa1 105 YGQSFQ--EGYAGIFHFQLWQFGEWVDVVVDDLLPTKDGKLVFVHSAQGNEFWSALLEKAYAKVNGSYEAL-SGGCTSEA 181 (322)
T ss_dssp SCCCSS--TTCCSEEEEEEEETTEEEEEEEESCEEEETTEESSCBCSSTTBCHHHHHHHHHHHHHTSSGGG-SSCCHHHH
T ss_pred cCcccc--cCcceeEEEEEeeCCeeEEEEecCceeccCCCEeeeecCCCCccHHHHHHHHHHHHhCCcccc-CCCCHHHH
Confidence 888766 788999999999999999999999999999999999999999999999999999999999999 99999999
Q ss_pred HhhccCCeeEEEEccCCCccchHHHHHhhcCCCCeEEEecccchhHHHHHhhhcCccccceeeeeeeEEEcCCCCcccEE
Q psy13030 292 LQDLTGGIVQSFALTNQDRYLTFQVLNSAVPRSSLLISSIKLEKEQKRQLRLRNGLITQHAYSVTGLARVRGPLGETPLV 371 (1218)
Q Consensus 292 l~dlTG~~~~~~~l~~~~~~l~~~~l~~~~~~g~l~~~~~~~~~~~~~~~~~~~GLv~~HaYsV~~v~~v~~~~~~~~Lv 371 (1218)
|++|||++++.++++..+.++ |+.|.+++++|++|+|++........+.....||+.+|||+|++++++..++..++||
T Consensus 182 L~~LTG~~~~~~~~~~~~~~~-~~~l~~~~~~g~~~~~~~~~~~~~~~e~~~~~GLv~~HaYsVl~v~~~~~~~~~~~Lv 260 (322)
T d2r9fa1 182 FEDFTGGVTEWYDLQKAPSDL-YQIILKALERGSLLGCSINISDIRDLEAITFKNLVRGHAYSVTDAKQVTYQGQRVNLI 260 (322)
T ss_dssp HHHTTCCEEEEEEGGGCCTTH-HHHHHHHHHHTCEEEEECCCSSSSTTCSBCTTSCBTTCCEEEEEEEEEEETTEEEEEE
T ss_pred HHHhcCCCcEEEEcccCchhH-HHHHHHHHHCCCceEEEEecCCccchhhhhhcCCcCCcceEEEEEEEEeeCCCcEEEE
Confidence 999999999999999888889 9999999999999999987654433444566899999999999999988777789999
Q ss_pred EEECCCCCCcccCCCCCCCcccCCCCHHHHHHhCCccCCCCeeccchHHHHhhccccceeeeC
Q psy13030 372 RLRNPWARGEWTGPWSERSWEWDGLSERDKELLSIRVSNDGEFWMSFEDFAKHFTHLDLVHVG 434 (1218)
Q Consensus 372 rLrNPWG~~eW~G~wsd~s~~W~~~~~~~~~~l~~~~~~dG~FWMs~~Df~~~F~~l~ic~~~ 434 (1218)
|||||||+.||+|+|||.|++|+.+++..++.+.... +||+|||+|+||+++|+.|+||+++
T Consensus 261 ~LRNPwg~~ew~G~ws~~s~~W~~~~~~~~~~~~~~~-ddG~FWms~~df~~~F~~v~vC~~~ 322 (322)
T d2r9fa1 261 RMRNPWGEVEWKGPWSDNSYEWNKVDPYEREQLRVKM-EDGEFWMSFRDFIREFTKLEICNLT 322 (322)
T ss_dssp EEECTTSCCCCCSTTSTTCGGGGGSCHHHHHHHCCCC-CSSEEEEEHHHHHHHCCEEEEEECC
T ss_pred EEECCCCCCcccCCCCCCChhhccCCHHHHHhcCCCC-CCCEEEeEHHHHHHhCCceEEEeCC
Confidence 9999999999999999999999999999998888765 8999999999999999999999974
|
| >d1mdwa_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ziva1 d.3.1.3 (A:28-337) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), calpain 9 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ziva1 d.3.1.3 (A:28-337) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), calpain 9 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r9fa1 d.3.1.3 (A:33-354) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mdwa_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1df0a2 b.14.1.1 (A:356-514) Calpain large subunit, middle domain (domain III) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qxpa3 b.14.1.1 (A:356-514) Calpain large subunit, middle domain (domain III) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fe0a1 b.134.1.1 (A:1-131) Small myristoylated protein 1, Smp-1 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r75a_ b.134.1.1 (A:) Unnamed hypothetical protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|